Autonomn­ nervov½ syst©m:

  • View
    42

  • Download
    0

Embed Size (px)

DESCRIPTION

Autonomní nervový systém:. Hlavní funkce:. kontrakce a relaxace hladkých svalů funkce všech exokrinních a některých endokrinních žláz srdeční rytmus některé metabolické pochody. parasympatikus. sympatikus. Dopamin. Biosytéza katecholaminů:. Receptor-efektorový systém:. - PowerPoint PPT Presentation

Text of Autonomn­ nervov½ syst©m:

  • Autonomn nervov systm:

  • Hlavn funkce:kontrakce a relaxace hladkch svalfunkce vech exokrinnch a nkterch endokrinnch lzsrden rytmusnkter metabolick pochody

  • parasympatikussympatikus

  • Biosytza katecholamin:

  • Receptor-efektorov systm:

  • Stimulace receptoru 1:vasokonstrikce zejmna konch, slizninch a splanchnickch cv, nepatrn v koronrn a mozkov oblasti, zven perifern cvn rezistence, tlaku - nsledn bradykardie (mstn i perifern)mydriza (kontrakce m. dilatator pupilae, radiln svaloviny), sn. nitroonho tlaku (zv. reabsorpce a sn. produkce nitroonho moku vasokonstrikc cv asnatho tlesa)kontrakce thotn dlohyejakulacekontrakce svrae mo. mche

  • Stimulace receptoru 2:(presynaptick) sn. vyplavovn NA (zejmna v CNS)stimulace agregace trombocytvazokonstrikce pi loklnm podn, jinak vlivem stimulace centrlnch receptor sniuj tonus sympatiku a TKhypotenzivn inek centrlnm mechanismem

  • Stimulace receptoru b1:srdce: FS (+ chronotropn .) SA uzel automaticita (+ bathmotropn) AV uzel, komory stalivost (inotropie) rychlost veden (dromotropn) spoteba kyslkuledviny: sekrece reninu, jen tp angiotenzinogen na angiotenzin I (iniciuje aktivaci RAS)

  • Stimulace receptoru b2:vasodilatace, hl. v kosternm sv. ("pprava na tk nebo tok"), TK diastol.bronchodilatacerelaxace uteru (ind. u hrozcho ped. porodu)relaxace stn stev (+ a2), zpomalen stevn paserelax. stny moovho mcheglykogenolza - zv. glykmie, zven sekrece inzulinutes kosternho svalstva

  • lipolzaStimulace receptoru b3:

  • Aktivace receptor:

    receptor

    tk

    inek

    1

    vtina vaskulrnch hladk svaloviny

    kontrakce ( cvn rezistence)

    m. dilatator pupilae

    kontrakce (mydriza)

    dloha

    kontrakce

    penis, vesiculae seminales

    ejakulace

    GIT - sfinktery

    kontrakce

    2

    presynapticky

    inhibice uvolnn meditoru

    destiky

    stimulace agregace

    srdce

    pozitivn chrono-, dromo- i inotropn

    juxtaglomerulrn buky

    uvolnn reninu

    b buky pankreatu

    uvolnn inzulinu

    2

    bronchiln, cvn, podln stevn i dlon hladk svalovina

    relaxace

    jtra

    stimulace glykogenolzy

    pn pruhovan svalovina

    tes ( uptake K+)

    3

    lipocyty

    lipolza

    D1

    hladk svaly

    relaxace cv splanchniku

    D2

    nervov zakonen

    modifikuj uvolnn meditor

  • Receptorov selektivita adrenergnch receptor:AGONISTANTAGONIST

  • NEEXISTUJE ABSOLUTN SELEKTIVITA KE KONKRTNMU RECEPTORU ( KLES SE VZRSTAJC KONCENTRAC)

  • Rozdlen sympatomimetik:

    _1038910585.doc

    Sympatomimetika

    pm

    nepm

    ltky uvolnn neuromed.

    inhibitory reuptaku

    inhibitory MAO

    -agonist

    -agonist

    (

    1

    +

    2

    ) neselektivn (

    1

    +

    2

    )

    selektivn

    1

    2

    1

    2

    _1038910640.doc

    Sympatomimetika

    pm

    nepm

    ltky ( uvolnn neuromed.

