BY : ADIBAH BTE MOHD KALID

ENGLISH UPSR - SET YOUR TARGET

Sections Types of question Target TargetACNo. 1Write 5 sentences based on a composite picture. 8/103/10No. 2 (A)Transferring of Information 10/1010/10No. 2 (B)Choose and give reasons 3/52/5No. 3Writing a short story based on pictures9/152/15TOTAL (PAPER 2)30/4017/40TOTAL (PAPER 1)35/4015/40OVERALL (PAPER 1 & PAPER 2)65/8032/80

SECTION ASENTENCE CONSTRUCTION

WRITE 5 COMPLETE SENTENCES BASED ON THE PICTURE. You may use the words given.

Read the instructions carefully. Underline the important points. Look and study the picture given. Circle as many verbs that you know. Read the helping words. Tick the words which are in the picture. Write 5 sentences about the picture. Check whether you have written simple, compound and complex sentences. Remember ! Your task is to write GRAMMATICALLY CORRECT SENTENCES. SO, DONT FORGET TO CHECK YOUR GRAMMAR, SPELLING AND PUNCTUATION.

ASSESSMENT OBJECTIVEQuestion 1To assess candidates ability to construct sentencesTask:

To write grammatically correct sentences. Based on the given stimulus.

CRITERIA OF SCORING BAND A (EXCELLENT)All sentences constructed correctly.Good words/ vocabulary used correctly. (good adjective)No spelling or punctuation errors.Variety of sentence structure.Ideas well presented and relevant to the stimulus.Confidence of the language.

MARKS : 9 - 10

Another manbushesA man with a straw hatcutsickleladiescollectingHaving gotong-royongmanthrowingwheelbarrowA friendhelp

cuttingsicklehavinghoedraincleanparkrakewheelbarrowbury

VNVNN

VNNNV

Samples of simple sentencesThe residents are having a `gotong royong`.The people are working together.The man is cutting the grass.Two ladies are collecting the rubbish.

Samples of compound sentences

The men and the women are having a `gotong-royong` to clean their neighbourhood. A man is pushing a wheelbarrow full of rubbish and throws them into a hole.

Samples of complex sentencesThe residents of a housing area are having a `gotong royong to clean their neighbourhood which is dirty. A man who is pushing the wheelbarrow is helping his friend to bury the rubbish in a large hole.

picnicdrinkingenjoybutterflysitswingtreematsharingsquirrel

Samples of simple sentencesThe girls are at the park.They are having a picnic under a shady tree.There are a few butterflies fluttering in the air.

Rina and Siti are sharing a drink to quench their thirst.Two girls are sitting on the mat while the other girl is swinging merrily on the swing.The two happy girls are sitting and drinking some water.

Samples of complex sentencesThe sweet girl who is wearing a scarf is drinking some water.The four girls are enjoying themselves at the park which is clean and beautiful.The little squirrel which is on the branch of the big shady tree is trying to climb down.

Read these sentences. Categorize them according to types of sentences.

Mother cooks chicken curry todayThe man and the woman wear black t-shirts.The girl who is holding a doll in her hand is calling her mother.The bag which is full of money was sent to the police station.Liza washes the dishes every night. They listen to the music.She took the book which my father bought.

The answers .Mother cooks chicken curry today. (Simple)The man and the woman wear black t-shirts. (Compound)The girl who is holding a doll in her hand is calling her mother. (Complex)The bag which is full of money was sent to the police station. (complex)Liza washes the dishes every night. (simple) They listen to the music. (simple)She took the book which my father bought. (complex)

VNVVV

NNNVN

backyardjugapronstandfencewearladderholdingplayingtalk

NOUNSWHOVERBSWHATVERBSHOWNOUNSWHATNOUNSWHERENOUNSWHYArticle,quantifier,col. nouns,SN/PN.pronounTensesto beTo haveadverbsArticle,quantifier,col. nouns,SN/PN.pronounPrepositions;In, on, into,onto, at, along, under, nearConjunctions;But, since, for,because, infinitive to,when, while

NOUNSWHOVERBSWHATVERBSHOWNOUNSWHATNOUNSWHERENOUNSWHYArticle,quantifier,col. nouns,SN/PN.pronounTensesto beTo haveadverbsArticle,quantifier,col. nouns,SN/PN.pronounPrepositions;In, on, into,onto, at, along, under, nearConjunctions;But, since, for,because, infinitive to,when, while1. The familyis - -at the backyard of their house2. Father is standing - _on the ladderbecause he wants to paint the wall.3.The lady is servingsome drinks for the family membersto drink while her daughter who is carrying a pail of water is walking beside her.

