VISTA5V40XM

COMMERCIAL FIRE ANDBURGURY AWRM SYSTEM

INSTALWTIONINSTRUCTIONS

NW19V1W3

CONGMTUMTIONS!On Your Purchase Of The Ademco 5140XM

The purpose of these Installation Instructions is to give you a comple~eoverview of the system, and provide instructions for installing a basicsystem.

CONTACTING TECHNICAL SUPPORT

PLEASE,Before you can Technical Support, be sure yew.

● READ THE INSTRUCTIONS!● Check au wiring connections.● Determine that the power supply anWor backup battery are

supplying proper voltages.● Veri@ your programming information where applicable.● Note the proper model number of this product, and the

version level (if known) along with any documentation thatcame with the product.

● Note your ADEMCO customer number andor companyname.

Having this information handy win make it easier for us to setiyou quictiy and effectively.

You may contact Technical Support ti,a Toll Free Fax. Please include yourreturn fax number. You will receive a reply within 24 hours. You may alsocontact Technical Support via modem to ATLIS-BBS, Tech Support’sElectronic Bulletin Board System. Replies are posted within 24 hours.

East Coast Technical Support: 1-800-645-7492 (8 a.m.-6 p.m. E. S. T.)West Coast Technical Support: 1-800-458-9469 (8 a.m.-5 p.m. p.S.T.)

Technical Support Fax Number: 1-800-447-5086ATLIS-BBS Electronic Bulletin Board System: 1-516-496-3980

(1200 -9600 Baud, 8 Data Bik, 1 StatiStop Bit, No Parity)

-2-

TABLE OF CONTENTS1.

Il.

Ill.

Iv.

v.

.,-

GENERAL INFORMATION . . . . . . . . . . . . . . . . ...5The 5140XM Control .........................................5Easy Prqrammim ......... ........ ..... .. .............. ....5Merno~;f Aarm.~ .......... ....... ...... .. .............. ....5Buift-in User’s Manual& Dexriptor Review.,.. .... ...5

ZONE CONFIGURATIONS . . . . . . . . . . . . . . . . ...6ZONE WPEDEFINlm~S ...... ....... ............... ....6BAsfc8HARD-wlRED zoNEs .. ..... .. .............. ...8

Zones 1 a 2: 2-W!re Smoke Detedors ............... 8fine 6: Alternate Tampar Funtiion ................... 9Zrme7Alternate Keyswitch Fundhn ...............9Zone 8: 2-Wire Glaaa Bre* Detedors .... ... .... ... 9

2-WIRE POLLING LOOP EXPANSION ................1OAdvimries .. ..... ........ .. ..... .. ....... ............... ...l OPolfing LW Smoke Dettiom ....... .. ........... ...l OMsc. Polling Loop Devices ............................ll

SYSTEM ZONES ......... .. ....... ........ .............. ...12

PERIPHERAL DEVICES . . . .. . .. .. .. . .. . .. ...13REmmmNmLEs ...... ....... ......... ............ ...l3

Two Console p0~5 .......................................l3PowetiW Ati Wring ..... ....... ....... .............. ...l4Addressable ~nsole DIP Switches .... .. ..........14

BELL CIRCUIT OUTPUTS .................................16Ganerd lnfomation ........ ..... ......... ............ ...l6Power and Wiring.., ......... .............................l6

AUXILIARY RELAY .........................................l7DIALER OUTPUTS ..........................................l8~&ERO~WS ....... .... .. ..... .. ............... ....l9

General lnformatbn .... .. ..... ....... ............... ....l9Remtie &nsole Sunder Opration ................2ORemote Keyswfich @ratbnNiring. ... ........ ...215140LED indeator Mule ... ....... .. ............. ...22Auxitia~ Alarm S@nafing Equipment .....23.........23Event L~ging Ptinter ~nn~ions .. ........... ....24Dir@Wrre Downbti~ .... .. ....... .............. ....25

MOUNTING & POWERING . . . . . . . . . . . . . . . ...26tiuming the Cti!net ........ ....... .............. ......26Mounting the CaMnet &k . ....... .......... .... ......26Mounting thetinmles .... .. ....... ......... ...........27AdjuSi~the LCD Viewi~ Awle.., ...... .. .. .......28

POWERING THE SYSTEM, . ..... .. ....... ............ ...29AC Power .. .................................................29Eatih Ground @nnedbns ..... ....... ............. ...29Batte~ Supervisbn ...... ..... .. ..... ................ ...3OBack-Up Pwer Calculations ..........................soPower-Up Pmdure ... ....... ...... ............... .....3OPolhng Lwp Cument Draw Worksheet .......... ....31Total Standby/Alarm bad Worksheets ........ ....31Battmy Capacity Calculation Worksheet ... .... ...32Battery Seltibn Table ..... ....... .. .............. ....32

SYSTEM OPERATION . . . . . . . . . . . . . . . . . . . . ...33SECURIWACCESS CODES ........ ................ ....33

Installer Code . ....... ....... ....... .. ........... .... ......33MasterManager Qdes ... ....... ....... ..... .. .. ... ...35Opera!or tides . .. ....... ........ ........ ............. ...35Duress We . .... ......... ....... ...... .. .............. ...35

KEYPAD Functions .... .. ..... .. ..... .. .............. ...36Arming Funtiions ....... ......... ..... .............. .....36Wew Capabi~iies OfaUser ... ........ ............. ....37WeWing Dow”loaded Messages ......................37Using the Buift-in User,s Guide...,,,37 ........... ....37Displaying Descriptors ...... .. ..... .. .............. ....37Panic Keys ..... ....... ........ ......... .............. .....37

v: SYSTEM-OPERATION (cent.)............,,38FIRE SUPERVISORY .&TROUBLE CONDITDNS..38

Supewiw~ & ‘Che&” Message ..,., .... ........ ...38Power F*lure ... ..... ... .... .... ..... .... ... .. ......... ...38~her Troubie &ndfiions . .... ..... ... ...... ........ ...38

