Catálogo_general_2010.pdf

Embed Size (px)

Citation preview

  • Productos y servicios 2010

    Catlogo general 2010

    Hilti. Mejor desempeo. Mxima duracin.

    Pro

    du

    cto

    s y

    se

    rvic

    ios 2

    010

    Hilti. Mejor desempeo. Mxima duracin.

    Cualquier modificacin a los datos, informacin, imgenes o clculos (includos diseos) por el usuario, puede traer como consecuencia que no se cumplan las aplicaciones o medidas de seguridad previstas por Hilti o por la ley. Por lo tanto, el usuario est de acuerdo en indemnizar y exculpar a Hilti de cualquier reclamacin relacionada a las aplicaciones basadas en tales modificaciones. Toda la informacin, datos, imgenes, diseo o clculos provistos en el manual son slo para ayuda sin garanta de posible falla o exacitud de clculo en una aplicacin especfica. Hilti no puede aceptar cualquier responsabilidad por dao de forma directa, indirecta, incidental o como consecuencia, prdidas y/o gastos derivados de la razn de uso, o inhabilidad de uso de la informacin en el manual para cualquier propsito.

    Todos los derechos reservados.

    Tienda :Av.RepblicadePanam4099 -Surquillo Telefax:446-6969Oficina :Av.RepblicadePanam2577 -LaVictoria Telf.:211-4422Fax:[email protected]/hilti

  • GARANTADE FABRICACI

    SERVICIODE POR VIDA

    SINCOSTOS

    2aos

    De por vida

    COSTOLIMITADO DEREPARACIN

    De por vida

    SERVICIODE POR VIDA

    SINCOSTOS

    2aos

    COSTOLIMITADO DEREPARACIN

    De por vida

    GARANTADE FABRICACIN

    De por vida

    GARANTADE FABRICACI

    COSTOLIMITADO DEREPARACIN

    SERVICIODE POR VIDA

    SINCOSTOS

    2aos

    De por vidaDe por vida

    Garanta de por vida del fabricante*

    Hilti repara o reemplaza, sin cargo alguno, todas las herramientas que tengan fallas como resultado de defectos de fabricacin o materiales durante toda la vida til del producto.

    Sin costo hasta por 2 aos*

    Con las herramientas Hilti usted se beneficia con cero costos de reparacin, hasta por 2 aos*** a partir de la fecha de compra. Esto incluye: Servicio de recoleccin y entrega de herramientas Costos de mano de obra Reparacin o reemplazo de todas las partes defectuosas incluyendo refacciones** Servicio de mantenimiento cuando as lo indique la luz de servicio Reparaciones, ajustes y chequeo preventivo despus de cada reparacin

    Costos limitados de reparacin de por vida*

    Al trmino de la cobertura sin costo*** y por el resto de la vida, se pagar mximo el 35% del precio de lista vigente de la herramienta.

    Si el costo es menor a este lmite, usted solo pagar el monto correspondiente

    Adems 3 meses sin costo en la reparacin efectuada, aplica sobre toda la herramienta incluyendo partes elctricas Sin cargo por recoleccin Aplica slo a reparaciones facturadas

    Servicio de por vida.

    * Consultar excepciones al nmero de Atencin al Cliente: (511) 211 4422** No cubre en los casos de dao por cadas, impactos o eventos naturales. No cubre en caso de que la herramienta sea alterada o reparada o que sus partes sean manipuladas por personas no autorizadas por Hilti. No cubre en caso de no contar con nmero de serie o que ste haya sido alterado. Se excluyen pistones, anillos.

    *** Cobertura 2 aos: Cobertura 1 ao:

    RotomartillosRotomartillos combinados

    RompedoresHerramientas de perforacin con diamanteHerramientas DX accionadas con plvora

    Herramientas GX accionadas con gasEquipos lser

    Sierras reciprocantesAtornilladorasEsmeriladoras

    TaladrosHerramientas de corte con diamante

    (cortamuros) (200 hrs.)

    Las principales ventajas del Servicio de por vida Hilti son:

    Mximo control de costos

    Absolutamente ningn costo hasta por los 2 primeros aos Costo limitado de reparacin despus del perodo de cobertura sin costo Envo sin costo de la herramienta 3 meses de garanta en la reparacin efectuada; aplica sobre toda la herramienta incluyendo partes elctricas

    Procedimiento rpido y directo No se requiere comprobante de la compra (e.j. No se pide factura o carta de garanta)

    Ms valor por su herramienta Recompra garantizada el cliente asegura tener siempre lo ltimo en tecnologa con las herramientas Hilti

    Hilti Servicio de por vida

    Hilti. Mejor desempeo. Mxima duracin.

    Notas

  • 23

    4

    5

    6

    7

    8

    1

    Productos | Servicios

    Indicewww.quimicasuiza.com/hilti (511) 211 4422 1

    Servicios Hilti

    Sistemas de medicin lser

    Sistemas de perforacin y demolicin

    Sistemas de perforacin y corte con diamante

    Pg. 2-21

    Pg. 22-35

    Pg. 36-67

    Pg. 68-115

    Sistemas de fijacin directa

    Pg. 116-145

    Sistemas de fijacin a tornillo

    Pg. 146-153

    Sistemas de anclajes

    Pg. 154-179

    Productos qumicos

    Pg. 180-197

    Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com

    You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.

    Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc

    RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes

    Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes

    Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no

  • 2SINCOSTOS

    GARANTADE FABRICACIN

    COSTOLIMITADO DEREPARACIN

    SERVICIODE POR VIDA

    2aosHasta

    De por vidaDe por vida

    Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com

    You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.

    Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc

    RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes

    Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes

    Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no

  • 3Servicio de por vida

    Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com

    You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.

    Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc

    RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes

    Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes

    Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no

  • 4Rompiendo las reglas.La nueva generacin de rompedores Hilti.

    Las herramientas del maana hoy.Rendimiento, confort y eficiencia sin igual.

    Estas herramientas rompen las reglas. Redefinen su propia funcin. Llevan los rompedores electroneumticos a una nueva dimensin.Pruebe un rompedor Hilti equipado con el apropiado cincel poligonal. Inmediatamente sentir el poder y la diferencia una diferencia que se combina con un desempeo impresionante y una excepcional baja vibracin, ofreciendo un alto incremento en la productividad diaria. Experimente la ingeniera avanzada, fiabilidad comprobada y el poder de los nuevos rompedores Hilti en los trabajos de demolicin y correccin de todo tipo.

    Las ventajes de la nueva generacin de rompedores Hilti son: Libre de mantenimiento con el motor SR sin escobillas de carbn para cambiar,

    largos intervalos de servicio y una significativa vida prolongada adems de un alto rendimiento constante an en un apagn (TE 1000-AVR, TE 706-AVR).

    Extremadamente baja vibracin y por lo tanto tiempos prolongados permisibles de encendido gracias al Sistema de Reduccin Activa de la Vibracin Hilti AVR para los rompedores.

    Un alto poder de rompimiento con el innovador cincel poligonal con auto afiliado Hilti que logra un constante desempeo y una gran reduccin en el atasque del cincel.

    El Hilti TE DRS-B es el primer sistema de remocin de polvo extremadamente efectivo para trabajos de cincelado interiores. El sistema recoge hasta el 95% del polvo.

    Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com

    You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.

    Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc

    RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes

    Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes

    Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no

  • 5TE 1000-AVR: El nuevo rompedor para todo propsito con un desempeo de martillado excepcional para una amplia variedad de trabajos en piso y paredes a niveles debajo de la cadera.

    TE 706-AVR: Logra mxima productividad en trabajos de demolicin en paredes de concreto y mampostera, combinando una ergonoma perfecta en conjunto con una alta energa de impacto en el martillado.

    TE 500-AVR: El cincelado es exacto y fcil en canales para conductos de cables y penetraciones en paredes de ladrillo y bloque.

    Cincelado en una nueva dimensin.Mayor poder, menor vibracin.

    Las herramientas perfectas para todo tipo de trabajo.

    TE 1000-AVR

    Rompedor

    TE 706-AVR

    Rompedor

    TE 500-AVR

    Rompedor

    Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com

    You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.

    Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc

    RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes

    Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes

    Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no

  • 6Simplemente conectado.Soluciones Hilti para post-instalaciones de conexiones de varilla.

    Cava un orificio.

    Limpia el orificio.

    Planta el rbol y rigalo adecuadamente.

    Para una unin duradera.

    Plantar un rbol es muy fcil. Utiliza la herramienta correcta para cavar un orificio con las dimensiones adecuadas, limpia la tierra sobrante y coloca el rbol en el agujero. Si despus le das al rbol suficiente agua dar raz y resistir de manera segura todo tipo de estrs y tensin, posiblemente hasta por cientos de aos. Con la solucin Hilti, haciendo post-instalaciones de conexiones de varilla es as de fcil.

    Tan seguro como las rejas.Para conexiones confiables debes fiar en los morteros adhesivos de inyeccin Hilti comprobados y aprobados, en los limpiadores de orificios y rotomartillos poderosos. Los altamente experimentados especialistas tcnicos Hilti estn a tu servicio y tendrn el gusto de responder a cualquier pregunta. Usted puede tener acceso permanente a 25 aos de experiencia en el campo de la post-instalacin de conexiones de varilla experiencia que lo ayudar a lograr conexiones con gran fiabilidad y mxima rentabilidad.

    Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com

    You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.

    Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc

    RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes

    Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes

    Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no

  • 7Sostiene lo que promete.

    Con la solucin Hilti, la post-instalacin de conexiones de varilla es tan fcil como plantar un rbol.Rpido: Los legendarios rotomartillos ligeros y combinados Hilti en conjunto con los al-tamente eficientes dispensadores Hilti hacen que tu trabajo sea ms rpido por mayor tiempo. Fcil: La limpieza apropiada del orificio es elemental. Con los sets de limpieza Hilti tienes todos los accesorios para la instalacin de varillas que necesites justo frente a tu mano. Fiable: El set de barras de refuerzo para la post-instalacin Hilti HIT es tan seguro y fiable como una reja. En consecuencia, los sistemas Hilti HIT han sido aprobados de forma oficial para las aplicaciones pertinentes.

    nete a los profesionales de Hilti HIT!Hilti provee entrenamiento especial para el uso de los sistemas Hilti HIT para post-instalacin de conexiones de varilla.

    Perfora un orificio de manera fcil utilizando los rotomartillos combinados y las brocas adecuadas Hilti.

    Limpia a fondo el orificio utilizando los sistemas de limpieza de los sets para varilla Hilti.

    Inyecta el mortero Hilti HIT de manera conveniente e instala la varilla de forma fiable.