NOUNSWHOVERBSWHATVERBSHOWNOUNSWHATNOUNSWHERENOUNSWHYArticle,quantifier,col. nouns,SN/PN.pronounTensesto beTo haveadverbsArticle,quantifier,col. nouns,SN/PN.pronounPrepositions;In, on, into,onto, at, along, under, nearConjunctions;But, since, for,because, infinitive to,when, while4. An old man who is wearing a paper hatis painting the fence carefully using a can of paint and a brush.5. Two boysare walking and talkinghappily _ -while a small boy is playing a yoyo.

Section A Practice 1 Look at the picture carefully. Write five sentences about the picture. You may use the words in the boxes to help you

parkstrollwatchcleansitwalkfishinglakechildrenwave

VV/NNNV

NV/NVNV

NOUNSWHOVERBSWHATVERBSHOWNOUNSWHATNOUNSWHERENOUNSWHYArticle,quantifier,col. nouns,SN/PN.pronounTensesto beTo haveadverbsArticle,quantifier,col. nouns,SN/PN.pronounPrepositions;In, on, into,onto, at, along, under, nearConjunctions;But, since, for,because, infinitive to,when, whileThe peopleare--at the beautiful park-A few peopleare fishing--in the lakewhile the others are strollingAn old man who is walking with his walking stickis walkingslowly--while waving his hand to the anglersA girlis pointing--to a couple of birdson the branch of a treeThe anglersare waitingpatiently-for the fishto bite their baits on the fishing line

Section A Practice 1 Look at the picture carefully. Write five sentences about the picture. You may use the words in the boxes to help you

sacksvolleyballwhistlespectatorsrunningholdingcelebratingtentscheertelematch

SUBJECT (WHO)VERB (WHAT)OBJECT (WHAT,WHERE)peopleverbsthings/placesThe pupils and teachersare celebratingTeachers Day in their school. A group of childrenis standing and watchingthe volleyball match. The spectatorsare cheeringfor their friends who are taking part in the activities. The referee who is holding a file is blowingthe whistle to end the game. The participants of the telematchare runningin the sacks.

Section APractice 2

Look at the picture carefully. Write five sentences about the picture. You may use the words in the boxes to help you

SUBJECT (WHO)VERB (WHAT)OBJECT (WHAT,WHERE)peopleverbsthings/placesThe villagers are doing some activities in their village.A few workers are harvesting the paddy using the sickles at the paddy field.The members of the family who are sitting on the mat are enjoying their meal.A couple is stirring some food in two large woks near the family.A man and a woman are wearingStraw hats to avoid the hot sun.

Practice 3 Section ALook at the picture carefully. Write five sentences about the picture. You may use the words in the boxes to help you

SUBJECT (WHO)VERB (WHAT)OBJECT (WHAT,WHERE)peopleverbsthings/placesThe villagers are at the park.Two boys are sweeping the compound using the brooms.The other two boys are collecting the rubbish and putting them into the large basketThe sweet ladies are carryingtwo trays of food for the people who are busy working.An old man is throwing the garbage into the big garbage truck.

Exercise 1

havingpayingpushshelvessalequeuing upSecurity guardtrolleysgoodschoose

Exercise 2Exercise 3Exercise 4

SUBJECT (WHO)VERB (WHAT)OBJECT (WHAT,WHERE)peopleverbsthings/places

Exercise 2

buycountertalkingwaitparcelpostmanladystampscarryingwrite

Exercise 3

chairseatingordertablescustomersstallroadsidewaitinghawkerfood

Exercise 4

organizedhallparticipatingclapcontestsingaudiencestagecouplesitting

Read the instructions carefully. Underline the important points. Read the text carefully. Read the sample answers given in the table. Then underline the answers to be transferred in the text. Be very careful with spelling and punctuation. Decide your choice. Write them in section B. Give good reasons for your choice. Remember ! Your task is to MAKE A CHOICE AND GIVE GOOD REASONS. SO, WRITE GOOD REASONS USING CORRECT GRAMMAR, SPELLING AND PUNCTUATION. Do not write too long. You will be awarded a maximum of 5 marks only.