S~lNGTHE REAL-TiME CLOCK ..... ...... .. .......39EVENT L~lNG PROCEDURES . .... ....... ....... ..4O

Pr~rammirrg .... .... ... .... ..... .... .... .... ... ....... ...40Display& Ptint M&es . .... ... ...... ... ....... ....... ...4OClear Event Log . .... .... ... ..... .... .... ..... .. .. ..... ...4l

V1. SVSTEM COMMUNICATION . . . . . . . . . . . . . ...42Splk/Dual Repoming .....................................42Adem Low Spe4 . ... .... ... ..... .... .. ......... ......42SESCOA/Radionics ... .. .. .... ..........................424+2 Rap fiing .............................. ...............42*2 Expre= . .... .... .... ... ..... .... .... ......... ..... ...42Ademm High Speed Repoting .......................43tinw ID Re~tiiW ... ... ..... .... ... ....... ..... .. ...43Table of Contact ID Event tides ....................44timmunimtbn Pr~ramming Guide ................44

V1l. PROGRAMMING THE SYSTEM . . . . . . . . . ...45GENERAL PR~RAMMING P-EDURES .... ....45

~mmunhfon Defauk Pr~ramming..,, ..... .....45Zone, Devtia Afpha Prqrmming ... .....45. .....45P~ramming Steps . . .... .. ..... ... ...... ......... ......45

QMMUNCATfON PROGRAMMING .... ........ ......47Loading Defaults . ..... .... ...............................47E=y-to-Pr~rm Communkation fields ... .. .....47Summary of Defaufr tins~uences ... ...... .. .....48

PRffiWMING DATA FIELDS ..... ..... ...... .. ......49*MmuwE ...... ... .. .... ... .. .. ..... ......... .......5o

Vlll.

lx.

x.

——————xl.

——

ZOne P~ramming ... .... ... ...... . .. .... ........ .......50Device Programming ....................................5oAl~a PqrammiW ... ... ... ..... .... .... .. ........ .....5lEnteting Zone Dexriptors . .... ..... ..... .. ....... ....5lAdding Custom Words . .................................52Creating a Custom Message ..........................52Vocabulary of Wordsln MemoV .....................53

DOWNLOADING PRIMER . . . . . . . . . . . . . . ...54

TESTING THE SYSTEM . . . . . . . . . . . . . . . . . ...56Batte~ Test . .............. ...................... ..........56Daler Test ... ... .... ... .... .... .... ..... ..... ....... .......56Ere Drill T& ... .... ... .... .... ... .... ..... ......... .......56One Man Fire Walk Test ................................56Burglary Wafk Tast .. ... ... .... .. ... .... ....... ....... ...57Arm.WBugla~ Tea ... ... .... .... ..... ..... .. ....... ...57Turning the System Over to the User,, ........57...57

REGULATORY AGENCY REQUlREMENT!j58Wsc. ULR~uirments . ... .... ..... ... .... ......... ..... ...58New York C~R~uirements .... .... .... ........ ..... ...584190WH OPERATION & WIRING .... ......59DIP SWITCH SETTING TABLEs .... .... ...6oCOMMUNICATION DEFAULTS .. . ... .. .. ...62SPECIFICATION S . . . . . . . . . . . . . . . . . . . . . . . . . . . 66SUMMARY OF CONNECTIONS . . . . . . . . . ...67PROGRAMMING FORM . . . . . . . . . .. Centerfold

--3-

LIST OF FIGURES

LIST OF FIGURES1,

2.

3.

4.

5.

6.

7.

8.

9,

10.

11.

12.

13.

14.

15.

16.

17.

18.

19.

20.

21.

5140XM FIRE CONTROL SYSTEM .....................................................................................5 _

ALARM SAF POWER SUPPLY CONNECTION DIAGRAM ...................................................l4

ADDRESSABLE CONSOLE .............................................................................................l5

BELL clRculT wlRING .....................................................................................................l6

AUXILIARY REMY wlRING ...............................................................................................l7

J2 PIN ASSIGNMENTS AND Functions ..........................................................................l9

REMOTE CONSOLE SOUNDER WIRING ..........................................................................2O

KEYswlTcH wlRING ........................................................................................................2l

5140LED INDICATOR MODULE WIRING ...........................................................................22

7620ULF’& 7920SE WIRING DIAGRAM .............................................................................23

346 POLARITY REVERSING RELAY WIRING .....................................................................23

W HIGH LINE SECURITY DIRECT WIRE TRANSMl~ER WIRING ........................ ..............23

EVENT LOGGING PRINTER Connections .....................................................................24

DIRECT WIRE DOWNLOADING Connections ................................................................25