    TE 70-ATC rotomartillo combinado

    PS 200 FerroscanPROFIS software

    HIT-RE 500-SDsistema de inyeccin

    El sistema completo para post-instalacin de conexiones de varilla.

    Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com

    You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.

    Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc

    RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes

    Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes

    Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no

  • 8Ideas desarrolladas gracias a nuestros clientes.Diseo de productos Hilti usted puede notar los beneficios.

    Usted nos dice.Todos los das. En todo el mundo.

    Con cuntas personas se rene usted en una semana de trabajo? Durante ese mismo espacio de tiempo, los representantes de Hilti hablan con casi un milln de profesionales de la industria de la construccin en todo el mundo y aprenden mucho de ello. Esta cercana nica a nuestros clientes es una de las razones por las cuales nuestros productos son lo que son ejemplos principales de excelencia en el diseo, de ergonoma inigualable, de funcionalidad sobre todo y de una durabilidad legendaria.

    Productos galardonados. Adelantndose a su tiempo en dcadas.

    Desde la dcada de 1950, Hilti ha Ganado un nmero inigualable de premios de diseo, alcanzando un nivel de xito nico en este campo. Galardones como los internacionalmente reconocidos iF Product Design Award 2009 o el Red Dot Design Award son la confirmacin de que la marca Hilti est claramente orientada hacia las necesidades del usuario, y resaltan el valor aadido que proporcionan claramente nuestros productos.

    Estos smbolos representan la mxima calificacin otorgada a criterios como innovacin, calidad de construccin y acabado, seguridad, comodidad en el trabajo, conveniencia, tamao y forma.

    Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com

    You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.

    Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc

    RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes

    Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes

    Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no

  • Pasinhasta el ltimo detalle.

    Desafode conceptos ya existentes.

    Un modelo de diseo del rotomartillo Hilti.

    No se deja nada al azar. La forma, la disposicin

    y la eleccin de los materiales para los

    componentes de la carcasa se basan en una

    gran cantidad de informacin obtenida de

    estudios de diseo y aplicacin, de pruebas

    prcticas y duraderas realizadas en sitio, de

    anlisis ergonmicos y de encuestas a usuarios.

    Este enfoque inflexible le permite beneficiarse

    de una gran cantidad de caractersticas

    convincentes tales como el nuevo diseo

    avanzado del agarre y del Sistema AVR de

    Reduccin Activa de al Vibracin incorporado

    en los rotomartillos Hilti.

    Hilti reinventa las reglas de diseo de cinceles.

    Cmo es un cincel? Apenas ha cambiado

    desde la Edad de Piedra. Sin embargo, Hilti es

    conciente de que incluso el mejor rotomartillo

    slo puede ser tan bueno como el cincel

    que se utiliza para transformar la energa de

    impacto en un poder de ruptura explosivo. El

    resultado es el revolucionario Cincel Poligonal

    de Hilti.

    Gracias a su forma poligonal, este galardonado

    cincel, todava nico, no solo alcanza mayores

    rangos de ruptura y reduce en gran medida la

    adherencia, sino que tambin es autoafilante

    durante toda su vida til.

    Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com

    You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.

    Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc

    RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes

    Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes

    Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no

  • Significado de smbolos

    Pg.12

    Servicio de logstica HILTI

    Pg.16

    HILTI Servicio de por Vida Pg.13

    Servicio de calibracin Pg.17

    Entrenamiento y seminarios Pg.19

    Ejecutivos de cuenta, Servico a clientes, HILTI Centers Pg.14

    Ingeniera y soporte tcnico Pg.18

    HILTI Online Pg.20

    Responsabilidad ambiental Pg.21

    Tecnologa a bateras

    Pg.15

    Hilti. Mejor desempeo. Mxima duracin.

    Servicios.

    Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com

    You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.

    Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc

    RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes

    Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes

    Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no

  • 1111 Servicioswww.quimicasuiza.com/hilti(511)2114422

    Servicios

    Significado de smbolos

    Pg.12

    Servicio de logstica HILTI

    Pg.16

    HILTI Servicio de por Vida Pg.13

    Servicio de calibracin Pg.17

    Entrenamiento y seminarios Pg.19

    Ejecutivos de cuenta, Servico a clientes, HILTI Centers Pg.14

    Ingeniera y soporte tcnico Pg.18

    HILTI Online Pg.20

    Responsabilidad ambiental Pg.21

    Tecnologa a bateras

    Pg.15

    Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com

    You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.

    Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc

    RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes

    Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes

    Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no

  • NO COSTS

    MANUFACTURERSWARRANTY

    REPAIR COST LIMIT

    LIFETIME SERVICE

    2 Years up to

    Lifetime Lifetime

    The Hilti Power Effect

    Hilti tools plus Hilti accessories.Total Performance.

    ServiciodeporvidaHilti:Proveeunservicionicoportodalavidadesuherramienta-completamentesincargoalgunoporhastalosprimerosdosaosdesdeeldadecompracubriendopartesparareparacinoreemplazo(inclusopartessujetasaldesgaste),incluyendoeltransportedelaherramientasincostoalguno.Despusdeestetiempo,Hilticontinacomprobandolacalidadensusproductosofreciendounlmiteenelcostodereparacinportodalavidadetuherramienta.

    ServiciodecalibracinHiltiresultadosfiablesdemedicindemaneraconstanteparatodaslasherramientasdemedicinHilti.