Study the advertisements for the competition below. Then, complete the table using the information given. Time : 10.00 a.m. Time : 2.00 p.m. Time : 2.00 p.m.

Study the advertisements for the competition below. Then, complete the table using the information given. Time : 10.00 a.m. Time : 2.00 p.m. Time : 2.00 p.m.

Competition Public Speaking CompetitionStory Telling Competition________________________________Date ________________________________________________________________10 June 2007Time 10.00 a.m.____________________________________________________________Venue ______________________________City Auditorium, Taman AmanSchool Hall, SK Aman 2Registration Fee______________________________RM 10.00______________________________Prize Dictionary____________________________________________________________

I would like to choose Story Telling Competition because I like story telling very much. I have many interesting stories to tell because I like to read. Reading is my favourite pastime. Besides, I have taken part in many story telling competitions before and I have won some prizes. So, I think I will stand a chance to win the competition. Apart from that it will be held on 9 June and I will be free on that day. I do not have any class as it falls on a weekend. It will start at 9a.m.so,my parents can send me there as they will be free too on that day. I will like to try my best to win the story book as I want to add to my collection.

Complete the table with the correct answer

Charity Car WashWildlife RangerTaman Titi Clean-upDay Saturday____________ and ______________Time 10.00 a.m. 4.00 p.m.______________________________Venue _____________________________________________

_______________Taman TitiPurpose________________________________To give brochures to the public________________________________Provided Drinks________________________________________

Lets practise

Lets practice Charity Car WashDay : as Sunday not free so Saturday is the best day for me.Venue : the car parkVery convenient for me to get there on my ownPurpose : - Would like to help to collect moneyProvided :Only drink, no foodDont mind, that is not a problemOwn reasons :Have never participated itWill be a fun experienceNever participated in car wash charity before

SAMPLE 2 (B)I would choose to volunteer at the Charity Car Wash because I would like to help the children at the Bright Childrens Home. I have never participated in a car wash so I think it will be a fun experience for me. I will also be helping to raise money for a good cause. The venue for the event is also convenient for me. It is at the car park. Apart from that I have participated in the Taman Titi the previous year. I would like to have a different cause this year I am also not free on Sunday so Saturday is the suitable day.

SUGGESTED SENTENCES FOR QUESTION 2(B)

TOPIC / AREA OF INTERESTSREASONS1. Place / LocationsIt is near my house,so I can go there easily.It is exciting to visit this place because there are many interesting and attractive spots.It is a nice and beautiful place to visit.I have never been to this place before, so I am very eager to go there.

2. Prices / costs / feesThe price is low, that is only RM .Although the price is high, it is reasonable and affordable.It is a reasonable price and I think I can afford it.I can afford to buy it.

Food/ drinks/ menu / mealIt is delicious and tasty.It is my favourite foodIt is easy to cook / to prepare / to serve.It is good for health because it contains vitamins / minerals and protein.I like the taste.It is nutritious .It offers free..4. Transport / vehiclesIt is the most comfortable way of travelling.It is an economical way of travelling.It is more convenient / comfortable.It is a faster means of transport, so I will not feel bored.I can reach the destination earlier.I like to see the beautiful scenery along the way.

5. Free discount offer / prices The offer is attractive. I like it very much.I can save my money.I can use the money to buy something else.I can use my money to buy books.I can add in my collection.I can get it cheaper . I can get it at a low price.I can keep it as a souvenir.6. Activities / contest / competitionThe activities are very interesting and challenging.The activities are suitable for my age.I can get a lot of knowledge .I can meet a lot of friends by joining the contest / competition.I am talented in so I can have the opportunity to show my talent.This activity is very useful and has a lot of benefits.This activity is simple and easy to do.