CABINET ATTACK RESISTANCE CONSIDERATIONS .......................................................26

SURFACE MOUNTING CONSOLES ..................................................................................27

FLUSH MOUNTING CONSOLES ................................................................... ....................28

ADJUSTING THE VIEW ANGLE .........................................................................................28

BATTERY CONNECTION DIAGRAM ..................................................................................29

4190WH WIRING DIAGRAM ..............................................................................................59

SUMMARY OF CONNECTIONS DIAGRAM .........................................................................67-

-4-

GENERAL INFORMATIONTHE 5140XM

CONTROL

EASY PROGRAMMING

-

IMEMORY-OF-ALARM

BUILT-!N USER’SMMUAL AND

DESCRIPTOR REWW

The 5140XM offers the features of a UL listed commercial fire alarm alnd acommercial h~ia~ ala~ pSnel in one package. It may be used to provide eitherfire warni~ protection alone or both fire warning and burglay protection incommercial ~~mbns ranging from small stores to ~erate sized facfory/clfficecomplexes.The 5140XM is a microprocessor based programmable panel which featuresEEROM memory technobgy (power loss does not result in the loss of panelprogramming). R albws up to s’~een 5137AD (gray)/5137ADR (red) consoles tobe mnnecfed whwh provkfe audible~sual indications of system status and :illowuser errf~ of system @mmaMs. The5140XM provties 8 class B (style B) zonesati a buih-in polhng bop w~ch albWS the number of zones to ~ expanded to 64using 2-wire Plfing loop devbs. Zones maybe programmed to provide mainualfire alarm, automati fire alarm wth alarm verification, waferfbw alarm, sprinklersystem supervisory and various types of burgla~ protection. The 5140XMprovides one hiff-in auparviaed dialer output for transmitting alarm and sytiemstatus reprts to a Mnfral station via the swtichad telephone nefwok. It alsoallows an optional5140DLM supervised back-up dialer module to be conneded irequired.The 5140XM is designed to meet the foltiing standards:Commercial Burglary: Commercial Fire:UL6W Grade A bcal mercantile premise~safe UL 884/NPFA 72A local andati vauk UL864/NFPA 71 centralUL 611/1610 Grades A, AA Central Statin afatirrUL 3* Grades A, AA Po~ie tinnaof

The 5140XM can be programm~ at the office prior to installation or on the jobsite directly from a console or from a laptop wmputer using the 4130PCdownbading software and the4100SM PC/panel serial interface module. It canalw be programmed remtely over the swtichsd telephone wires using a PC, the4130PC software and a Hayes 1200 SMARTMODEM. For installer mnvenience,the panel is pre-programmed with a set of standard values that is designf!d tomeet the needs of many installations. These values, however, can be changed tosun the needs of any patiicular installation. The panel can also be pre-programmed by the installer with one of four standard communication defaukprogramming values, etiminafing the need for extensive programming time andeffort.

The Panel provides a memo~-of-alarm feature, whch, upon entering a securtiywde to ‘silence an alarm andor to dbarm the burglary potion of the system,aufomatilly diaphya an zones that were in an alarm corrdiinn.

For end-user Wnveniewe, the 5140XM wntains a built-in Users Manual. Bydepressing and froting any of the furrcfbn keys on the console for 5 semnds, abrief exDlanafion of that Darficular function Wrolls across the aloha-numericdi~lay.’ In atifon, all p~rammad zone descriptors can be displa~ed (one at atime) by pressing and holding the READY key for 5 seconds, then releasing thekey. This serves as a check for installers to be sure all descriptors are enteredproperly.

I5,,,-,,m.

m.=,I

8- B,mmB)ZONE*

(2wPPom2.W(RESMOKE.mc,o.s)I I

N,Ofi,c.

}

b BEu, m PRmwwE FORBURGMY :gl:::

cwB@m*

D~CES b SEE 2 Om y.’;o~z:ms,o.

9P, —Nmw q. P“Lmm-, Plw) fl&w~~ , .R , ~ ,, :&~ A“X REUY

➤ PR%WWE WNC.ON,

-5-

Il. ZONE CONFIGURATIONS

ZONE WPE DEFINITIONSThe 5140XM System albws up to M zones of hard-wire and polfing tip protection. Each zone must be assi~dto a zone type, whkh defines the way in whiih the system respnds to fauhs in that zone. In addition, there areseveral “system zones” for keypad panics, pelting ~p fauks, etc. whch must be assigned a zone type. Seethe“SyQem Zone” section for a fist of these zones.

TW 00Zone Hot Uaad

TW 01Entry/Exit #l Burglary

Tyw 02Entry~xlt #2 Burglary

TyPS 03Perimeter Burglary

TW 04Interior, Follower

rye 05Trouble by Day/Alarm

by Night

TYW 0624.hOur Silent Alarm

TYW 0724-hour Audible Alarm

TYPS 0824-hour Auxlliaq

Alarm

Program a zone wkh this zone type if the zone is not used.

This zone type provides entry delay whenever the zone is faulted if the wntrol isarmed in the Away or Stay modes. When the panel is armed in the Instant orMaximum modes, no entry delay is provided. Exit delay begins whenever themntrol is armed, regardless of the arming mode selected. These delays areprogrammable. This zone type is usually assigned to sensors or mntacts ondoors through which primary entry and exit will take place.

This zone type provides a secondary entry delay whenever the zone is faulted ifthe panel is armed in the Away and Stay males. When the panel is armed in theInstant or Maximum modes, no entry delay is provided. Secondary exit delaybegins whenever the mntrol is armed, regardless of the arming mode selected.These delays are programmable. This zone type is usually assigned to sensors orcontacts on doors through which seconda~ entry and exit will take place, andwhere more time might be needed to get to and from the ~nsole. Delay time mustbe greater than Zone type 1. (Ex.: a garage, bading dock, or basement door)

This zone type gives an instant alarm if the zone is fauked when the panel isarmed in the Away, Stay, Instant or Maximum modes. This zone type is usuallyassigned to all sensors or contacts on efierior doors and wintiws.

This zone type gives a delayed alarm (using the programmed Entry/exit time) fthe Entry/Exit zone is faulted first. Otherwise this zone type gives an instantalarm. This zone type is active when the panel is armed in the Away or mmi’ mmodes. Maximum mode eliminates the delay though. This zone ty~~”sbypassed automatically when the panel Is armed in the Stay orInstant modes. This zone type is usually assigned to a zone covering an areasuch as a foyer, bbby, or halhay through which one must pass upon entry (Afterfauting the entry/exif zone to reach the console to disarm the system.) Since thiszone type is designed to provide an instant alarm if the ent~/exif zone is notviolated first, if will protect an area in the event an intruder hides on the premisesprior to the system being armed, or gains access to the premises through anunprotected area.

This zone type will give an instant alarm if faulted when armed in the Away, Stay,Instant or Maximum (night) modes, During the disarmed state (day), the systemwill provide a latched trouble sounding from the console (and a central stationreport, if desired). This zone type is usually assigned to a zone which contains afoil-protected door or window (such as in a store), or to a zone covering a“sensitive” area such as a stock room, drug supply room, etc. This zone type canalso be used on a sensor or contact in an area where immediate notification of anentry is desired.