    LasherramientasylosaccesoriosHiltisedesarrollanypruebandemaneraconjunta,haciendoqueellosseemparejenperfectamenteelunoalotro.Assepuedebeneficiardelniveldeoperacindeunsistemacompletoqueabarcamuchomsquesololasumadesuscomponentes.

    ElSistemaControlActivodeTorque(ATC)ofrecemximaseguridad,trabajoconfortableysinrestriccionesgraciasalareduccinautomticadelarotacinensituacionescrticas.

    ElSistemadeReduccinActivadelaVibracin(AVR)reducelavibracinhastapordostercioscomparadoconotrasherramientasconvencionales.

    HiltiPulsePowerarribadeunmillndeimpulsosporsegundopararesultadosdemedicinrpidosyaltamentefiables,anencondicionesdetrabajodifciles.

    Significado de smbolos

    Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com

    You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.

    Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc

    RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes

    Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes

    Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no

  • SINCOSTOS

    GARANTADE FABRICACIN

    COSTOLIMITADO DEREPARACIN

    SERVICIODE POR VIDA

    2aosHasta

    De por vidaDe por vida

    Hilti Servicio de por Vida

    Extraordinarios servicios que duran toda la vida.Un paquete de servicios nico para aquellos que desean ser propietarios de sus herramientas.LasherramientasHiltiestndiseadasparadurar.Peroinclusosiaparecealgndefecto,HiltiseharcargograciasalServicioHiltideporVida.Deformaprofesional,sincargoalguno,porhastadosaosdeldadecompra.DespusdeestetiempocontinuamoscomprobandolacalidaddenuestrosproductosofrecindoleuncostolmiteenlareparacinhastaquecontineutilizandosuherramientaHilti.Inclusolebrindamosunagarantadeporvidacontradefectosdefabricacin.Estosolocertificaloquesabemos,esnicoenelramodelaconstruccin.

    Sin costos hasta por 2 aos*ConlasherramientasHiltiustedsebeneficiaconcerocostosdereparacin,hastapor2aosapartirdelafechadecompra.Estoincluye:ServicioderecoleccinyentregadeherramientasCostosdemanodeobraReparacinoreemplazodetodaslaspartesdefectuosasincluyendorefacciones**ServiciodemantenimientocuandoasloindiquelaluzdeservicioReparaciones,ajustesychequeopreventivodespusdecadareparacin

    Adems:

    3mesessincostoenlareparacinefectuada,aplicasobretodalaherramientaincluyendoparteselctricas

    SincargoporrecoleccinAplicasloareparacionesfacturadas

    Garanta de por vida del fabricante*Hiltireparaoreemplaza,sincargoalguno,todaslasherramientasquetenganfallascomoresultadodedefectosdefabricacinomaterialesdurantetodalavidatildelproducto.

    *ConsultarexcepcionesalnmerodeAtencinalCliente:(511)2114422

    **Nocubreenloscasosdedaoporcadas,impactosoeventosnaturales.Nocubreencasodequelaherramientaseaalteradao

    reparadaoquesuspartesseanmanipuladasporpersonasnoautorizadasporHilti.Nocubreencasodenocontarconnmerode

    serieoquestehayasidoalterado.Seexcluyenpistones,anillos.

    Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com

    You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.

    Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc

    RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes

    Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes

    Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no

  • A su servicio

    Estamos cerca de usted.Por telfono, en un Hilti Center y directo en su obra.

    Llevamos nuestros servicios hacia ustedLos Ejecutivos de Cuenta Hilti estn a su servicio en la obra, brindando experiencia que lo ayuda a estar un paso adelante, proporcionando conocimientos en aplicaciones, ayudndolo a seleccionar el producto ptimo para su obra, ofreciendo soluciones para situaciones complejas y dando demostraciones en sitio de productos innovadores.

    Servicio a Clientes toma sus pedidosEstamos listos para responder a sus preguntas, asesorarlo tcnicamente, tomar sus pedidos, elaborar cotizaciones, disponibilidad de inventarios e informacin de precios, coordinar una visita de un Asesor Tcnico Hilti y cubrir sus necesidades en horario continuo de 8:00 a 18:00 hrs. Pero no se preocupe si no puede hablar con nosotros en este horario, nuestra lnea de fax est abierta para usted las 24 horas del da.

    Oficina: Av. Repblica de Panam 2577 - La Victoria - Lima

    [email protected]

    Hilti Center una tienda para comprar herramientas HiltiAqu nuestros productos se encuentran disponibles de forma directa respaldado por el conocimiento y experiencia de nuestro personal. Pregunte por la demostracin de algn producto por el que se encuentre interesado y asegrese de irse con la solucin adecuada para sus necesidades. Triganos su herramienta Hilti si necesita servicio la revisaremos en la tienda y le recomendaremos la mejor accin a tomar.

    Tienda: Av. Repblica de Panam 4099 - Surquillo - Lima

    Telf. : (511) 211 4422Fax : (511) 211 4050

    Telfax: (511) 446 6969

    Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com

    You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.

    Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc

    RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes

    Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes

    Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no

  • Tecnologaa batera

    Tira los cables. Sistema de proteccin de bateras Hilti (CPC).

    Librate y sigue adelante. ElsistemadeproteccindebaterasHilti(CPC)llevalatecnologadebaterasLitio-Ionaunanuevadimensin.Lasventajassonsimplementesensacionales:anmayorcapacidadypoderenlabatera,vidaextralargadelasceldas,controldevoltajeinde-pendienteparacadacelda;yuncascoergonmicoyreforzadoconfibradevidrio.HiltiCPCessumejorcompaeroparaliberarsedecablesenlaobra.

