25
DNA

DNA. DNA is read from 5’ end DNA close up Central Dogma

  • View
    221

  • Download
    1

Embed Size (px)

Citation preview

Page 1: DNA. DNA is read from 5’ end DNA close up Central Dogma

DNA

Page 2: DNA. DNA is read from 5’ end DNA close up Central Dogma

DNA is read from 5’ end

Page 3: DNA. DNA is read from 5’ end DNA close up Central Dogma

DNA close up

Page 4: DNA. DNA is read from 5’ end DNA close up Central Dogma

Central Dogma

Page 5: DNA. DNA is read from 5’ end DNA close up Central Dogma
Page 6: DNA. DNA is read from 5’ end DNA close up Central Dogma

Symbol 3-letter Meaning Codons ------ -------- ------- ------

A Ala Alanine GCT,GCC,GCA,GCG C Cys Cysteine TGT,TGC D Asp Aspartic GAT,GAC E Glu Glutamic GAA,GAG F Phe Phenylalanine TTT,TTC G Gly Glycine GGT,GGC,GGA,GGG H His Histidine CAT,CAC I Ile Isoleucine ATT,ATC,ATA K Lys Lysine AAA,AAG L Leu Leucine TTG,TTA,CTT,CTC,CTA,CTG M Met Methionine ATG N Asn Asparagine AAT,AAC P Pro Proline CCT,CCC,CCA,CCG Q Gln Glutamine CAA,CAG R Arg Arginine CGT,CGC,CGA,CGG,AGA,AGG S Ser Serine TCT,TCC,TCA,TCG,AGT,AGC T Thr Threonine ACT,ACC,ACA,ACG V Val Valine GTT,GTC,GTA,GTG W Trp Tryptophan TGG X Xxx Unknown Y Tyr Tyrosine TAT, TAC * End Terminator TAA,TAG,TGA

Page 7: DNA. DNA is read from 5’ end DNA close up Central Dogma
Page 8: DNA. DNA is read from 5’ end DNA close up Central Dogma
Page 9: DNA. DNA is read from 5’ end DNA close up Central Dogma

Binding of RNA polymerase at start of transcription

Page 10: DNA. DNA is read from 5’ end DNA close up Central Dogma

Transcription

Page 11: DNA. DNA is read from 5’ end DNA close up Central Dogma

Transcription (con’t)

Page 12: DNA. DNA is read from 5’ end DNA close up Central Dogma

Transcription complete

Page 13: DNA. DNA is read from 5’ end DNA close up Central Dogma
Page 14: DNA. DNA is read from 5’ end DNA close up Central Dogma

tRNA

Page 15: DNA. DNA is read from 5’ end DNA close up Central Dogma
Page 16: DNA. DNA is read from 5’ end DNA close up Central Dogma

Translation

Page 17: DNA. DNA is read from 5’ end DNA close up Central Dogma
Page 18: DNA. DNA is read from 5’ end DNA close up Central Dogma
Page 19: DNA. DNA is read from 5’ end DNA close up Central Dogma

E. coli dUTPase

MKKIDVKILDPRVGKEFPLPTYATSGSAGLDLRACLNDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRSGLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDSFTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEGGFGHSGRQ 1 atgaaaaaaa tcgacgttaa gattctggac ccgcgcgttg ggaaggaatt tccgctcccg 61 acttatgcca cctctggctc tgccggactt gacctgcgtg cctgtctcaa cgacgccgta 121 gaactggctc cgggtgacac tacgctggtt ccgaccgggc tggcgattca tattgccgat 181 ccttcactgg cggcaatgat gctgccgcgc tccggattgg gacataagca cggtatcgtg 241 cttggtaacc tggtaggatt gatcgattct gactatcagg gccagttgat gatttccgtg 301 tggaaccgtg gtcaggacag cttcaccatt caacctggcg aacgcatcgc ccagatgatt 361 tttgttccgg tagtacaggc tgaatttaat ctggtggaag atttcgacgc caccgaccgc 421 ggtgaaggcg gctttggtca ctctggtcgt cagtaa

Page 20: DNA. DNA is read from 5’ end DNA close up Central Dogma

Polysomal translation

Page 21: DNA. DNA is read from 5’ end DNA close up Central Dogma

lac operon

Page 22: DNA. DNA is read from 5’ end DNA close up Central Dogma

Regulatory gene, i, codes for repressor protein

Page 23: DNA. DNA is read from 5’ end DNA close up Central Dogma
Page 24: DNA. DNA is read from 5’ end DNA close up Central Dogma

Can also have enhancers

Page 25: DNA. DNA is read from 5’ end DNA close up Central Dogma