    inhibitory reuptaku

    inhibitory MAO

    -agonist

    -agonist

    (

    1

    +

    2

    ) neselektivn (

    1

    +

    2

    )

    selektivn

    1

    2

    1

    2

    _1038910770.doc

    Sympatomimetika

    pm

    nepm

    ltky ( uvolnn meditoru

    inhibitory reuptaku

    inhibitory MAO

    -agonist

    -agonist

    (

    1

    +

    2

    ) neselektivn (

    1

    +

    2

    )

    selektivn

    1

    2

    1

    2

    _1038205215.doc

    Sympatomimetika

    pm

    nepm

    ltky ( uvolnn neuromed.

    inhibitory reuptaku

    inhibitory MAO

    -agonist

    -agonist

    (

    1

    +

    2

    ) neselektivn (

    1

    +

    2

    )

    selektivn

    1

    2

    1

    2

  • Adrenalinpirozen l. stimuluje a, b1 a b2vy afinita k b, vnzkch koncentracch stimuluje hlavn b-receptory

    inkysrdce, cvyzmny TKbronchodilatacehyperglykmie - glykogenolza, sekrece glukagonu, insulinulipolza

    metabolizovn jako ostatn katecholaminy MAO a COMT, konen produkty normetanefrin a vanilmandlov kys.

  • Adrenalin - nedouc inkyCNS neklid, zkost, bolest hlavykrvcen do mozku v dsledku zv. TKsrden arytmieu hyperthyreosy zv. mnostv adrenergnch receptor, snit dvkuu bloktor uptake katecholamin (kokain, tricykl. antidepresiva) a u inhibitor MAO zeslen inek

  • Adrenalin - indikaceresuscitace pi zstav obhu, tonizace myokardu. 1-2 mg v 5 ml f.r. i.v. nebo intratracheln rourkou, od intrakardilnho podn se opustilo (riziko traumatu).anafylaktick ok, zde se uplatn inkybronchodilatandekongesce sliznicpozitivn inotropnvasokonstrikn ve vych dvkchblokda degranulace r. bunk - i.v. frakcionovan 0.3 mg adrenalinu ( 0.3 ml) roztoku 1:1000 do dosaen inku, pak infzeglaukompsada k lok. anestetikm, vasokonstrikc prodluuje anesteziidekongesce sliznicantiastmatikum: nahraen selektivnmi b2-mimetiky

  • Noradrenalinstimuluje a a b1zvy. syst. i diast. TK, reflex. stimulace vagu me vst k bradykardii

    Indikace terapie hypotenznch stav (mn anestesie, sympatektomie, pedvkovn antihypertensivy)v lb oku vtinou nahraen dopaminem

  • Dopaminstimuluje b a ve vych dvkch i a, a dopaminov receptory v arteriolch ledvin a stev. inek zvis na dvce:dvka 1-2 ug/kg/min: stim. D receptor - zven renln perfzedvka 2-8 ug/kg/min: stim beta receptor - pos. inotropn a chronotropn efektdvka nad 8 ug/kg/min: stim. alfa1 receptor - vasokonstrikceIndikaceLba oku:Stimulace b1= positivn inotropn a chronotropn inek, vy dvky vedou ke konstrikci cv; Stim D = zv. prtok v ledvinch a splanchniku, (rozdl od noradrenalinu)Srden selhn

  • Dobutamin synt., stimuluje b1 - siln inotropn, slab chronotropn inek, mn zvyuje spotebu kyslku ne ostatn katecholaminy, lba srd. selhn, T1/2 =2.5 min, podvn v kontinuln infzi

  • Isoprenalininj., synt., stim. b1 a b2 - vrazn zvyuje srden vkon, ale dky b2 vasodilataci v kosternch svalech snen diastol i stednho TK.