    Controldevoltajeporseparadoparaprevenirlasobrecarga,calentamientoydes-cargadecadacelda

    Listoparautilizarseencadamomentocargainicialrpidaconhastael75%deca-pacidad

    SolamentelamitaddelpesodelasbaterasNiCd/NiMhconelmismotipodecapaci-dad

    Noseautodescargalasbaterasnopierdensucargaduranteelalmacenamientoyestnlistasparautilizarseencualquiermomento

    Mstrabajoporcargadebaterahasta100%mayorcapacidadquelasbaterasNiCd/NiMhdelmismopeso

    LasceldastieneunamayorduracindevidaEstatusdelacargayalertadeLEDsAmigablealmedioambienteencontrasteaNiCd,noexisteningntipodepolucinpormetalespesadosparaelmedioambiente

    Servicio nico para las herramientas Hilti Litio CPCEstasherramientasextremadamenteligerasyperfectamenteequilibradasproporcio-nanunnuevoniveldelibertadparatrabajosdemuchostipos.UnacaractersticanicadenuestrasherramientasLitioCPCeselserviciodeporvidaHilti.Lasreparacionesdelasherramientasinalmbricas,baterasycargadoressontotalmentegratuitasporlosprimerosdosaosdesdelafechadecompra.Ningnotroproveedorleofreceunserviciocomparableparasusherramientasinalmbricas.

    Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com

    You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.

    Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc

    RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes

    Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes

    Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no

  • Servicio de Logstica Hilti

    Servicio de distribucin*. Entregamos donde sea.Plazo de entrega (sujeto a disponibilidad):DahbilsiguienteparalaCiudaddeLima.2dashbilesalinteriordelpasquecuentenconcoberturadelasprincipalescompaasdemensajera.

    Entregas urgentes:Enpedidosrecibidoshastalas11:00hrs.:SloenLima,mismoda,sujetoatrfico.Restodelpas,sincargodefletealcliente(previaautorizacin).Plazo de entrega desde Hilti Centers:Enmostrador:inmediato,sujetoadisponibilidaddeproductosenelHiltiCenter.ConsulteconsuAsesordeObraparaconfirmarlasfechasdeentrega.*Sujetoadisponibilidaddeinventarioyniveldeservicio.

    Servicio post-venta. Servicio y calidad.

    EnHiltileofrecemosunsoportetcnicoespecializado,durantelavidatildesuherramienta.Nuestro servicio de post-venta le ofrece los siguientes servicios:ServicioespecializadoalclienteMantenimientoantesqueunareparacinCostosmenoresdereparacinSeguimientodesuherramientaalolargodelavidatildelamismaAtencinpersonalizadaRecoleccindesusherramientasEntregadesusherramientasatodoelpassincostoCostolmitedereparacinServiciodeporvidaSistemadepre-aprobacinPara empezar su trmite de reparacin necesita:IdentificarqueherramientaHiltitiene(Modeloynmerodeserie)Llamaral: (511)2114000(A)1680,SERVICIOTCNICO (511)4466969,HILTICENTER (511)2114422,SERVICIOALCLIENTE

    Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com

    You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.

    Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc

    RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes

    Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes

    Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no

  • Servicio de Calibracin

    Precisin verificada.La revisin para las herramientas de medicin Hilti.

    LasherramientasdemedicinHilti,comotodoslosinstrumentosdemedicin,puedenverseafectadosatravsdeltiempoporelusodiarioencondicionesdetrabajo,porlascondicionesdealmacenamientoylasinfluenciasexternas.GraciasalServiciodeCalibracinHilti,losprofesionalesenelnegociodelaconstruccinpuedenconfiarenlasherramientasdemedicinHilti.

    Revisionesregularesaseguranquelasherramientassiganoperandodemaneraprecisaconformealosestndaresyrequisicionesaplicables.DeestamaneraHiltirecomiendaunacalibracinanualdecadaherramientasujetaalusonormal.Siseencuentrandeficiencias,laherramientaserreajustadaparaasegurarquefuncioneconlaprecisinyfiabilidaddesiempre.Hiltilegarantizaestoconuncertificadodecalibracinqueconfirmequelaherramientacumplalasespecificaciones.

    La precisin viene de forma automticaGraciasalavisoautomticodecuandoserequiereelsiguienteserviciodecalibracin,elusuariopuedeestarsegurodequesusherramientasdemedicinHiltisonrevisadasdemaneraprofesionalenintervalosregularesyquecumplenconlasespecificacionesindicadasenelmanualdeinstrucciones.

    Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com

    You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.

    Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc

    RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes

    Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes

    Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no

  • Ingeniera y Soporte Tcnico

    Asistencia profesional.Ayudamos a que sus proyectos sean un xito.

    Informacin para integrar proyectos, planificacin y apoyoNuestropersonalaltamenteexperimentadoloapoyaparaasegurarquelascosassehaganbiendesdelaprimeravez.Lopodemosapoyarconsusproyectos,especificaciones,normas,catlogospersonalizadosyhojasdeseguridad.Laplanificacin,listademateriales,clculosydibujosparaproyectosgrandessonpartedelpaquete.NuestrosEspecialistasdeProyectoHiltiapoyancoordinandolosserviciosdelogsticayapoyotcnicoporproyectodefinido.