This zone type sends a report to the Central Station but provides no consoledsplay or sounding. This zone type ie usually assigned to a zone containing anEmergency button.

This zone type sends a report to the Central Station, and provides an alarm soundat the console, and an audible external alarm. This zone type is usually assignedto a zone that has an Emergency button.

This zone type sends a report to Central Station and provides an alarm souti atthe console, (No bell output is provided). This zone type is usuallyassigned to a zone containing a button for use in personal emergencies, or to azone containing non-fire related monitoring devices such as water se:=,s,temperature sensors, etc.

-6-

Type 09Supewiaed Fire (No

Verification),-.

Type 10itierlor w/Delay

Type 16Fire Mth Verification

Type 17Fire Waterflow

Ty~ 18Fire Supewiaory

Type 1924 Hour Trouble

Used for zones containing smke detectors (when smoke alarm verification is notdesired), or containing heat detectors, pull stations, etc. An open in this zonf? willintiate a trouble sig~l. A s~ti in this zone will mtiate afire alarm.

This zone type gives entry delay (usiW the programmed entry time), if tri[]pedwhen the panel is amed in the Away rode. This zone type is also active dlJfingmaximum mode, but no delay is provided (alarms occur immediately if zone istripped). This zone type Is bypassed when the panel Is srmed in theStay or fnstant modes. Delay begins whenever sensors in this zone areviolated, regardless of whether or not an entry/exif delay zone was tripped first.

Used when smke alarm verification Is desired on hardwire and polling loop zonesmnfaining only 2-wire or 4-wire smoke detedors. An open will initiate a trc,ubleresponse and a short initiates a fire alarm res~nse, Initial short detection causes6 second smoke detector power reset. Subsequent short detection wit~n 90smnds of reset causes fire alarm.

An open in this zone causes a trouble response. Shorts which remain present forbnger than the programmable time delay cause a fire alarm response,

This type is assigned to a zone haviW sensors which monitor fire sprinklersystems ~.e. PIV switches, etc.). An own in this zone causes a trouble. Shoflswhich remain present longer than the programmable time delay cause asupervisory res~nse. Supervisory response will not activate a bell output,

An open or shoti in this zone causes a trouble response. No external alarmsounders are actuated.

,-

-.7-

BASIC 8 HARD-WIRED ZONES (Zones 1-8)

GENERAL All zones have a 350 milh-second resWnse and can be assigned any zone t~.INFORMATION All zones provide class B (style B) supervision using a 2K EOL resistor (m ‘

610-7, supphed). The panel also supewises the zone wiring for eatih gro~fauns.

When programmed for fire warning usage, all zones can monitor 4-wire smkedetectors (zone ty~s 9, 16), N.O. fire alarm initiating devices (zone types 9, 17)or N.O. sprinkler system superviwry devices (zone type 18). When programmedfor burglary usage, all zones can mcnitor N.O. or N.C. alarm initiating devices. Useany UL fisted N.O. or N.C. device not requiring power from the panel. Use onlythose 4-wire smoke detectom Mstedbelow.

Note that power for 4-wire smoke detectors is supptied by the pane~s auxitiarypower #1 output and thb power mst be switched using the ~n~n auxi[ary relayto allow the detectors to be reset via the second entry of an OFF sequenm ~.e.:semrity code + OFF key) at a mnsole folbwing an slam. Also mte that a SystemSensor A77-71 6-01 EOL relay module must be used to supewise the powermnne~lons to 4-wire smoke detectors. See the AUXILIARY RELAY section forprogramming and wiring information. Zones which are programmed for fire withalarm verification respnse (zone type 16) should only be used to monitor smokedetectors.

Connect N.C. devices In series with the zone wires and connect N.O. devicesacross (In parallel with) the zone wires. Obsewe polarity when wiring smokedetectors. Connect the 2K EOL resistor across the zone wires at the last device.The maximum zone resistance is 100 ohms for zones 1, 2 and 6 and 300 ohmsfor all other zones (excluding the 2K EOL resistor).

Compstlble 4-Wire Smoke DetectorsYou may use as many 4-tire smoke detectom as can be powered from the panersauxitiary power 1 output without exceeding this outpu~s rating (see thePOWERING THE SYSTEM section for auxiiary POwer ratings)Photoelectric, direct wire I System Sensor 2412 wPhotoelectric w/heat sensor, dhect wire ! System Sensor 2412TH

Ionization, direct wire I System Sensor 1412

ZONES 1 & Z 2-~RE These zones have the added cspabihty of suppoting 2-wire smke detectors.SMO= DETECTORS Each zone provides enough sta~by current (2 MA) to pwer up to sixteen of the

smoke detectors fisted bebw. Each zone provides only enough alarm current (20mA) to power one smoke detedor in the alarmed state. When assigned zonetype 9 or 16, the second entry of an OFF sequewe at a console will interruptpower to these zones to albw detectors to be reset folbwing an alanw.

Compstlble 2-Wire Smoke DetectorsYou may use up to sixteen 2-wire smke detectors on zone 1 and on zone 2 asfound in the table below.

DETECTOR TYPE DEVICE MODEL #Photoelectric w/heat sensor, direct wire System Sensor 2300TPhotoelectric, dir~ wire System Sensor 2400Photoelectric w/heat sensor, direct wire System Sensor 2400THPhotoelectric w/B401 B base System Sensor 2451Photoelestnc w/heat sensor and B401B base System Sensor 2451THIonization, direct wire System Sensor 1400Ionization w/B401 B base System Sensor 1451Photoelectric duct detect. w/DH400 base System Sensor 2451Ionization duct detector w/DH400 base System Sensor 1451DH

NOTE These smoke detedors are Listed for use wth the 5140XM and are the only 2-wiresmoke detedors that may be ussd.

w

-8-

ZONE 6: Ths zone maybe programmed to sewe as a tamper loop for the C-COM c;ibinetALTERNATE TAMPER and for the Ademco AB12 grade A burglary bell box. For Grade A Burglary

FUNCTION installations, field Y17 must be programmed to “l” to enab[e this function and,- zone 6 should be assigned a day/night burglary res~nse (zone type 05). The

panel will initiate a day trouble/night alarm when an open or short circuit isdetected in this zone or when an earth ground fauk caused by tampering with theAB12 burglary bell box is detected. See the BELL CIRCUIT OUTPUTS setion forAB12 bell wiring information.