7.Pets It is a cute animal.It is easy to look after.I can take care of it easily.I can play with it.I can have a company.It helps to look after the house.It is easier to manage as it eats only (grains)8. Society / clubThe activities are interesting.It can increase my knowledge.It teaches me to be independent.It gives me chance to mix around.I can get many new friends.I can cooperate with the other members.It has a lot of benefits.I can learn many new things.

9. Colour / patterns/ fashion.It is beautiful.It is attractive and nice.It suits me.It is the latest design and fashion.I like the colour.It is my favourite colour.10. Hobby / InterestI will enjoy myself doing it.I can share my hobby with my friends as we have the same interest.I can do something beneficial during my free time.It can widen my knowledge.I can get many friends.11. Time taken / Duration of time.I takes a shorter time to finish my work.It takes a shorter time to reach the destination.The time given is enough for me to complete my work.12. Topic / Title / ThemeThe topic is suitable for my age.The topic is very interesting.The topic is very simple and easy.The topic is related to our daily life.

13. Facilities I will feel comfortable with the facilities provided.I will feel more convenient.I can use the facilities provided.I can save my money and time.14. OccupationsI can earn more money for a living.It teaches me to be responsible.It teaches me to be independent.I am committed to my job.I can support my parents.15.Age groupIt is suitable for me as I am . years old.I am eligible , so I can take part.16. Pen palHe/ she is from If I have the chance, I will visit his / her country one day.We have the same hobbies, so we can exchange ideas.We share the same hobby / interest / idea.We are of the same age.She/ He is older than I , so I can learn many new things from her / him.> She/ He can be my foster sister / brother.

ASSESSMENT OBJECTIVEQuestion 3To assess candidates ability to express ideas in sentences with correct structures.

TASK:To write sentences about the pictures in a paragraph or paragraphs using the given words or own words and express their ideas cretively.

BAND A (EXCELLENT)

Confident use of the languageIdeas conveyed clearly through a variety of sentence structures.Confident use of new words to express ideas.Ideas are well-planned, relevant and are linked so as to sustain the interest of the reader.Overall accurate use of spelling and punctuation. 13 - 15 marks

Tenses Spelling Punctuation to + infinitive Flow of ideas and proper sequencing. Suitable vocabulary adjectives adverbs /linking words/ conjunctions. Interesting expressions and use of similies and proverbs where possible. Writing must be neat and legible.

Expand the sentences by adding suitable new words and phrases. Make sure the information added appropriate to the story line. The quality of the sentence carries more marks and not the number or length of sentences written. Check your answers for grammatical or spelling errors.

Step By Step In Writing A CompositionFollow these steps to write a good compositionWrite at least 3 paragraphs introduction contents closureIntroduction 1 paragraph only- look at all the pictures. find the main character and the other characters in the pictures - get the ideas of the story- ask questions like who is the main character? What is he? - where is the place? something special about the place of the events (adjectives)

Contents- most important part and can be more than 1 paragraph brainstorm the verbs related to the pictures one by one write them down in the verbs column in the sentence table then arrange accordingly (happened first and the next)Closure 1 paragraph only the conclusion of the story write about the feelings ,hopes, lesson learnt from the incidents

INTRODUCTION Azman who is my classmate lives in Putrajaya. Every morning, he takes a bus to school because his house is just a stones throw away from there.

friends waited school bus stopThe pictures describe an incident. Write sentences based on the pictures and words given. You must add your own words to make the story interesting. Brainstorm the verbs for each of the picture.

TIMESUBJECTVERBOBJECTWhen WhoWhat/HowWhat / WhereWhyLast Monday,Azman and his friendswaitedfor the bus at the bus stopThey saton the bench andTheytalked and chatted happilySoon, more and more peoplejoinedin the wait.The placewas crowdedwith people

Content 1 Last Monday, Azman and his friends waited for the bus at the bus stop in front of their school. They sat on the bench. They talked and chatted happily. Soon, more and more people joined in the wait. The place was crowded with people.

get on cut queue pushed - lady

TIMESUBJECTVERBOBJECTWhen WhoWhat/HowWhat / WhereWhyA few minutes later, the busarrived.The boysrushed to get on the busAzmanwantedto be the first to board the busSo, he cut the queue andpushedhis way up

