Upload
harlygan
View
79
Download
0
Embed Size (px)
Citation preview
Productos y servicios 2010
Catlogo general 2010
Hilti. Mejor desempeo. Mxima duracin.
Pro
du
cto
s y
se
rvic
ios 2
010
Hilti. Mejor desempeo. Mxima duracin.
Cualquier modificacin a los datos, informacin, imgenes o clculos (includos diseos) por el usuario, puede traer como consecuencia que no se cumplan las aplicaciones o medidas de seguridad previstas por Hilti o por la ley. Por lo tanto, el usuario est de acuerdo en indemnizar y exculpar a Hilti de cualquier reclamacin relacionada a las aplicaciones basadas en tales modificaciones. Toda la informacin, datos, imgenes, diseo o clculos provistos en el manual son slo para ayuda sin garanta de posible falla o exacitud de clculo en una aplicacin especfica. Hilti no puede aceptar cualquier responsabilidad por dao de forma directa, indirecta, incidental o como consecuencia, prdidas y/o gastos derivados de la razn de uso, o inhabilidad de uso de la informacin en el manual para cualquier propsito.
Todos los derechos reservados.
Tienda :Av.RepblicadePanam4099 -Surquillo Telefax:446-6969Oficina :Av.RepblicadePanam2577 -LaVictoria Telf.:211-4422Fax:[email protected]/hilti
GARANTADE FABRICACI
SERVICIODE POR VIDA
SINCOSTOS
2aos
De por vida
COSTOLIMITADO DEREPARACIN
De por vida
SERVICIODE POR VIDA
SINCOSTOS
2aos
COSTOLIMITADO DEREPARACIN
De por vida
GARANTADE FABRICACIN
De por vida
GARANTADE FABRICACI
COSTOLIMITADO DEREPARACIN
SERVICIODE POR VIDA
SINCOSTOS
2aos
De por vidaDe por vida
Garanta de por vida del fabricante*
Hilti repara o reemplaza, sin cargo alguno, todas las herramientas que tengan fallas como resultado de defectos de fabricacin o materiales durante toda la vida til del producto.
Sin costo hasta por 2 aos*
Con las herramientas Hilti usted se beneficia con cero costos de reparacin, hasta por 2 aos*** a partir de la fecha de compra. Esto incluye: Servicio de recoleccin y entrega de herramientas Costos de mano de obra Reparacin o reemplazo de todas las partes defectuosas incluyendo refacciones** Servicio de mantenimiento cuando as lo indique la luz de servicio Reparaciones, ajustes y chequeo preventivo despus de cada reparacin
Costos limitados de reparacin de por vida*
Al trmino de la cobertura sin costo*** y por el resto de la vida, se pagar mximo el 35% del precio de lista vigente de la herramienta.
Si el costo es menor a este lmite, usted solo pagar el monto correspondiente
Adems 3 meses sin costo en la reparacin efectuada, aplica sobre toda la herramienta incluyendo partes elctricas Sin cargo por recoleccin Aplica slo a reparaciones facturadas
Servicio de por vida.
* Consultar excepciones al nmero de Atencin al Cliente: (511) 211 4422** No cubre en los casos de dao por cadas, impactos o eventos naturales. No cubre en caso de que la herramienta sea alterada o reparada o que sus partes sean manipuladas por personas no autorizadas por Hilti. No cubre en caso de no contar con nmero de serie o que ste haya sido alterado. Se excluyen pistones, anillos.
*** Cobertura 2 aos: Cobertura 1 ao:
RotomartillosRotomartillos combinados
RompedoresHerramientas de perforacin con diamanteHerramientas DX accionadas con plvora
Herramientas GX accionadas con gasEquipos lser
Sierras reciprocantesAtornilladorasEsmeriladoras
TaladrosHerramientas de corte con diamante
(cortamuros) (200 hrs.)
Las principales ventajas del Servicio de por vida Hilti son:
Mximo control de costos
Absolutamente ningn costo hasta por los 2 primeros aos Costo limitado de reparacin despus del perodo de cobertura sin costo Envo sin costo de la herramienta 3 meses de garanta en la reparacin efectuada; aplica sobre toda la herramienta incluyendo partes elctricas
Procedimiento rpido y directo No se requiere comprobante de la compra (e.j. No se pide factura o carta de garanta)
Ms valor por su herramienta Recompra garantizada el cliente asegura tener siempre lo ltimo en tecnologa con las herramientas Hilti
Hilti Servicio de por vida
Hilti. Mejor desempeo. Mxima duracin.
Notas
23
4
5
6
7
8
1
Productos | Servicios
Indicewww.quimicasuiza.com/hilti (511) 211 4422 1
Servicios Hilti
Sistemas de medicin lser
Sistemas de perforacin y demolicin
Sistemas de perforacin y corte con diamante
Pg. 2-21
Pg. 22-35
Pg. 36-67
Pg. 68-115
Sistemas de fijacin directa
Pg. 116-145
Sistemas de fijacin a tornillo
Pg. 146-153
Sistemas de anclajes
Pg. 154-179
Productos qumicos
Pg. 180-197
Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com
You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.
Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc
RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes
Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes
Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no
2SINCOSTOS
GARANTADE FABRICACIN
COSTOLIMITADO DEREPARACIN
SERVICIODE POR VIDA
2aosHasta
De por vidaDe por vida
Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com
You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.
Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc
RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes
Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes
Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no
3Servicio de por vida
Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com
You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.
Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc
RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes
Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes
Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no
4Rompiendo las reglas.La nueva generacin de rompedores Hilti.
Las herramientas del maana hoy.Rendimiento, confort y eficiencia sin igual.
Estas herramientas rompen las reglas. Redefinen su propia funcin. Llevan los rompedores electroneumticos a una nueva dimensin.Pruebe un rompedor Hilti equipado con el apropiado cincel poligonal. Inmediatamente sentir el poder y la diferencia una diferencia que se combina con un desempeo impresionante y una excepcional baja vibracin, ofreciendo un alto incremento en la productividad diaria. Experimente la ingeniera avanzada, fiabilidad comprobada y el poder de los nuevos rompedores Hilti en los trabajos de demolicin y correccin de todo tipo.
Las ventajes de la nueva generacin de rompedores Hilti son: Libre de mantenimiento con el motor SR sin escobillas de carbn para cambiar,
largos intervalos de servicio y una significativa vida prolongada adems de un alto rendimiento constante an en un apagn (TE 1000-AVR, TE 706-AVR).
Extremadamente baja vibracin y por lo tanto tiempos prolongados permisibles de encendido gracias al Sistema de Reduccin Activa de la Vibracin Hilti AVR para los rompedores.
Un alto poder de rompimiento con el innovador cincel poligonal con auto afiliado Hilti que logra un constante desempeo y una gran reduccin en el atasque del cincel.
El Hilti TE DRS-B es el primer sistema de remocin de polvo extremadamente efectivo para trabajos de cincelado interiores. El sistema recoge hasta el 95% del polvo.
Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com
You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.
Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc
RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes
Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes
Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no
5TE 1000-AVR: El nuevo rompedor para todo propsito con un desempeo de martillado excepcional para una amplia variedad de trabajos en piso y paredes a niveles debajo de la cadera.
TE 706-AVR: Logra mxima productividad en trabajos de demolicin en paredes de concreto y mampostera, combinando una ergonoma perfecta en conjunto con una alta energa de impacto en el martillado.
TE 500-AVR: El cincelado es exacto y fcil en canales para conductos de cables y penetraciones en paredes de ladrillo y bloque.
Cincelado en una nueva dimensin.Mayor poder, menor vibracin.
Las herramientas perfectas para todo tipo de trabajo.
TE 1000-AVR
Rompedor
TE 706-AVR
Rompedor
TE 500-AVR
Rompedor
Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com
You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.
Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc
RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes
Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes
Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no
6Simplemente conectado.Soluciones Hilti para post-instalaciones de conexiones de varilla.
Cava un orificio.
Limpia el orificio.
Planta el rbol y rigalo adecuadamente.
Para una unin duradera.
Plantar un rbol es muy fcil. Utiliza la herramienta correcta para cavar un orificio con las dimensiones adecuadas, limpia la tierra sobrante y coloca el rbol en el agujero. Si despus le das al rbol suficiente agua dar raz y resistir de manera segura todo tipo de estrs y tensin, posiblemente hasta por cientos de aos. Con la solucin Hilti, haciendo post-instalaciones de conexiones de varilla es as de fcil.
Tan seguro como las rejas.Para conexiones confiables debes fiar en los morteros adhesivos de inyeccin Hilti comprobados y aprobados, en los limpiadores de orificios y rotomartillos poderosos. Los altamente experimentados especialistas tcnicos Hilti estn a tu servicio y tendrn el gusto de responder a cualquier pregunta. Usted puede tener acceso permanente a 25 aos de experiencia en el campo de la post-instalacin de conexiones de varilla experiencia que lo ayudar a lograr conexiones con gran fiabilidad y mxima rentabilidad.
Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com
You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.
Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc
RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes
Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes
Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no
7Sostiene lo que promete.
Con la solucin Hilti, la post-instalacin de conexiones de varilla es tan fcil como plantar un rbol.Rpido: Los legendarios rotomartillos ligeros y combinados Hilti en conjunto con los al-tamente eficientes dispensadores Hilti hacen que tu trabajo sea ms rpido por mayor tiempo. Fcil: La limpieza apropiada del orificio es elemental. Con los sets de limpieza Hilti tienes todos los accesorios para la instalacin de varillas que necesites justo frente a tu mano. Fiable: El set de barras de refuerzo para la post-instalacin Hilti HIT es tan seguro y fiable como una reja. En consecuencia, los sistemas Hilti HIT han sido aprobados de forma oficial para las aplicaciones pertinentes.
nete a los profesionales de Hilti HIT!Hilti provee entrenamiento especial para el uso de los sistemas Hilti HIT para post-instalacin de conexiones de varilla.
Perfora un orificio de manera fcil utilizando los rotomartillos combinados y las brocas adecuadas Hilti.
Limpia a fondo el orificio utilizando los sistemas de limpieza de los sets para varilla Hilti.
Inyecta el mortero Hilti HIT de manera conveniente e instala la varilla de forma fiable.
TE 70-ATC rotomartillo combinado
PS 200 FerroscanPROFIS software
HIT-RE 500-SDsistema de inyeccin
El sistema completo para post-instalacin de conexiones de varilla.
Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com
You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.
Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc
RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes
Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes
Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no
8Ideas desarrolladas gracias a nuestros clientes.Diseo de productos Hilti usted puede notar los beneficios.
Usted nos dice.Todos los das. En todo el mundo.