ZONE 7: This zone may be programmed to sewe as a keyswitch input. See the REMOTEALTERNATE KEYSWITCH section for keyswitch programming, wiring and operating

KEYSWITCH FUNCTION information.

ZONE 8 This zone has the added capatifify of supporting 2-wire latching type glass breakTWO WfRE GLASS detectors. Use detedors which are wmpafible with the ratings fisted below. The

BREAK DETECTORS second ent~ of an OFF sequewe wilf interrupt zone power to allow detedors toreset followiW an alarm.

Compatible Z-wire Glass Break DetectorsStandby Voftage: 5VDC - 14VDCStandby Resistance: Greater than 20k ohms (equivalent resistance ~ofalldetectors in parallel)Alarm Resistance: Less than 1.lk ohms (see note below)Alarm Current 2 MA -10 MAReset Tree: Less than 6 semndsThe IEl 735L series detectors have been tested and found to be compatible?withthese ratings. Up to 50 IEI 735L deteaors, mnnected in parallel, maybe used(the alarm current provided by this zone is sufficient to support operation 0[ onlyone detector in alarmed state). Follow the manufacturers recommendatiot~s onproper detector installation.NOTES:. Detectors which exceed 1.1k ohms in alarm, but maintain a voltage drop in

alarm of less than 3.8 votfs can also W used.. Use of N.O. or N.C. contatis on the same zone may prevent proper glass

break detector operation.

-9-

2-WIRE POLLING LOOP EXPANSION (Zones 9-64)GENERAL

INFORMATION

INTERCOMINTERFERENCE

ADVISORIES

POLLING LOOP SMOKEDETECTORS

The 5140XM provides a built-in 2-wire polling loop interface which allows thenumber of zones to be expanded from the basic 8 zones to UPto ~ zones u.sin9various addressable polfing loop sensors. The panel supewises the ~lhn~ \pwiring for open, short and earth ground faufts. See below for a fist of comptilesensors and for comments regarding reefritions on burglary and fire usage.The potting loop provides power to sensors and serves as a mmmunication pathbetween fhe panel and sensors. Each sensor must be assigned a uniqueaddress ID number (from 9-64) before being connected to the polfing loop. Mostsensors have DIP switches for this purpose. See the DIP SWITCH SETTINGTABLE FOR POLLING LOOP DEVICES for information on how to assign IDnumbers using DIP switches. Care must be taken to assign unique ID numbers toeach sensor in order to allow the panel to supervise and provide unique wnsolesfatus indications for individual sensors.Sensors can be connected to a single run, or groups of sensors may beconnected fo separate wire runs without affefing the pane~s atifity to superviseindividual senmrs. Follow the wiring instmcfions provided with individual sensors(4190WH wiring diagram is provided at the end of this manual). Be sure toobserve sensor polarify when wiring. The maximum allowable wire run lengthbetween the panel and the last sen~r on a given wire wn is as follows:

Pollin Loo Wire Run Lengths

=NOTE: Twisted pair remmmetied for all normal wire runs.IMPORTANT: The maximum comtined polfing loop run is 400V. If usingshielded wire, the maximum is 2000. If longer wire runs are needed, a 4197 LoopExtender Module must be used.

If an intercom system is being used, the ~lhng loop wires must be as far frorn%heintercom wiring as possible (minimum 6). If this spacing cannot be achieved,shielded wire must be used. If this is not done, interference on the intercomsystem might occur. Also note that the maximum total wire length sup~rted is cutin hati when shielded wire is used.

The maximum allowable current draw on the polhng loop is 84mA. Refer to thePOLLING LOOP CURRENT DRAW WORKSHEET (found in the POWERING THESYSTEM section) for current draws of various Wlfing loop devices. If more than64mA is being drawn, use of the 4197 provides another loop with 64mAavdlable.Make certain to include the total current drawn on the pelting loop in the TotalStandby/Alarm Load Worksheet (see POWERING THE SYSTEM section) whenfiguring the total auxihary load on the pane~s power supply.

Can be added to the 2-wire Poling Loop on zones 9 through 84 (as programmedin fields ’03, ’04, ’05, 1’01, 1’02, 1.03, 1’04 and 1.05). These detectors have abuiti-in RPM which is DIP switch programmable. They are wired in parallel to thepelting loop, and do not need auxikay power or a separate reset switch. Thepolfing loop provides power and reset signals to the detectors, as well as alarmand frouble signals from the detectors.4192SD Photoelectric Polling Loop Smoke DetectorDirect wire photoelectric smoke detector wifh built-in RPM which is DIP switchprogrammable.4192SDT Photoelectric Polling Loop Smoke Detector w/HeatDetectorDirect wire photoelectric smoke’ detector with f 35°F (57°C) heat detector, andbuiti-in RPM which is DIP switch programmable.4192CP Ionization Smoke Detector wDireCl wire products of combustion ionization detector with buik.in RPM which isDIP switch programmable.

-1o-

PASSIVE INFRARED Refer to the PIR Installation Instructions for installation hints” as to the bestMOTION DETECTORS mounting Iocation forthese devices.