Content 2 A few minutes later, the bus arrived. As soon as the boys saw it, they rushed to get on the bus. They ran as fast as lightning because Azman wanted to be the first to board the bus. He cut the queue and pushed his way up. Then the bus started to move.

fell helped injured - scolded

TIMESUBJECTVERBOBJECTWhen WhoWhat/ HowWhat / WhereWhyUnfortunately, the ladylost gripped and felloff the busThe driverstoppedthe bus immediately andrushed to helpherHescoldedAzman for his actionThe other passengerswerealso very furious with him

TIMESUBJECTVERBOBJECTWhen WhoWhat/HowWhat / WhereWhySomeonecalledthe ambulanceWhen, the ambulancearrivedThey senther to the hospitalAzman regrettedhis action.Hepromised not to be selfish anymore in the future

Content 3 Unfortunately, the lady lost gripped and fell off the bus. She shouted out loudly in pain. The driver stopped the bus immediately and rushed to help her. He scolded Azman for his action. The other passengers were furious with him. Then, someone called the ambulance. When the ambulance arrived, they quickly sent her to the hospital. Azman regretted his action.

CLOSURE Finally, the bus continued its journey. Azman learnt his lesson. He promised not to be selfish in future. It was an expensive experience for him that he will never forget. As the saying goes experience is the best teacher.

PHRASAL VERBS

Add in - include lay out - prepareAsk for request point out - showBack out withdraw own up - admitBarge in interrupt look at inspect, studyBring in introduce look around - tourBrush off reject look up to - respectCall upon invite meet with - encounterCarry on continue put up - accommodateDie down decrease run into - encounterEnd up finish spring up - beganFind out discover search for - seekGet at reach spread out extend, stretchGet over overcome start off - beginGet through reach ,pass take aback - surpriseHold up delay talk over - discussLaugh at mock watch out - observe

Similesas beautiful as the rainbowas proud as a peacockas big as an elephantas busy as a bee/ an antas clear as crystalas cold as iceas deep as a wellas fast as lightningas green as grassas happy as a childas hungry as a wolfas loud as thunderas white as snowas slow as a tortoise/ a snailas silent as the graveas stupid as a donkeyas sweet as honey/ sugar

Sentences with similies She was as proud as a peacock when the teacher praised her.The children came as hungry as a wolf.Father shouted as loud as thunder when he saw the scratch marks on his new car.

SIMILIESExercises - Use the correct similies in these sentences.e.g. Kamalam was as proud as a peacock when she was praised by the police for saving the girl` s life. She went home happily and told her parents about it.

Practice 1Sue walked into the classroom wondering why it wasn`t like it used to be. The usual noisy class was __________________________ so, she went to Hakim, sat down near him and whispered a few questions into his ear.

Practice 2Rahimah and her little brother were left on their own that night. Their parents went outstation so she had to baby sit him. The two siblings sat on the sofa close to each other watching their favorite movie. Suddenly, the lights went out. It was a blackout. The two children screamed __________________________ and hugged each other tightly. Practice 3The pupils of 6 Wawasan were listening attentively to their English teacher, Puan Adibah. She was standing in front of the classroom, explaining to them how to construct sentences. The children understood her lesson as her explanation was ___________________________..

SIMILIESExercises - Use the correct similies in these sentences.e.g. Kamalam was as proud as a peacock when she was praised by the police for saving the girl` s life. She went home happily and told her parents about it.

Practice 1Sue walked into the classroom wondering why it wasn`t like it used to be. The usual noisy class was as silent as the grave so, she went to Hakim, sat down near him and whispered a few questions into his ear.

Practice 2Rahimah and her little brother were left on their own that night. Their parents went outstation so she had to baby sit him. The two siblings sat on the sofa close to each other watching their favorite movie. Suddenly, the lights went out. It was a blackout. The two children screamed as loud as thunder and hugged each other tightly. Practice 3The pupils of 6 Wawasan were listening attentively to their English teacher, Puan Adibah. She was standing in front of the classroom, explaining to them how to construct sentences. The children understood her lesson as her explanation was as clear as a crystal.