Con cuntas personas se rene usted en una semana de trabajo? Durante ese mismo espacio de tiempo, los representantes de Hilti hablan con casi un milln de profesionales de la industria de la construccin en todo el mundo y aprenden mucho de ello. Esta cercana nica a nuestros clientes es una de las razones por las cuales nuestros productos son lo que son ejemplos principales de excelencia en el diseo, de ergonoma inigualable, de funcionalidad sobre todo y de una durabilidad legendaria.
Productos galardonados. Adelantndose a su tiempo en dcadas.
Desde la dcada de 1950, Hilti ha Ganado un nmero inigualable de premios de diseo, alcanzando un nivel de xito nico en este campo. Galardones como los internacionalmente reconocidos iF Product Design Award 2009 o el Red Dot Design Award son la confirmacin de que la marca Hilti est claramente orientada hacia las necesidades del usuario, y resaltan el valor aadido que proporcionan claramente nuestros productos.
Estos smbolos representan la mxima calificacin otorgada a criterios como innovacin, calidad de construccin y acabado, seguridad, comodidad en el trabajo, conveniencia, tamao y forma.
Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com
You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.
Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc
RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes
Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes
Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no
Pasinhasta el ltimo detalle.
Desafode conceptos ya existentes.
Un modelo de diseo del rotomartillo Hilti.
No se deja nada al azar. La forma, la disposicin
y la eleccin de los materiales para los
componentes de la carcasa se basan en una
gran cantidad de informacin obtenida de
estudios de diseo y aplicacin, de pruebas
prcticas y duraderas realizadas en sitio, de
anlisis ergonmicos y de encuestas a usuarios.
Este enfoque inflexible le permite beneficiarse
de una gran cantidad de caractersticas
convincentes tales como el nuevo diseo
avanzado del agarre y del Sistema AVR de
Reduccin Activa de al Vibracin incorporado
en los rotomartillos Hilti.
Hilti reinventa las reglas de diseo de cinceles.
Cmo es un cincel? Apenas ha cambiado
desde la Edad de Piedra. Sin embargo, Hilti es
conciente de que incluso el mejor rotomartillo
slo puede ser tan bueno como el cincel
que se utiliza para transformar la energa de
impacto en un poder de ruptura explosivo. El
resultado es el revolucionario Cincel Poligonal
de Hilti.
Gracias a su forma poligonal, este galardonado
cincel, todava nico, no solo alcanza mayores
rangos de ruptura y reduce en gran medida la
adherencia, sino que tambin es autoafilante
durante toda su vida til.
Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com
You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.
Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc
RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes
Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes
Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no
Significado de smbolos
Pg.12
Servicio de logstica HILTI
Pg.16
HILTI Servicio de por Vida Pg.13
Servicio de calibracin Pg.17
Entrenamiento y seminarios Pg.19
Ejecutivos de cuenta, Servico a clientes, HILTI Centers Pg.14
Ingeniera y soporte tcnico Pg.18
HILTI Online Pg.20
Responsabilidad ambiental Pg.21
Tecnologa a bateras
Pg.15
Hilti. Mejor desempeo. Mxima duracin.
Servicios.
Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com
You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.
Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc
RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes
Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes
Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no
1111 Servicioswww.quimicasuiza.com/hilti(511)2114422
Servicios
Significado de smbolos
Pg.12
Servicio de logstica HILTI
Pg.16
HILTI Servicio de por Vida Pg.13
Servicio de calibracin Pg.17
Entrenamiento y seminarios Pg.19
Ejecutivos de cuenta, Servico a clientes, HILTI Centers Pg.14
Ingeniera y soporte tcnico Pg.18
HILTI Online Pg.20
Responsabilidad ambiental Pg.21
Tecnologa a bateras
Pg.15
Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com
You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.
Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc
RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes
Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes
Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no
NO COSTS
MANUFACTURERSWARRANTY
REPAIR COST LIMIT
LIFETIME SERVICE
2 Years up to
Lifetime Lifetime
The Hilti Power Effect
Hilti tools plus Hilti accessories.Total Performance.
ServiciodeporvidaHilti:Proveeunservicionicoportodalavidadesuherramienta-completamentesincargoalgunoporhastalosprimerosdosaosdesdeeldadecompracubriendopartesparareparacinoreemplazo(inclusopartessujetasaldesgaste),incluyendoeltransportedelaherramientasincostoalguno.Despusdeestetiempo,Hilticontinacomprobandolacalidadensusproductosofreciendounlmiteenelcostodereparacinportodalavidadetuherramienta.
ServiciodecalibracinHiltiresultadosfiablesdemedicindemaneraconstanteparatodaslasherramientasdemedicinHilti.
LasherramientasylosaccesoriosHiltisedesarrollanypruebandemaneraconjunta,haciendoqueellosseemparejenperfectamenteelunoalotro.Assepuedebeneficiardelniveldeoperacindeunsistemacompletoqueabarcamuchomsquesololasumadesuscomponentes.
ElSistemaControlActivodeTorque(ATC)ofrecemximaseguridad,trabajoconfortableysinrestriccionesgraciasalareduccinautomticadelarotacinensituacionescrticas.
ElSistemadeReduccinActivadelaVibracin(AVR)reducelavibracinhastapordostercioscomparadoconotrasherramientasconvencionales.
HiltiPulsePowerarribadeunmillndeimpulsosporsegundopararesultadosdemedicinrpidosyaltamentefiables,anencondicionesdetrabajodifciles.
Significado de smbolos
Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com
You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.
Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc
RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes
Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes
Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no
SINCOSTOS
GARANTADE FABRICACIN
COSTOLIMITADO DEREPARACIN
SERVICIODE POR VIDA
2aosHasta
De por vidaDe por vida
Hilti Servicio de por Vida
Extraordinarios servicios que duran toda la vida.Un paquete de servicios nico para aquellos que desean ser propietarios de sus herramientas.LasherramientasHiltiestndiseadasparadurar.Peroinclusosiaparecealgndefecto,HiltiseharcargograciasalServicioHiltideporVida.Deformaprofesional,sincargoalguno,porhastadosaosdeldadecompra.DespusdeestetiempocontinuamoscomprobandolacalidaddenuestrosproductosofrecindoleuncostolmiteenlareparacinhastaquecontineutilizandosuherramientaHilti.Inclusolebrindamosunagarantadeporvidacontradefectosdefabricacin.Estosolocertificaloquesabemos,esnicoenelramodelaconstruccin.
Sin costos hasta por 2 aos*ConlasherramientasHiltiustedsebeneficiaconcerocostosdereparacin,hastapor2aosapartirdelafechadecompra.Estoincluye:ServicioderecoleccinyentregadeherramientasCostosdemanodeobraReparacinoreemplazodetodaslaspartesdefectuosasincluyendorefacciones**ServiciodemantenimientocuandoasloindiquelaluzdeservicioReparaciones,ajustesychequeopreventivodespusdecadareparacin
Adems:
3mesessincostoenlareparacinefectuada,aplicasobretodalaherramientaincluyendoparteselctricas
SincargoporrecoleccinAplicasloareparacionesfacturadas
Garanta de por vida del fabricante*Hiltireparaoreemplaza,sincargoalguno,todaslasherramientasquetenganfallascomoresultadodedefectosdefabricacinomaterialesdurantetodalavidatildelproducto.
*ConsultarexcepcionesalnmerodeAtencinalCliente:(511)2114422
**Nocubreenloscasosdedaoporcadas,impactosoeventosnaturales.Nocubreencasodequelaherramientaseaalteradao
reparadaoquesuspartesseanmanipuladasporpersonasnoautorizadasporHilti.Nocubreencasodenocontarconnmerode
serieoquestehayasidoalterado.Seexcluyenpistones,anillos.
Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com
You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.
Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc
RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes
Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes
Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no
A su servicio
Estamos cerca de usted.Por telfono, en un Hilti Center y directo en su obra.
Llevamos nuestros servicios hacia ustedLos Ejecutivos de Cuenta Hilti estn a su servicio en la obra, brindando experiencia que lo ayuda a estar un paso adelante, proporcionando conocimientos en aplicaciones, ayudndolo a seleccionar el producto ptimo para su obra, ofreciendo soluciones para situaciones complejas y dando demostraciones en sitio de productos innovadores.
Servicio a Clientes toma sus pedidosEstamos listos para responder a sus preguntas, asesorarlo tcnicamente, tomar sus pedidos, elaborar cotizaciones, disponibilidad de inventarios e informacin de precios, coordinar una visita de un Asesor Tcnico Hilti y cubrir sus necesidades en horario continuo de 8:00 a 18:00 hrs. Pero no se preocupe si no puede hablar con nosotros en este horario, nuestra lnea de fax est abierta para usted las 24 horas del da.
Oficina: Av. Repblica de Panam 2577 - La Victoria - Lima
Hilti Center una tienda para comprar herramientas HiltiAqu nuestros productos se encuentran disponibles de forma directa respaldado por el conocimiento y experiencia de nuestro personal. Pregunte por la demostracin de algn producto por el que se encuentre interesado y asegrese de irse con la solucin adecuada para sus necesidades. Triganos su herramienta Hilti si necesita servicio la revisaremos en la tienda y le recomendaremos la mejor accin a tomar.
Tienda: Av. Repblica de Panam 4099 - Surquillo - Lima
Telf. : (511) 211 4422Fax : (511) 211 4050
Telfax: (511) 446 6969
Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com
You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.
Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc
RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes
Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes
Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no
Tecnologaa batera
Tira los cables. Sistema de proteccin de bateras Hilti (CPC).
Librate y sigue adelante. ElsistemadeproteccindebaterasHilti(CPC)llevalatecnologadebaterasLitio-Ionaunanuevadimensin.Lasventajassonsimplementesensacionales:anmayorcapacidadypoderenlabatera,vidaextralargadelasceldas,controldevoltajeinde-pendienteparacadacelda;yuncascoergonmicoyreforzadoconfibradevidrio.HiltiCPCessumejorcompaeroparaliberarsedecablesenlaobra.
Controldevoltajeporseparadoparaprevenirlasobrecarga,calentamientoydes-cargadecadacelda
Listoparautilizarseencadamomentocargainicialrpidaconhastael75%deca-pacidad
SolamentelamitaddelpesodelasbaterasNiCd/NiMhconelmismotipodecapaci-dad
Noseautodescargalasbaterasnopierdensucargaduranteelalmacenamientoyestnlistasparautilizarseencualquiermomento
Mstrabajoporcargadebaterahasta100%mayorcapacidadquelasbaterasNiCd/NiMhdelmismopeso
LasceldastieneunamayorduracindevidaEstatusdelacargayalertadeLEDsAmigablealmedioambienteencontrasteaNiCd,noexisteningntipodepolucinpormetalespesadosparaelmedioambiente
Servicio nico para las herramientas Hilti Litio CPCEstasherramientasextremadamenteligerasyperfectamenteequilibradasproporcio-nanunnuevoniveldelibertadparatrabajosdemuchostipos.UnacaractersticanicadenuestrasherramientasLitioCPCeselserviciodeporvidaHilti.Lasreparacionesdelasherramientasinalmbricas,baterasycargadoressontotalmentegratuitasporlosprimerosdosaosdesdelafechadecompra.Ningnotroproveedorleofreceunserviciocomparableparasusherramientasinalmbricas.
Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com
You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.
Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc
RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes
Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes
Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no
Servicio de Logstica Hilti
Servicio de distribucin*. Entregamos donde sea.Plazo de entrega (sujeto a disponibilidad):DahbilsiguienteparalaCiudaddeLima.2dashbilesalinteriordelpasquecuentenconcoberturadelasprincipalescompaasdemensajera.
Entregas urgentes:Enpedidosrecibidoshastalas11:00hrs.:SloenLima,mismoda,sujetoatrfico.Restodelpas,sincargodefletealcliente(previaautorizacin).Plazo de entrega desde Hilti Centers:Enmostrador:inmediato,sujetoadisponibilidaddeproductosenelHiltiCenter.ConsulteconsuAsesordeObraparaconfirmarlasfechasdeentrega.*Sujetoadisponibilidaddeinventarioyniveldeservicio.
Servicio post-venta. Servicio y calidad.
EnHiltileofrecemosunsoportetcnicoespecializado,durantelavidatildesuherramienta.Nuestro servicio de post-venta le ofrece los siguientes servicios:ServicioespecializadoalclienteMantenimientoantesqueunareparacinCostosmenoresdereparacinSeguimientodesuherramientaalolargodelavidatildelamismaAtencinpersonalizadaRecoleccindesusherramientasEntregadesusherramientasatodoelpassincostoCostolmitedereparacinServiciodeporvidaSistemadepre-aprobacinPara empezar su trmite de reparacin necesita:IdentificarqueherramientaHiltitiene(Modeloynmerodeserie)Llamaral: (511)2114000(A)1680,SERVICIOTCNICO (511)4466969,HILTICENTER (511)2114422,SERVICIOALCLIENTE
Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com
You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.
Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc
RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes
Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes
Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no
Servicio de Calibracin
Precisin verificada.La revisin para las herramientas de medicin Hilti.
LasherramientasdemedicinHilti,comotodoslosinstrumentosdemedicin,puedenverseafectadosatravsdeltiempoporelusodiarioencondicionesdetrabajo,porlascondicionesdealmacenamientoylasinfluenciasexternas.GraciasalServiciodeCalibracinHilti,losprofesionalesenelnegociodelaconstruccinpuedenconfiarenlasherramientasdemedicinHilti.
Revisionesregularesaseguranquelasherramientassiganoperandodemaneraprecisaconformealosestndaresyrequisicionesaplicables.DeestamaneraHiltirecomiendaunacalibracinanualdecadaherramientasujetaalusonormal.Siseencuentrandeficiencias,laherramientaserreajustadaparaasegurarquefuncioneconlaprecisinyfiabilidaddesiempre.Hiltilegarantizaestoconuncertificadodecalibracinqueconfirmequelaherramientacumplalasespecificaciones.
La precisin viene de forma automticaGraciasalavisoautomticodecuandoserequiereelsiguienteserviciodecalibracin,elusuariopuedeestarsegurodequesusherramientasdemedicinHiltisonrevisadasdemaneraprofesionalenintervalosregularesyquecumplenconlasespecificacionesindicadasenelmanualdeinstrucciones.
Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com
You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.
Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc
RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes
Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes
Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no
Ingeniera y Soporte Tcnico
Asistencia profesional.Ayudamos a que sus proyectos sean un xito.
Informacin para integrar proyectos, planificacin y apoyoNuestropersonalaltamenteexperimentadoloapoyaparaasegurarquelascosassehaganbiendesdelaprimeravez.Lopodemosapoyarconsusproyectos,especificaciones,normas,catlogospersonalizadosyhojasdeseguridad.Laplanificacin,listademateriales,clculosydibujosparaproyectosgrandessonpartedelpaquete.NuestrosEspecialistasdeProyectoHiltiapoyancoordinandolosserviciosdelogsticayapoyotcnicoporproyectodefinido.
Asesora tcnica en su obraNuestrosIngenierosyTcnicosleofrecenapoyodirectoenobraencualquierlocacin.Ofrecenunserviciodeconsultoraparaarquitectos,planeadores,ingenierosyprofesionalesdelaconstruccinennecesidadesespecficasparasusaplicaciones.Entrenamientosycertificacionestambinsonpartedenuestroservicio.
Software tcnico y documentosNuestrassolucionesinnovadorasyprcticasensoftwareestndisponiblesparaapoyarloensutrabajodiario,cubriendodiseosdeanclajesyseleccindeconceptosdeinstalacin.Descargadedocumentostcnicosdesdenuestrapginaweb:www.quimicasuiza.com/hilti
Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com
You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.
Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc
RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes
Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes
Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no
Entrenamiento y Seminarios
Saber cmo.Para cada especialidad en el ramo de la construccin.
EntrenamientosNosaseguramosyprotegemossurentabilidadconlabastaexperienciaqueHiltiofrece;brindamosentrenamientosenrelacinalosproductosyserviciosdecalidadmundial,integrandounvaloragregadoasutrabajo.Estoseventosseorganizanentodoelpas,preguntaatuAsesorTcnicoyagendapronto.