    Asesora tcnica en su obraNuestrosIngenierosyTcnicosleofrecenapoyodirectoenobraencualquierlocacin.Ofrecenunserviciodeconsultoraparaarquitectos,planeadores,ingenierosyprofesionalesdelaconstruccinennecesidadesespecficasparasusaplicaciones.Entrenamientosycertificacionestambinsonpartedenuestroservicio.

    Software tcnico y documentosNuestrassolucionesinnovadorasyprcticasensoftwareestndisponiblesparaapoyarloensutrabajodiario,cubriendodiseosdeanclajesyseleccindeconceptosdeinstalacin.Descargadedocumentostcnicosdesdenuestrapginaweb:www.quimicasuiza.com/hilti

    Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com

    You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.

    Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc

    RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes

    Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes

    Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no

  • Entrenamiento y Seminarios

    Saber cmo.Para cada especialidad en el ramo de la construccin.

    EntrenamientosNosaseguramosyprotegemossurentabilidadconlabastaexperienciaqueHiltiofrece;brindamosentrenamientosenrelacinalosproductosyserviciosdecalidadmundial,integrandounvaloragregadoasutrabajo.Estoseventosseorganizanentodoelpas,preguntaatuAsesorTcnicoyagendapronto.

    Qu ofrecemos y cmo lo beneficiaDuracindelosentrenamientosdesde2horashasta2dasEntrenamientotcnicoyprcticoMejoradelaseguridadyproductividadenlaobrayproyectosCertificacin,constancias,etc.

    Cursos especficosEntrenamientosdeanclajesQumicosyMecnicosSeminariosdeSistemasCortafuegoEntrenamientosespecficosporsegmento,talleresdeseguridad,etc.EntrenamientosdesistemasDX(Fijacindirecta)

    Preguntaportemarios,talleresyherramientasdigitales(software,bloquesCAD,etc.)

    Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com

    You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.

    Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc

    RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes

    Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes

    Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no

  • Hilti Online

    Solo con un click.A su disposicin las 24 horas del da.

    Lapginawebwww.quimicasuiza.com/hiltiestasudisposicinlas24horasdelda.Conslounclickustedpodraccederalasiguienteinformacin:

    CatlogodeproductosSoftwaredediseodeanclajesLocalizacindelHiltiCentermscercanoNuevosproductosDescargasdedocumentosRegistropararecibirinformacinvaelectrnica

    ymuchoms.

    Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com

    You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.

    Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc

    RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes

    Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes

    Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no

  • Responsabilidad Ambiental

    Construimos un mejor futuro.Estamos comprometidos a reducir el impacto ambiental.

    LaproteccindelmedioambienteesunaparteintegraldenuestraculturaysemanifiestaennuestropropsitocorporativoApasionadamente,creamosclientesentusiastasyconstruimosunmejorfuturo!Tomamosencuentaalmedioambienteyvariosaspectosdesaludyseguridadduranteeldesarrollo,diseo,fabricacin,entrega,usodelosproductosyeliminacindelosmismos.Estoaseguraelcumplimientodelegislacionesactualesyfuturasdelmedioambienteyseguridad,lamejoraconstanteparacumplirconlasnormasambientalesanivelmundialennuestrasplantasHilti,ylaaplicacindeestaculturaennuestrosproveedores.Porquecreemosfirmementequesiasumimosnuestraresponsabilidadconelmedioambientepodemoscrecerdeformarentablealargoplazo.

    Minimizando el impacto ambientalHiltimanejalosasuntosambientalesconelmismorigorqueotrosaspectosdelacompaa.Nosesforzamosparaminimizarcualquierposibleefectodainoenelambientequepuedaresultarcomoconsecuenciadeunadenuestrasacciones.Hiltisiempreestreduciendoelimpactoambientalnegativoenlaoperacindesumanufacturayenvos.

    Nuestro deber con la humanidad y el medio ambienteHiltiapoyalos10principiosdelPactoMundialdelasNacionesUnidasqueinvitaalascompaasareconocer,apoyaryponerenprcticadentrodesuesferadeinfluenciauncatlogodevaloresfundamentalesrelacionadosalosderechoshumanos,normaslaborales,proteccindelmedioambienteyluchacontralacorrupcin.YaqueHiltitambintieneunaresponsabilidadecolgicaque,entreotrosaspectosambientales,significaquelaproteccindelclimatambinesunapreocupacin,firmamosCaringforClimateConvention(ConvencinCuidandoelClima)en2007.ElCdigodeConductaparaProveedoresdeHiltidetallalasexpectativasconsussociosyproveedores.Hablasobrelosrequerimientossociales,deseguridadyproteccindemedioambientemientrastambintratalosrequerimientoslegalesyelcompromisodelascompaasparalucharcontralacorrupcin.HiltitambinsiguelosindicadoresproporcionadosporGlobalReportingInitiative(GRIIniciativadelReporteGlobal)yreportaindicadoresrelevantesdeHiltiensuReporteAnual.

    El cumplimiento con las regulaciones es un requisito para una accin y conducta responsableEnHilti,somosestrictosconelcumplimientoRoHS(restriccindelautilizacindedeterminadassustanciaspeligrosasenaparatoselctricosyelectrnicos),RAEE(ResiduosdeAparatosElctricosyElctrnicos),REACH(Registro,EvaluacinyAutorizacindelasSustanciasQumicas).Adems,HiltifueacreditadoenISO9001en1985yagreglaacreditacinenISO14001en1997.EstasnormasISOconstituyenlabasedenuestrosistemaintegradodegestinqueescertificadodemaneraindependienteporSwissAccreditationService(SQSServicioSuizodeAcreditacin).

    Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com

    You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.

    Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc

    RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes

    Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes

    Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no

  • Sistemas de medicin lser.

    Hilti. Mejor desempeo. Mxima duracin.

    Sistemas de medicin lser.

    Hilti. Mejor desempeo. Mxima duracin.

    Sistemas de medicin lser.

    Hilti. Mejor desempeo. Mxima duracin.

    Medidores de distancia lser

    Alineacin y nivelacin lser

    Sistemas de deteccin

    Accesorios medicin lser

    Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com

    You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.

    Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc

    RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes

    Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes

    Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no

  • 2Medicin lser

    2 Sistemas de medicin lserwww.quimicasuiza.com/hilti (511) 211 4422 23

    Medidores de distancia lser

    Alineacin y nivelacin lser

    Sistemas de deteccin

    Accesorios medicin lser

    Medidor lser PD 4 Pg. 24Medidor lser PD 40 Pg. 25Medidor lser PD 42 Pg. 26

    Lser multidireccional PMP 34 kit Pg. 27Lser lineal PML 32-R / PMA 30 Pg. 28

    Lser rotatorio PR 20 Pg. 29 Lser rotatorio PRE 3 Pg. 30

    Sistema Ferroscan PS 200 Pg. 32

    Varios Pg. 33-34

    Lser rotatorio PRI 2 Pg. 31

    Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com

    You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.

    Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc

    RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes

    Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes

    Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no

  • 24 2 Sistemas de medicin lser www.quimicasuiza.com/hilti (511) 211 4422

    Medidores de distancia lser

    Medidor lserPD 4

    Aplicaciones n Medicin de distancias entre 0.2 m y 70 m con gran exactitud n Mediciones rpidas y seguras en lugares de difcil acceso

    Datos de pedido

    Descripcin Contenido Cantidad No. Item

    Medidor lser PD 4 PD 4, 2 AA pilas alcalinas, manual de instrucciones, estuche, compartimiento para bateras y certificado del fabricante

    1 un 00202416

    Datos Tcnicos

    PD 4Precisin 2 mm

    Rango de medicin 0.2 m - 70 m

    Funcin de clculo Mediciones directas / tracking

    Lser 635 nm, clase 2 (IEC 825-1), clase II (FDA 21 CFR)

    Vida de las baterias alcalinas 20,000 mediciones

    Peso incluye bateras (g) 180 g

    Rango de temperatura de aplicacin

    -10C a +50C

    Tipo de proteccin contra polvo y agua

    IP X5

    Accesorios Pg. 33 - 34

    Del tamao de tu bolsillo y a prueba de agua!

    Caractersticas y Beneficios n 100% a prueba de agua y polvo n Diseo robusto para su uso en trabajos de obra n Operacin con un solo botn n Fcil de utilizar n Solo se necesita un operario n Diseo ergonmico para un nivel de operacin nico y conveniente n Precisin lser para obtener mediciones confiables

    SIN COSTOS

    GARANTA DE FABRICACIN

    COSTO LIMITADO DE REPARACIN

    SERVICIO DE POR VIDA

    2 aos

    De por vida De por vida

    * Cuenta con un dispositivo de bloque para proteccin de temperaturas extremas +/-

    Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com

    You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.

    Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc

    RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes

    Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes

    Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no

  • 2252 Sistemas de medicin lserwww.quimicasuiza.com/hilti (511) 211 4422

    Medidores de distancia lser

    Medidor lserPD 40

    Aplicaciones n Mide distancias de 0.05 m a 200 m con precisin lser n Medidas directas de distancias y clculos de reas n Mediciones rpidas y seguras en lugares de difcil acceso

    Datos de pedido

    Descripcin Contenido Cantidad No. Item

    Medidor lser PD 40 PD 40, correa, 2 pilas AA alcalinas, manual de instrucciones, estuche, compartimiento para bateras y certificado del fabricante

    1 un 00320281

    Datos Tcnicos

    PD 40Precisin 1 mm

    Rango de medicin 0.05 m - 200 m

    Funcin de clculo Medicin, tracking, rea, suma y resta

    Lser 635 nm, clase 2 (IEC 825-1), clase II (FDA 21 CFR)

    Vida de las baterias alcalinas 10,000 mediciones

    Peso incluye bateras (g) 200 g

    Rango de temperatura de aplicacin

    -10C a +50C

    Tipo de proteccin contra polvo y agua

    IP 54

    Accesorios Pg. 33 - 34

    Mediciones exactas de 5 cm hasta 200 metros

    Caractersticas y Beneficios n Solo se requiere una persona para su uso n Fcil de utilizar n Mide distancias en menos de un segundo n Compacta, diseo ergonmico, robusta y perfecta para trabajos

    en obra

    n Rpida medicin de reas

    SIN COSTOS

    GARANTA DE FABRICACIN

    COSTO LIMITADO DE REPARACIN

    SERVICIO DE POR VIDA

    2 aos

    De por vida De por vida

    * Cuenta con un dispositivo de bloque para proteccin de temperaturas extremas +/-

    Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com

    You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.

    Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc

    RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes

    Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes

    Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no

  • 26 2 Sistemas de medicin lser www.quimicasuiza.com/hilti (511) 211 4422

    Medidores de distancia lser

    Medidor lserPD 42

    Aplicaciones n Mediciones rpidas y seguras en lugares de difcil acceso n Mide distancias de 0.05 m a 200 m con precisin lser n Mediciones de distancia directa e indirectas y clculos de rea y

    volmen

    n Revisin de paralelas y ngulos rectos con la funcin MIN/MAX

    Datos de pedido

    Descripcin Contenido Cantidad No. Item

    Medidor lser PD 42 PD 42, correa, 2 x AA pilas alcalinas, manual de instrucciones, estuche, compartimiento para bateras y certificado del fabricante

    1 un 00320285

    Datos Tcnicos

    PD 42Precisin 1 mm

    Rango de medicin 0.05 m - 200 m

    Funcin de clculo rea, volumen, Pitgoras x 3, cronmetro, memoria x 30, rea

    pintada, botn para borrar

    Lser 635 nm, clase 2 (IEC 825-1), clase II (FDA 21 CFR)

    Vida de las baterias alcalinas 10,000 mediciones

    Peso (g) 200 g

    Rango de temperatura de aplicacin

    -10C a +50C

    Tipo de proteccin contra polvo y agua

    IP 54

    Accesorios Pg. 33 - 34

    Gran rango de funciones y mediciones en cualquier tipo de condiciones

    Caractersticas y Beneficios n Solo se requiere una persona para su uso, an en lugares

    luminosos

    n Interfase grfica con varias funciones n Guarda mediciones exactas en la memoria - no hay necesidad de

    medir nuevamente

    n Mediciones fciles y seguras en lugares de difcil acceso

    SIN COSTOS

    GARANTA DE FABRICACIN

    COSTO LIMITADO DE REPARACIN

    SERVICIO DE POR VIDA

    2 aos

    De por vida De por vida

    * Cuenta con un dispositivo de bloque para proteccin de temperaturas extremas +/-

    Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com

    You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.

    Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc

    RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no

    CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no

    Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no

    Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no

    Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes

    Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes

    Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no

  • 2272 Sistemas de medicin lserwww.quimicasuiza.com/hilti (511) 211 4422

    Alineacin y nivelacin lser

    Lser multidireccionalPMP 34Nivela, plomada y escuadra simultneamente

    Caractersticas y Beneficios n Alineacin interior de hasta 30 metros n Alineacin rpida y sin errores para exteriores n Proyecta 2 o 4 puntos, 2 verticales y 2 horizontales n Plomado hacia arriba y hacia abajo n Dos puntos de referencia en un ngulo de 90 n Alineacin horizontal n Herramienta autonivelante

    Aplicaciones n Colocacin de rieles de tabla yeso n Posicionamiento de charolas porta cables n Marcado de bajantes de tubera hidrosanitaria n Transferencia de puntos - piso a techo

    Datos Tcnicos

    PMP 34Precisin 3 mm @ 10 m

    Lser 650 nm, clase 2 (IEC 825-1), clase II (FDA 21 CFR)

    Precisin cada 10 m 3 mm

    Vida de las baterias alcalinas 40 h

    Peso (g) 700 g

    Rango de auto nivelacin 5

    Tipo de proteccin contra polvo y agua

    IP 54

    Tiempo de autonivelacin

  • 28 2 Sistemas de medicin lser www.quimicasuiza.com/hilti (511) 211 4422

    Alineacin y nivelacin lser

    PMA 30Rango de medicin 2 m - 30 m

    Sensibilidad de la deteccin de la lnea lser a 5m de distancia

    Alta: 0.7 mm / Estndar: 2 mm

    Vida de las baterias alcalinas 50 h

    Temperatura de operacin - min

    -20 C

    Temperatura de operacin - max

    50 C

    Tipo de proteccin contra polvo y agua

    IP 54* Cuenta con un dispositivo de bloque para proteccin de temperaturas extremas +/-

    Lser linealPML 32-R

    Aplicaciones n Lneas de transferencia para referencias en paredes y de pisos a

    techos

    n Nivelacin de techos suspendidos y charolas porta cables n Alineaciones verticales en tuberas n Alineaciones horizontales y verticales de azulejos

    Datos de pedido

    Descripcin Contenido Cantidad No. Item

    Combo PML 32 R y PMA 30 Maletn Hilti, lser lineal PML 32, funda, dianas, pilas, manual de instruc-ciones, certificado del fabricante y lentes

    1 un 00331452

    Datos Tcnicos

    PML 32-RRango de medicin 2 m - 10 m

    Lser 635 nm, clase 2 (IEC 825-1), clase II (FDA 21 CFR)

    Precisin cada 10 m 1.5 mm

    Vida de las baterias alcalinas 40 h

    Peso (g) 600 g

    Rango de auto nivelacin 5

    Tipo de proteccin contra polvo y agua

    IP 54

    Rango mximo de operacin con receptor lser

    30 m

    Accesorios Pg. 33 - 34

    La herramienta correcta para alinear y aplomar. Todo en uno.

    Caractersticas y Beneficios n Operacin fcil y con un solo botn para todo tipo de aplicaciones n Las manos quedan libres para trabajar junto a la lnea referencial n El receptor lser PMA 30 ahorra tiempo, an en condiciones

    luminosas

    n Sistema de autonivelacin ( 5) n La lnea laser parpadea para advertir al usuario de una

    desnivelacin y as obtener resultados confiables, rayo inteligente

    n Simplificacin de nivelaciones y alineamientos en diversas alturas

    Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com

    You can