Other adjectivesTo describe things Cosy/cozy room Swampy area Thick woodSweet drinkSmall town Flat surface Good student Porcelain bowlSoft doughSeventh floor Green mountains Ceramic tilesHuge building Warm waterCreepy houseLarge fieldPeaceful village

Large green apples rectangular alarm clockFresh vegetables Beautiful carved coffee table round marble dinning tableHot mutton curry soft satin clothBig white shopping bag long curly black hairExciting/interesting stories enjoyable holidaysLonely/street /night careless boyUnpleasant smell tiny holesFlat tyre meaningful lessonCalm blue sea noisy market

SOME SUGGESTED EXPRESSIONS THAT CAN BE USED BEFORE STARTING A NEW SENTENCE.Quickly .

Suddenly ..

Immediately ..

After that

A few minutes later .

Later on .

The next day

After some time ..

While

As soon as

11. upon arrival..

LINKERS, CONNECTORS AND EXPRESSION WORDSExercises - Use the suitable linkers, connectors ,similies or expression words to join the sentences. Practice 1 suddenly, slowly, as fast as lightning, to his surprise, so Zainal was walking home from school one day. He walked down the lane . he heard a loud noise coming from the bushes .., he rushed to see what the noise was. He peeped into the bushes and . saw a big python swallowing a goat. The goat was struggling hard to free itself he ran ..home to break the news to the villagers.

Practice 2 Then, after that, first , finally, next Sarimah was busy doing the housework. .., she dusted the cupboard and cabinets. she vacuumed the living room and mopped the floor. ..she went into the kitchen and prepared the meal for the family. .., she served the delicious and scrumptious food on the table . at 1.00p.m.,she had lunch with her family.

LINKERS, CONNECTORS AND EXPRESSION WORDSExercises - Use the suitable linkers, connectors or expression words to join the sentences. Practice 1 suddenly, slowly, as fast as lightning, to his surprise, so Zainal was walking home from school one day. He walked slowly down the lane suddenly he heard a loud noise coming from the bushes so he rushed to see what the noise was. He peeped into the bushes and to his surprise saw a big python swallowing a goat. The goat was struggling hard to free itself he ran as fast as lightning home to break the news to the villagers.

Practice 2 Then, after that, first , finally, next Sarimah was busy doing the housework. First, she dusted the cupboard and cabinets. Next she vacuumed the living room and mopped the floor. After that she went into the kitchen and prepared the meal for the family. Then she served the delicious and scrumptious food on the table . Finally at 1.00p.m.,she had lunch with her family.

IDIOMS AND FIGURATIVE EXPRESSIONSTo show one `s expression about something.

Sample :1. a wet blanket a very discouraging person It is difficult for Husna to succeed because she is a wet blanket. 2. Blow one`s trumpet boast Nobody likes a person who blow one`s trumpet.

3. build castles in the air - day dreamThe twins were reminded to work harder , not just building castles in the air.

4. carried away - very excited The children got carried away with their English project and they forgot about food.

5. dirt cheap - extremely cheap The goods at the flea market are dirt cheap.

6. live from hand to mouth live in a hardship The family live from hand to mouth all this while.

7. put an end to stop something We have to put an end to that rumours

8. rains cats and dogs rain heavily The boys cannot go out and play football as it rains cats and dogs

9. turn over a new leaf conduct oneself better Salim promised to turn over a new leaf and not to steal anymore.

10. Throw cold water on - discourage Although he did not do well in his exam he did not throw the water on.

A stones throw away Finger licking good Left for home Eye catching scenery The food is delicious and scrumptious .

EXERCISE - PROVERBS & IDIOMS Practice 1Anita dislikes going to the hospital. She hates the smell of medicine , the sight of the medical staffs wearing white uniforms and nurses with the syringe for injections. The doctor spoke to her softly Young Lady, if you do not want to visit me often, you have to take care of your health. Eat well, lots of water, fruits and vitamins. As the saying goes ____________________________ he added.