Qu ofrecemos y cmo lo beneficiaDuracindelosentrenamientosdesde2horashasta2dasEntrenamientotcnicoyprcticoMejoradelaseguridadyproductividadenlaobrayproyectosCertificacin,constancias,etc.
Cursos especficosEntrenamientosdeanclajesQumicosyMecnicosSeminariosdeSistemasCortafuegoEntrenamientosespecficosporsegmento,talleresdeseguridad,etc.EntrenamientosdesistemasDX(Fijacindirecta)
Preguntaportemarios,talleresyherramientasdigitales(software,bloquesCAD,etc.)
Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com
You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.
Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc
RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes
Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes
Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no
Hilti Online
Solo con un click.A su disposicin las 24 horas del da.
Lapginawebwww.quimicasuiza.com/hiltiestasudisposicinlas24horasdelda.Conslounclickustedpodraccederalasiguienteinformacin:
CatlogodeproductosSoftwaredediseodeanclajesLocalizacindelHiltiCentermscercanoNuevosproductosDescargasdedocumentosRegistropararecibirinformacinvaelectrnica
ymuchoms.
Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com
You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.
Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc
RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes
Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes
Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no
Responsabilidad Ambiental
Construimos un mejor futuro.Estamos comprometidos a reducir el impacto ambiental.
LaproteccindelmedioambienteesunaparteintegraldenuestraculturaysemanifiestaennuestropropsitocorporativoApasionadamente,creamosclientesentusiastasyconstruimosunmejorfuturo!Tomamosencuentaalmedioambienteyvariosaspectosdesaludyseguridadduranteeldesarrollo,diseo,fabricacin,entrega,usodelosproductosyeliminacindelosmismos.Estoaseguraelcumplimientodelegislacionesactualesyfuturasdelmedioambienteyseguridad,lamejoraconstanteparacumplirconlasnormasambientalesanivelmundialennuestrasplantasHilti,ylaaplicacindeestaculturaennuestrosproveedores.Porquecreemosfirmementequesiasumimosnuestraresponsabilidadconelmedioambientepodemoscrecerdeformarentablealargoplazo.
Minimizando el impacto ambientalHiltimanejalosasuntosambientalesconelmismorigorqueotrosaspectosdelacompaa.Nosesforzamosparaminimizarcualquierposibleefectodainoenelambientequepuedaresultarcomoconsecuenciadeunadenuestrasacciones.Hiltisiempreestreduciendoelimpactoambientalnegativoenlaoperacindesumanufacturayenvos.
Nuestro deber con la humanidad y el medio ambienteHiltiapoyalos10principiosdelPactoMundialdelasNacionesUnidasqueinvitaalascompaasareconocer,apoyaryponerenprcticadentrodesuesferadeinfluenciauncatlogodevaloresfundamentalesrelacionadosalosderechoshumanos,normaslaborales,proteccindelmedioambienteyluchacontralacorrupcin.YaqueHiltitambintieneunaresponsabilidadecolgicaque,entreotrosaspectosambientales,significaquelaproteccindelclimatambinesunapreocupacin,firmamosCaringforClimateConvention(ConvencinCuidandoelClima)en2007.ElCdigodeConductaparaProveedoresdeHiltidetallalasexpectativasconsussociosyproveedores.Hablasobrelosrequerimientossociales,deseguridadyproteccindemedioambientemientrastambintratalosrequerimientoslegalesyelcompromisodelascompaasparalucharcontralacorrupcin.HiltitambinsiguelosindicadoresproporcionadosporGlobalReportingInitiative(GRIIniciativadelReporteGlobal)yreportaindicadoresrelevantesdeHiltiensuReporteAnual.
El cumplimiento con las regulaciones es un requisito para una accin y conducta responsableEnHilti,somosestrictosconelcumplimientoRoHS(restriccindelautilizacindedeterminadassustanciaspeligrosasenaparatoselctricosyelectrnicos),RAEE(ResiduosdeAparatosElctricosyElctrnicos),REACH(Registro,EvaluacinyAutorizacindelasSustanciasQumicas).Adems,HiltifueacreditadoenISO9001en1985yagreglaacreditacinenISO14001en1997.EstasnormasISOconstituyenlabasedenuestrosistemaintegradodegestinqueescertificadodemaneraindependienteporSwissAccreditationService(SQSServicioSuizodeAcreditacin).
Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com
You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.
Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc
RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes
Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes
Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no
Sistemas de medicin lser.
Hilti. Mejor desempeo. Mxima duracin.
Sistemas de medicin lser.
Hilti. Mejor desempeo. Mxima duracin.
Sistemas de medicin lser.
Hilti. Mejor desempeo. Mxima duracin.
Medidores de distancia lser
Alineacin y nivelacin lser
Sistemas de deteccin
Accesorios medicin lser
Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com
You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.
Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc
RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes
Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes
Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no
2Medicin lser
2 Sistemas de medicin lserwww.quimicasuiza.com/hilti (511) 211 4422 23
Medidores de distancia lser
Alineacin y nivelacin lser
Sistemas de deteccin
Accesorios medicin lser
Medidor lser PD 4 Pg. 24Medidor lser PD 40 Pg. 25Medidor lser PD 42 Pg. 26
Lser multidireccional PMP 34 kit Pg. 27Lser lineal PML 32-R / PMA 30 Pg. 28
Lser rotatorio PR 20 Pg. 29 Lser rotatorio PRE 3 Pg. 30
Sistema Ferroscan PS 200 Pg. 32
Varios Pg. 33-34
Lser rotatorio PRI 2 Pg. 31
Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com
You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.
Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc
RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes
Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes
Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no
24 2 Sistemas de medicin lser www.quimicasuiza.com/hilti (511) 211 4422
Medidores de distancia lser
Medidor lserPD 4
Aplicaciones n Medicin de distancias entre 0.2 m y 70 m con gran exactitud n Mediciones rpidas y seguras en lugares de difcil acceso
Datos de pedido
Descripcin Contenido Cantidad No. Item
Medidor lser PD 4 PD 4, 2 AA pilas alcalinas, manual de instrucciones, estuche, compartimiento para bateras y certificado del fabricante
1 un 00202416
Datos Tcnicos
PD 4Precisin 2 mm
Rango de medicin 0.2 m - 70 m
Funcin de clculo Mediciones directas / tracking
Lser 635 nm, clase 2 (IEC 825-1), clase II (FDA 21 CFR)
Vida de las baterias alcalinas 20,000 mediciones
Peso incluye bateras (g) 180 g
Rango de temperatura de aplicacin
-10C a +50C
Tipo de proteccin contra polvo y agua
IP X5
Accesorios Pg. 33 - 34
Del tamao de tu bolsillo y a prueba de agua!
Caractersticas y Beneficios n 100% a prueba de agua y polvo n Diseo robusto para su uso en trabajos de obra n Operacin con un solo botn n Fcil de utilizar n Solo se necesita un operario n Diseo ergonmico para un nivel de operacin nico y conveniente n Precisin lser para obtener mediciones confiables
SIN COSTOS
GARANTA DE FABRICACIN
COSTO LIMITADO DE REPARACIN
SERVICIO DE POR VIDA
2 aos
De por vida De por vida
* Cuenta con un dispositivo de bloque para proteccin de temperaturas extremas +/-
Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com
You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.
Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc
RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes
Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes
Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no
2252 Sistemas de medicin lserwww.quimicasuiza.com/hilti (511) 211 4422
Medidores de distancia lser
Medidor lserPD 40
Aplicaciones n Mide distancias de 0.05 m a 200 m con precisin lser n Medidas directas de distancias y clculos de reas n Mediciones rpidas y seguras en lugares de difcil acceso
Datos de pedido
Descripcin Contenido Cantidad No. Item
Medidor lser PD 40 PD 40, correa, 2 pilas AA alcalinas, manual de instrucciones, estuche, compartimiento para bateras y certificado del fabricante
1 un 00320281
Datos Tcnicos
PD 40Precisin 1 mm
Rango de medicin 0.05 m - 200 m
Funcin de clculo Medicin, tracking, rea, suma y resta
Lser 635 nm, clase 2 (IEC 825-1), clase II (FDA 21 CFR)
Vida de las baterias alcalinas 10,000 mediciones
Peso incluye bateras (g) 200 g
Rango de temperatura de aplicacin
-10C a +50C
Tipo de proteccin contra polvo y agua
IP 54
Accesorios Pg. 33 - 34
Mediciones exactas de 5 cm hasta 200 metros
Caractersticas y Beneficios n Solo se requiere una persona para su uso n Fcil de utilizar n Mide distancias en menos de un segundo n Compacta, diseo ergonmico, robusta y perfecta para trabajos
en obra
n Rpida medicin de reas
SIN COSTOS
GARANTA DE FABRICACIN
COSTO LIMITADO DE REPARACIN
SERVICIO DE POR VIDA
2 aos
De por vida De por vida
* Cuenta con un dispositivo de bloque para proteccin de temperaturas extremas +/-
Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com
You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.
Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc
RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes
Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes
Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no
26 2 Sistemas de medicin lser www.quimicasuiza.com/hilti (511) 211 4422
Medidores de distancia lser
Medidor lserPD 42
Aplicaciones n Mediciones rpidas y seguras en lugares de difcil acceso n Mide distancias de 0.05 m a 200 m con precisin lser n Mediciones de distancia directa e indirectas y clculos de rea y
volmen
n Revisin de paralelas y ngulos rectos con la funcin MIN/MAX
Datos de pedido
Descripcin Contenido Cantidad No. Item
Medidor lser PD 42 PD 42, correa, 2 x AA pilas alcalinas, manual de instrucciones, estuche, compartimiento para bateras y certificado del fabricante
1 un 00320285
Datos Tcnicos
PD 42Precisin 1 mm
Rango de medicin 0.05 m - 200 m
Funcin de clculo rea, volumen, Pitgoras x 3, cronmetro, memoria x 30, rea
pintada, botn para borrar
Lser 635 nm, clase 2 (IEC 825-1), clase II (FDA 21 CFR)
Vida de las baterias alcalinas 10,000 mediciones
Peso (g) 200 g
Rango de temperatura de aplicacin
-10C a +50C
Tipo de proteccin contra polvo y agua
IP 54
Accesorios Pg. 33 - 34
Gran rango de funciones y mediciones en cualquier tipo de condiciones
Caractersticas y Beneficios n Solo se requiere una persona para su uso, an en lugares
luminosos
n Interfase grfica con varias funciones n Guarda mediciones exactas en la memoria - no hay necesidad de
medir nuevamente
n Mediciones fciles y seguras en lugares de difcil acceso
SIN COSTOS
GARANTA DE FABRICACIN
COSTO LIMITADO DE REPARACIN
SERVICIO DE POR VIDA
2 aos
De por vida De por vida
* Cuenta con un dispositivo de bloque para proteccin de temperaturas extremas +/-
Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com
You can view actual document colors and color spaces, with the free Color Editor (Viewer), a Plug-In from the Prinect PDF Toolbox. Please request a PDF Toolbox CD from your local Heidelberg office in order to install it on your computer.