    IndikaceNkdy povn k lb A-V bloku a zstavy srdce, kde nelze pout kardiostimultor.Lba bradykardi nereagujcch na atropin.(v minulosti 1. pomoc pi bodnut hmyzem, bronchodilatans)

  • Vliv rznch sympatomimetik na TK a tepovou frekvenciadrenalinenoradrenalineisoprenaline

  • a1 agonist:Fenylefrin stimulac a1 zvyuje TK, vede k mydrize, nap. EVERCIL a NEOSYNEPHRINE gtt; VIBROCIL gtt

    Midodrin a1 stimulace posturln hypotense (GUTRON)

    Nafazolin, oxymethazolin, xylomethazolin a1 dekongesce sliznic vprvn fzi inku je nsledovan reaktivn hypermi - sanorinismus - doporuuje se neuvat dle ne tden

  • a2 agonist:Klonidin a a - metyldopaindikac je hypertenze (dochz k potlaen sympatick nervov aktivity z CNS zptnovazebnou inhibic pi stimulaci a2 receptorhypotensiva, lba zvislost morfinovho typu

  • -agonist:neselektivn - dopamin2 agonist - fenoterol, salbutamol, terbutalin, formoterolzachovn bronchodilatan a tokolytick inek pi minimu kardiovaskulrnch inkdle inhibice uvolovn leukotrien, histaminu a inhibice fosfolipzy A2

  • Rozdlen sympatomimetik:

    _1038910585.doc

    Sympatomimetika

    pm

    nepm

    ltky uvolnn neuromed.

    inhibitory reuptaku

    inhibitory MAO

    -agonist

    -agonist

    (

    1

    +

    2

    ) neselektivn (

    1

    +

    2

    )

    selektivn

    1

    2

    1

    2

    _1038910640.doc

    Sympatomimetika

    pm

    nepm

    ltky ( uvolnn neuromed.

    inhibitory reuptaku

    inhibitory MAO

    -agonist

    -agonist

    (

    1

    +

    2

    ) neselektivn (

    1

    +

    2

    )

    selektivn

    1

    2

    1

    2

    _1038910770.doc

    Sympatomimetika

    pm

    nepm

    ltky ( uvolnn meditoru

    inhibitory reuptaku

    inhibitory MAO

    -agonist

    -agonist

    (

    1

    +

    2

    ) neselektivn (

    1

    +

    2

    )

    selektivn

    1

    2

    1

    2

    _1038205215.doc

    Sympatomimetika

    pm

    nepm

    ltky ( uvolnn neuromed.

    inhibitory reuptaku

    inhibitory MAO

    -agonist

    -agonist

    (

    1

    +

    2

    ) neselektivn (

    1

    +

    2

    )

    selektivn

    1

    2

    1

    2

  • Nepm sympatomimetika:IMAO (antidepresiva)Amfetamin, metamfetamin, MDMA, fenmetrazin, metylfenidt, cathinonperifern nepmo ovlivuj a i b rec., tm, e uvoluj meditor ze zsobnch vezikulpechzej pes HEB, CNS stim.efekt.zvyuj psychomot. aktivitu (doping)dynamogenn efekt = zvy. rozhodnost k inmanorektick efekt , sni. chu k jdlu stim centra pro potravu v hypothalamunebezpe toxikomanie

  • Efedrinpodobn, ale slab inky dekongesce nosn sliznice, nevhoda - nsledn hypermie se zvenou sekrec pomocn bronchodilatans vroba metamfetaminu Tyraminmetabolit tyrosinu, za normlnch okolnost eliminovn inkem prvnho prchodu vlivem MAO. Jeho vznam vpodob nedoucch ink naroste vppad podn farmak inhibujcch MAO. Pak potrava obsahujc vysok mnostv tyraminu (zejmna vlivem fermentanch pochod) me vyvolat hypertenzn reakci. Jedn se o sry (edar), jogurtov vrobky, salmy, nebo i banny.

    Kokain inhibice re-uptake neuromediator (zejm. dopamin)

  • Nedouc inky:Katecholaminy - nzk prostup HEB => nzk toxicita na CNS - toxick . na periferii vyplvaj ze zven stimulace a nebo b1 receptor:vrazn vazokonstrikcesrden arytmieinfarkt myokardu (a nekrzy pi opakovanm podn)hemorrhagie nebo plicn edm.

  • Sympatolytikanepmpmselektivnneselektivn

  • alkaloid Rauwolfia serpentinadepletuje meditor v zsobnch vezikulch zamezenm pstupu prekurzor meditoru do vezikul

    inky na CNS neuroleptikum s inkem antipsychotickm a m