Practice 2She walked with a heavy steps out the door. With sad eyes she turned back and looked again at her friend. She hated to say good bye to her but she had to leave to further her study oversea. Deep in her heart she knew that Rosie was a true friend that she will never forget, as a saying goes ___________________________

Practice 3Salman jumped down from the bus and ran as fast as lightning to his class. He was 15 minutes late. As he stepped into the class, he saw his teacher staring at him. He told himself __________________ and walked straight up to her and faced the music

EXERCISE - PROVERBS & IDIOMS

Practice 1Anita dislikes going to the hospital. She hates the smell of medicine , the sight of the medical staffs wearing white uniforms and nurses with the syringe for injections. The doctor spoke to her softly Young Lady, if you do not want to visit me often, you have to take care of your health. Eat well, lots of water, fruits and vitamins. As the saying goes an apple a day keeps the doctor away he added.

Practice 2She walked with a heavy steps out the door. With sad eyes she turned back and looked again at her friend. She hated to say good bye to her but she had to leave to further her study oversea. Deep in her heart she knew that Rosie was a true friend that she will never forget, as a saying goes a friend in need is a friend indeed

Practice 3Salman jumped down from the bus and ran as fast as lightning to his class. He was 15 minutes late. As he stepped into the class, he saw his teacher staring at him. He told himself is better late than never and walked straight up to her and faced the music

REDUNDANCY - Rd A four wheel drive car - a four wheel driveWent back home- went homeAt there - there Thank to him - thank himRed in colour - my bag is redgrazing the grass - is/are grazing in the fieldAlthough she is fat but she can run fast. Although she is fat, she can run fast

REPEATITION - RpSiti saw an old lady. The old lady was walking in front of Siti. Siti saw an old lady. The old lady was walking in front of her.I have a friend. His name is Yasser. Yasser is 15 years old and Yasser lives in Taman Suria. I have a friend. His name is Yasser. He is 15 years old and he lives in Taman Suria.

Avoid these mistakesMy mother was bought the vegetables at the night market. ( X ) WRONG STRUCTUREMy mother bought the vegetables..

The car was knocked Ali. ( X ) WRONGAli was knocked by the car or The car knocked Ali while he was walking on the road.

It is not wrong to say.The books are arranged neatly on the shelves in the library.There are varieties of food served on the table for the guests at the party.The stage is decorated beautifully with balloons and streamers for the event.

SYMBOLS FOR ERRORS IN WRITINGWrong sentence structure - Wrong word /vocabulary used - vWrong spelling - sp Error in punctuation Wrong grammar ~~~~~ Repetation RpRedundancy - RdOmmission of words /Unclear meaning - ____?

The pictures describe an incident. Write sentences based on the pictures and words given. You must add your own words to make the story interesting. Brainstorm the verbs for each of the picture. school holidays Amir uncle Kuala Perlis stayed a weekmorning uncle fishing in the sea - boat fishing rodcame back late evening caught fish happy and excited

The pictures describe an incident. Write sentences based on the pictures and words given. You must add your own words to make the story interesting. Brainstorm the verbs for each of the picture. school holidays Amiry uncle Kuala Perlis stayed a week

SubjectVerbObjectWhoWhat/HowWhat / Where/ WhereArticle, quantifiers, col. Nouns, SN_PN, PronounsTenses,VTB, VTHAdverbsArticle, quantifiers, col. Nouns, SN_PN, PronounsPrepositions : in, on, into, onto, at, along, under, nearConjunctions : but, since, for, because, to, when, whilevisitediswentgreeted him and took was excitedplanned to staytook went

SubjectVerbObjectWhoWhat/HowWhat / Where/ WhereArticle, quantifiers, col. Nouns, SN_PN, PronounsTenses,VTB, VTHAdverbsArticle, quantifiers, col. Nouns, SN_PN, PronounsPrepositions : in, on, into, onto, at, along, under, nearConjunctions : but, since, for, because, to, when, whileLast school holiday, Amiryvisited -his uncles familywho lives in Kuala Perlis.His uncle is -a fishermanand lives in a small fishing village.Hewent - -there by bus alonebecause his parents could not come along.When hearrived at the jetty, his unclegreeted him and took him to his house.Amirywas excited - - -as it was the first time traveling alone.He planned to stay -there for a week.The next morning, Uncle Roslitook -him fishing in the sea.They went -in his fishing boat.