4278 Quad Element Polling Loop PIR,.- Quad element PIR with built-in RPM which is DIP switch programmabh? and

mnnecfe drectlyto the polhng hop. Includes mirrors for both wide angl~?andcudain/long range applications. NOTE: The built-in auxihary aensorloop ia notsupewieed and should Mt be used.4275 Dual Elament Polling Loop PIRDual element PIRwith built-in RPMwMch is DIP switch programmable. Includesmirrors for both wide angle andcutiaitilong range apphcafions andcan use the1875PA Pet Alley mirror. Built-in selectable pulse count capabitify.

MISCELLANEOUS 4194 Surface Mounted Reed Contact (Wide Gap)POLLING LOOP Wide gap surface mounted reed confacf with buik-in RPM, which is DIP switch

DEVICES programmable.4190WH Two Zone Remote Point ModuleUsed to supewise conventional N.O./N.C. devices via the polling loop, and has atamper supervised cover.Provides one class B (style B) supervised (Ieft)loop for monitoring fire alarm,sprinkler superviso~ and burglary senmrs. NOTE: N.O. fire/sprinkler devfces metbe (style B) supervised using a 4.7k EOLR (model 610;11; purchased sepiiratelyas pati of 41OOEOLR Resistor ~t~. N.O. and N.C. burglary devices may besupewised using either a4.7kor30k EOLR. Note that the second unsupewised(right) loop should not be used. DIP switch programmable zone nutier.

4208 Eight Zone Polling Loop Expansion ModuleUsed to supervise conventional N.O./N.C. devices via the polhng loop. Provides 8class B(style B) supervised Ioopsfor monitoring fire alarm, sprinkler supe!visovand burgla~ sensors.NOTE: The fhst six krops are (style B) supervised using a4.7k EOLR arid canmonitor either N.O. fire alartisprinkler supervisory devices or N.O./N.C. b~jrglarydevices. The last two loops are supervised using a 30k EOLR and can only beused to monitor N.O.W.C. burglary devices.Note that the 4208 must either be mounted inside the 5140XM cabinet <Irin aseparate enclosure which hasatamper supervised cover when used to monitorburglary devices.DIP switch programmable zone numbers. The first two loops can be selected foreither normal or fast response (DIP switch selectable).

4197 Polling Loop Extender ModuleAt present, the4197 is UL Listed for burgla~ appticafions only. Can be used if the2-wire polhng loop must be greater than the recommended length (4000 mm). Byinstalhng a 4197 at the end of the first loop, the polfing loop can be continued. Ifmore than 64mA needs to be drawn from the pelting loop to power RPMs, use ofthe 4197 p,~vides a~fher loop with 64mA available. Connects to the polhrlg loopand must be Wwered from auxifiay power #l output.

-11–

SYSTEM ZONES (Zones 70- 99)GENERAL Aside from the 64 hardwire and polfing loop sensor zones, the 5140XM provides

INFORMATION a number of additional zones which are dedicated to monitoring various aspectsof system behavior. These system zones are listed below. The “system zor “number appears in the console display window when a fault contition associatiwith this zone is detected. The zone types programmed in field 3’10 (for zones70-75) and field ’05 (for zones 95-99) determine the panel’s response to “systemzone” faults.

Zone #70: Bell Output 1: Monitors bell 1 outpu~s supewision status (if enabledat installation time). See the BELL CIRCUIT OUTPUTS section formore information.

Zone #71: Bell Output 2: Monitors bell 2 outpu~s supervision status ct enabledat installation time). See the BELL CIRCUIT OUTPUTS section formore information.

Zone #72: Earth Ground: Monitors the panel’s field wiring to determine if aneatih ground fault exists. Ttis zone’s default type is set to [19] (24hour trouble) to provide a trouble response to earth ground faults.When the panel detects an earth ground fault caused by tamperingwith (i.e.: drilling through) the Ademco AB12 grade A burglary bellbox, it overrides the zone 72 fault response and instead ttiggers azone 6 alarm (if enabled in field 3’1 7).

Zone #73: J2 Input: Monitors the status of Input 1 on the main PCB J2 header.Input 1 can be used to monitor the “Xmit Okay” signal from the7620ULF LORRA. See the TRIGGER OUTPUTS section for moreinformation.

Zone #74 Dialer Line 1: Monitors the supervision status of the main dialeroutput (K enabled at installation time). See the DIALER OUTPUTSsection for more information.

Zone #75: Dialer Line 2: Monitors the supe~ision status of the optional5140DLM back-up dialer module’s output (if installed/enabledinstallation time). See the DIALER OUTPUTS section for rob_,information.

Zone #76: Auxiliary Relay: Assigned to the built-in auxiliary relay for thepurposes of allowing the operation of this relay to be bypassed.Wnce the auxilia~ relay is not supervised, this zone does not monitoranytting and cannot be assigned a zone type.

Zone #77 LORRA Triggers: Assigned to the LORRA triggers on the main PCBJ2 header for the purposes of allowing the operation of thesetriggers to be bypassed. Since the LORRA triggers are notsupervised, this zone does not monitor an~hing and cannot beassigned a zone type.

Zone #95: Keypad Panic: Activated by simultaneous depression of the console~] and [1] keys. See the KEYPAD FUNCTIONS section for moreinformation.

Zone #96: Keypad Panic: Activated by simultaneous depression of the console[#] and [3] keys. See the KEYPAD FUNCTIONS section for moreinformation,

Zone #97: Polling Loop Short: Monitors the polbng loop wiring for short circuitfaults, See the POLLING LOOP section for more information.

Zone #99: Keypad Panic: Activated by simultaneous depression of the console~] and [#] keys. See the KEYPAD FUNCTIONS section for moreinformation.