Applied Color Management Settings:Output Intent (Press Profile): SM74-nueva_s10 U330 K95 9-10.icc
RGB Image:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
RGB Graphic:Profile: eciRGB.iccRendering Intent: PerceptualBlack Point Compensation: no
CMYK Image:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
CMYK Graphic:Profile: SM74-nueva_s10 U330 K95 9-10.iccRendering Intent: PerceptualBlack Point Compensation: noPreserve Black: no
Device Independent RGB/Lab Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent RGB/Lab Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Image:Rendering Intent: PerceptualBlack Point Compensation: no
Device Independent CMYK/Gray Graphic:Rendering Intent: PerceptualBlack Point Compensation: no
Turn R=G=B (Tolerance 0.5%) Graphic into Gray: yes
Turn C=M=Y,K=0 (Tolerance 0.1%) Graphic into Gray: noCMM for overprinting CMYK graphic: yesGray Image: Apply CMYK Profile: noGray Graphic: Apply CMYK Profile: noTreat Calibrated RGB as Device RGB: noTreat Calibrated Gray as Device Gray: yesRemove embedded non-CMYK Profiles: yesRemove embedded CMYK Profiles: yes
Applied Miscellaneous Settings:Colors to knockout: noGray to knockout: noPure black to overprint: yes Limit: 96%Turn Overprint CMYK White to Knockout: yesTurn Overprinting Device Gray to K: yesCMYK Overprint mode: set to OPM1 if not setCreate "All" from 4x100% CMYK: yesDelete "All" Colors: noConvert "All" to K: no
2272 Sistemas de medicin lserwww.quimicasuiza.com/hilti (511) 211 4422
Alineacin y nivelacin lser
Lser multidireccionalPMP 34Nivela, plomada y escuadra simultneamente
Caractersticas y Beneficios n Alineacin interior de hasta 30 metros n Alineacin rpida y sin errores para exteriores n Proyecta 2 o 4 puntos, 2 verticales y 2 horizontales n Plomado hacia arriba y hacia abajo n Dos puntos de referencia en un ngulo de 90 n Alineacin horizontal n Herramienta autonivelante
Aplicaciones n Colocacin de rieles de tabla yeso n Posicionamiento de charolas porta cables n Marcado de bajantes de tubera hidrosanitaria n Transferencia de puntos - piso a techo
Datos Tcnicos
PMP 34Precisin 3 mm @ 10 m
Lser 650 nm, clase 2 (IEC 825-1), clase II (FDA 21 CFR)
Precisin cada 10 m 3 mm
Vida de las baterias alcalinas 40 h
Peso (g) 700 g
Rango de auto nivelacin 5
Tipo de proteccin contra polvo y agua
IP 54
Tiempo de autonivelacin
28 2 Sistemas de medicin lser www.quimicasuiza.com/hilti (511) 211 4422
Alineacin y nivelacin lser
PMA 30Rango de medicin 2 m - 30 m
Sensibilidad de la deteccin de la lnea lser a 5m de distancia
Alta: 0.7 mm / Estndar: 2 mm
Vida de las baterias alcalinas 50 h
Temperatura de operacin - min
-20 C
Temperatura de operacin - max
50 C
Tipo de proteccin contra polvo y agua
IP 54* Cuenta con un dispositivo de bloque para proteccin de temperaturas extremas +/-
Lser linealPML 32-R
Aplicaciones n Lneas de transferencia para referencias en paredes y de pisos a
techos
n Nivelacin de techos suspendidos y charolas porta cables n Alineaciones verticales en tuberas n Alineaciones horizontales y verticales de azulejos
Datos de pedido
Descripcin Contenido Cantidad No. Item
Combo PML 32 R y PMA 30 Maletn Hilti, lser lineal PML 32, funda, dianas, pilas, manual de instruc-ciones, certificado del fabricante y lentes
1 un 00331452
Datos Tcnicos
PML 32-RRango de medicin 2 m - 10 m
Lser 635 nm, clase 2 (IEC 825-1), clase II (FDA 21 CFR)
Precisin cada 10 m 1.5 mm
Vida de las baterias alcalinas 40 h
Peso (g) 600 g
Rango de auto nivelacin 5
Tipo de proteccin contra polvo y agua
IP 54
Rango mximo de operacin con receptor lser
30 m
Accesorios Pg. 33 - 34
La herramienta correcta para alinear y aplomar. Todo en uno.
Caractersticas y Beneficios n Operacin fcil y con un solo botn para todo tipo de aplicaciones n Las manos quedan libres para trabajar junto a la lnea referencial n El receptor lser PMA 30 ahorra tiempo, an en condiciones
luminosas
n Sistema de autonivelacin ( 5) n La lnea laser parpadea para advertir al usuario de una
desnivelacin y as obtener resultados confiables, rayo inteligente
n Simplificacin de nivelaciones y alineamientos en diversas alturas
Prinect Color EditorPage is color controlled with Prinect Color Editor 4.0.55Copyright 2008 Heidelberger Druckmaschinen AGhttp://www.heidelberg.com
You can