BRAINSTORMING THE VERBSmorning uncle fishing in the sea - boat fishing rod

SubjectVerbObjectWhoWhat/HowWhat / Where/ WhyArticle, quantifiers, col. Nouns, SN_PN, PronounsTenses,VTB, VTHAdverbsArticle, quantifiers, col. Nouns, SN_PN, PronounsPrepositions : in, on, into, onto, at, along, under, nearConjunctions : but, since, for, because, to, when, whilewent brought alongpushed showed him waited caught

SubjectVerbObjectWhoWhat/HowWhat / Where/ WhereArticle, quantifiers, col. Nouns, SN_PN, PronounsTenses,VTB, VTHAdverbsArticle, quantifiers, col. Nouns, SN_PN, PronounsPrepositions : in, on, into, onto, at, along, under, nearConjunctions : but, since, for, because, to, when, whileThey went -in his fishing boat.Theybrought along -some food which his aunt prepared and the fishing equipmentsfor them to catch fish.Both of thempushed slowlytheir boatoff the shoreand sailed smoothly to the middle of the seaUncle Rosli showed him how to put the baitson the hookThen, theywaited patiently - -for the fish to eat their baits.After a while ,theycaughtmany fishand put them in to the container that they brought.

came back late evening caught fish happy and excitedBRAINSTORMING THE VERBS

SubjectVerbObjectWhoWhat/HowWhat / Where/ WhereArticle, quantifiers, col. Nouns, SN_PN, PronounsTenses,VTB, VTHAdverbsArticle, quantifiers, col. Nouns, SN_PN, PronounsPrepositions : in, on, into, onto, at, along, under, nearConjunctions : but, since, for, because, to, when, whilepacked was overjoyedwas cooked was is

SubjectVerbObjectWhoWhat/HowWhat / Where/ WhereArticle, quantifiers, col. Nouns, SN_PN, PronounsTenses,VTB, VTHAdverbsArticle, quantifiers, col. Nouns, SN_PN, PronounsPrepositions : in, on, into, onto, at, along, under, nearConjunctions : but, since, for, because, to, when, whileLate in the evening, theypacked their thingsand went homeAmiry was overjoyedwith their catchHe was as happy as a larkAt home, his auntcooked the fish for dinner.It was a memorable day for himand he had a great experience that day.

As the saying goes experience isthe best teacherfor him.

celebrated assembled hall speech - listenedWRITE OUT ALL THE VERBS YOU CAN THINK OFwas decoratedcelebratedassembledlistenedwent upclappedstoodTEACHERS DAYgave

SubjectVerbObjectWhoWhat/HowWhat / Where/ WhereArticle, quantifiers, col. Nouns, SN_PN, PronounsTenses,VTB, VTHAdverbsArticle, quantifiers, col. Nouns, SN_PN, PronounsPrepositions : in, on, into, onto, at, along, under, nearConjunctions : but, since, for, because, to, when, while

- liked Kuda Kepang enjoyed watched happy - performanceBrainstormingWRITE OUT ALL THE VERBS YOU CAN THINK OFwatchedperformeddancedenjoyedclappedwere entertained

concert performed stage chair play -sangstoodworeperformedorganisedtook partWRITE OUT ALL THE VERBS YOU CAN THINK OFBrainstorming

ended presented flowers presents class party - memorableendedpresented a bouquet of flowersthrew a class party had a memorablewent upwas happyWRITE OUT ALL THE VERBS YOU CAN THINK OFBrainstorming

Sample Answer

Last Saturday, SK Taman Daya, celebrated Teachers Day. It was a great celebration. The pupils of the school assembled in the hall. The headmaster gave a speech. They listened attentively to it. When the speech was over the children applauded loudly.

After that, they had a concert. The representatives from each standard performed many performances. The level one pupils danced gracefully while Year 6 pupils acted in a play. The Year 4 and 5 pupils formed a choir of 150 pupils, they sang a few lovely songs for their beloved teachers.

After that, the Year 3 pupils performed a Kuda Kepang dance. The performances were beautiful. The children loved it. They enjoyed watching the performances.

The concert ended at around 12.00 pm. Before they left for their class party, they presented a bouquet of flowers to the headmaster and his wife. It was a memorable day for them. They had such an experienced that day. As the saying goes experience is the best teacher.

*******