-12-

III. PERIPHEWL DEVICES

F., GENERALINFORMATION

TWO CONSOLE PORTS

REMOTE CONSOLESThe 5140XM panel interfaces to 5137AD (gray bezel) and 5137ADR (red bezel)alpha custom LCD consoles. These consoles provide visual and audibleindication of system status and allow the user to enter system operatingcommands. These consoles provide the following features:. 2-fine, 32 character(16 characters per hne) alpha numeric LCD display wtich

provides a programmable “Enghsh Language” description for each zone.. 12 key telephone style keypad. The keys are back-~i.. Built-in sounder which provides audible indications of alarm, fire supervisory

and trouble conditions.. Choice of gray or red front bezel.NOTE: Many municipa~ties require that fire system annunciators be red in color,Check wlh the authodfy having jurisdiction before choosing a console color foryour installation.. 90 mA current draw.

The 5140XM provides 2 console interface Pfls. Port 1 uses terminals 11.14 onthe main PCB terminal block and port 2 usee pins 1,4,5,, 7 on the main PCB J4connector as indicated below. The wrt 2 ~wer/data wires are elecfricallv isolatedfrom (i.e. not affected by open, short or earth ground faults on) wrt 1 ~wer/datawires. Note that the 4142TR nine wire cable (1 cable suppfied) is used to m:ikeconnections to the J4 connector.Port 1terminal 11: aux power#l output (to mnaole red wire)terminal 12: ground (to mnsole black wire)terminal 13: data in 1 (to console green wire)terminal 14: data out 1 (to console yellow wire)

Port 2J4/pin 1: ground (to console black wire)J4/pin 4: data in 2 (to mnsole green wire)J4/pin 5: aux power W output (to console red wire)J4/pin 7: data out 2 (to console yellow wire)

When only 1 console will be used in the installation, this console must bemounted on or near the cahnet (see the MOUNTING THE CONSOLES section)and may be wired to either wrt. When more than 1 console will b installed, the“main” console must be mounted on or near the caMnet and must be wired toPod 2. The “suppleme~ary” consoles can be mounted where desired and mustbe wired to Port 1. The “main” console will continue to function even when wiringfaults prevent the “supplemental” consolee from operating properly, Note thatthe panel can detect earth ground faults on Port 1 and 2 wiring but does notsupewise this wiring for open and short circuit faults.

- 1:3-

POWRING AND The 5140XM suppods, independent of auxiliary power considerations, up toWIRING sixteen 5137AD/51 37ADR mnsoles. The 5140XM can supply up to 1 amp of

euxitiaw standby power for consoles, pelting loop devices, motion detectors, 4-wire smke detecfom, etc. (the maximum auxiliary standby bad that mn be drawnis hinted by the capaciy of the backup battery used. A 1 amp load requires a tAH battery. See the POWERING THE SYSTEM section for more informat~).Provided that the maximum permissible standby load is not exceeded, up to 11consoles (at 90mA per wnsole) can be powered from the pane~s auxifiary power1 and auxihary power 2 outputs. Keep this in mind when adding consoles so thatthe pane~s power supply is not overloaded resulting in a battery which does notproperly charge.

If the pane~s maximum permissible standby load is exceeded, then additionalmnsoles an~or other auxilia~ devices can be powered from a separate ULCommercial Listed Wwer supply. The Alarm-Saf model AS/PS5-BFS-l 2-ULCommercial Fire Listed supply can be used to power additional consoles and/orother auxiliaw fire davices. The dia~ram below shows how to make connectionsto the Alarm -Saf power supply. -

R,ure 2. MM -SW POWER SUPPLY CONNE~ON DIAGWM

Supplementary consoles may be wired to a single wire run or individual consolesmay be mnnacfed to separate wire rims. The maximum wire run length from thepanel to a mnsole whwh is homrun back to the panel must not exceed:

CONSOLE WIRE RUN. ------ .“

F

LtNU I nZ

,#,6*1 gaugewn)

If more than one console is wired to a singlerun, then the a~ve maximum lengths mustbe divided by the number of consoles onthe run (i.e. the maximum length would be225 feet if two consoles are wired on a #22

NOTE: The length of all wire runs mmbined must not exceed 2000 feet whenunshielded quad mnducfor cable is used (1000 feet ff shielded cable is used.)

ADDRESSABLE The 5137AD and 5137ADR mnwles are addressable devices. They have a built-CONSOLE DIP SWITCH in DIP switch which is used to select their operating address. Each console used

SETTINGS must be assigned a unique address for proper system operation. Refer 10 thefigure and table below to set this DIP swtch. The panel can be programmed to tellit what sounding options should be used for each console (refer to DEVICEPROGRAMMING in the PROGRAMMING THE SYSTEM section for moreinformation). The pane~s standard factory default enables all console addressesand sets each console for no sounder suppression. You only need to use theDevice Programming Mode at initial installation if you desire to change ‘hesounder options for one or more consoles. -,,

NOTE: Some versions of the 5137AD/5137ADR mnsoles have a sixth DIPswich. Make sure that fhe sixth swtch is in the DOWN psifion.

-14–

CONSOL,E DIP SEmNGS

~

I

NOTE: &me versions of tie5137AD15137ADRmnsole mayhw a 6 psition DIPstiti. Tksixth swimh should b put Intk ~WN ~itti.

ADDRESS “31 “b not use address 31.~ss 31 muses h cmdm owm@ in non-&dres~Uemode (i.e. works like a~. nmdesmtie 5137

–15-

BELL CIRCUIT OUTPUTSGENERAL The 5140XM provides two ball circuit outputs for operating fire and burglary alarm

INFORMATION indicating devices (belll -terminals 3,4andbe112 -terminals 5,6). Each ouloufmay be independently selected for the following features: .,.

.

.

.

.

class B (style Y) supervision (used for fire bell circuits) using a 2K EOL resi~-or(model 610-7, supphed) or m supervision (used for burglary bell circuts).System zone 70 monitors the supewision status of the bell 1 output andsystem zone 71 monitors the supewision status of the bell 2 output. Thepane~s response to fauks on these outputs is determined by the zone typeprogrammed in field 3’10 for the wrrespanding system zone.

NOTE: Cutthewhite~mper Wl (W4)onthe main PCBandprogram zone70(zone 71) for no res~nse to disable supervision for bell 1 (bell 2). No EOLRrequired.

activation by alarm candtions on one, some or all protection zones (fieWs 3’70through 3’61)

short ding for canfirmtion of arming (field’16 for bell 1, 3“57 for ball 2) and forentry/exif or perimeter zone fauks while CHIME mode is active (field 1.47 forbell 1,3’59 for bell 2)

activation in a steady or pulsing manner in response to alarm candfiion (field3’1 5)

2 to 30 minute timeout or no timeout (field’ 13 for bell 1,3’60 for bell 2). Note:burglary bell circuits must be programmed for 16 (or more) minute timeout.

POWR AND WRING Each bell outpuf is rated as follows: 10VDC 14VDC, 2.3 amps max., pwerUmited. Note that the total alarm mrrent drawn from the aux power 1, aux power 2,bell 1 and bell 2 outputs cannot exceed 2.3 amps for battery independentoperation.

By default, bell 1 is set to operate as an unsupewised burglary ball output. Youmay use any UL hsted, non-palafized burg laW indicating device rated for 10-14VDC operation on this output. Note that a local burglary grade A tisting reqt :that a bell in a tamper protected housing be used (such as the Adem A=)and that bell wiring be run in conduit. By defauk, bell 2 is set to operate as asupervised fire bell output. Note that the panel supervises this wiring for open,shod and earth ground fauks. You may use any UL fisted, polarized fire indiiati~device rated for 10-14 VDC operation on this output. Observe polarity whenwiring polarized devices. Some examples of mmpafible devices are given babw.The diaaram shows how to make connections to these outputs.

Exampl;s of Compatible Alarm indicating DevicesBurglary Bells AdemwAB12 (9rade A bel~housing)Fire Bells AdemmWFP8-12 (W bell)

Ademm WFP1O-12 (10” bell)Horns System Sensor PA400R (red piezo horn)

System Sensor MA-1224 (red horn)System Sensor MAfSS-12 (horn and strobe)

Strobes System Sensor SS-12

–16–

~g”re 4. BELL CIRCUIT WIRING(Shows wiring for bell o.tp.t* configured using fadowdefault programming selections)

.m

BELL 1 FACTORY DEFAULTS 3 4 5 6~: ;i~~flg.red .S a b“’gtav

. use non-polarized Gmde Aindcating devices leg Ademco + +-N.. AB12 see below) BELL; BELL 2

. Wiring is not s“pewlsed ...!whhte jumper, W?, on mat. PCB

. Activates for ,.”,s 3.8 .[am.. Steady al.m .utPut. 16 minute timmut

BELL z FACTORY DEFAUL=Bell 2 is con fig”,ed as a fir. bet!.,,.,,,,“,. ”....Us. Wlatized Indicat,”g 12~::LRl

devices. C!ass B oDen/shofl supewisio” (M:=~.24 h, trouble cesPo”* tO f~UltS. Activates for .0”, 1, 2 .l.ms. Pulsed alarm outPut. No timeout

AS32 BELWBOX WIRING

hBt 2 WIRING NO=S. D,sco””mt the ml 2S

fati.v wires .o”.mNo”“al #4 to K

. . . .. Zone 6 should be

Programmti f.r a daytw.blelnight slam (qpeor 24 hour slam (WPe07response

. w,,, Pa”el, s door tamwswitch in series with z..

. AII wiring from AB12 to~o;yt be W. in

,-

AUXILIARY RELAYThe 5140XM provides a built-in “Form C“ relay with contacts rated at 28VACNDC, 2.8 amps max. This relay maybe programmed for one of the funcfbnsbetow (field 3’61):

. Alarm Activation: Steady acfivatin in response to an alarm on one, someor all zones as selected in fie~s 3’70 through 3’81. If field 361 is set to”1”,the auxiliay relay remains asfivated until timeout (which is programmedindependent of the bell 1 and bell 2 timeouts; tieti 3’60) or until the 5eCurifycode + OFF has been entered. If field 3’61 is set to ‘4, the auxihary relayremains activated until the installer or master mde + [#] +67 is entered.

When this functiin is used, the auxiha~ relay Hn be used for elevator recall orventilator shutdown on fire alarms or when wired to the aux power 1 output orto a separate power supply (such as Alarm-Saf model AS/PS5-BFS-l 2-ULsee the REMOTE CONSOLES section), the auxiliary relay can be used toprovide a third (unsupewised) bell output for supplementa~ strobes,sounders, etc. as irrdiiatad in the diagram, below. By defauk, the auxilia~f relayis sef to acfiiafe on zone 1-8 alarms with no timeout (field 3“61 =1 ) as m“~hf Wrequired for a common fire and burglaV alarm strobe itilmtor usage.

When fieM 3’61=1, the auxiliary relay can also be programmed to give a briefativafion for confirmation of arming (field 757) or for errfry/exit or perimeterzone fauks while CHIME me is active (fieti 759).

. Trouble/Supervisory Activation: Steady activation in response to anyzone or system related trouble co~tion or to any fire supervisory condiiin.Remains activated until all fault conditions have been corrected and thesecurity de + OFF has been entered.

. 4-Wire Smoke Detector Reset: Momentary (6 second) activation atsecond entry of OFF sequence wtich interrupts power to 4-wire smokedetectors connected to hard-wired zones (zones 1-8) or to polfing tip zones,allowing the detectors to be reset following an alarm. Power to 4-wire smokedetectors should be wired to the auxitia~ relay and to the auxilia~ power 1output as shown in the diagram bebw.

. Batte~ Savefi When ttis function is selected, the auxiha~ relay will normallybe activated ~.e. N.O. and pole contacts will be connected, N.C. confa~ will beopen) and will de-advate 4 hours after the stafi of an AC power failure. Usingthis feature, noncritical toads (such as supplementary mnsoles) which do noneed to be supported for the full 24 hour baffeV backup period can bedisconnected from the auxitiary outputs, allowing a smaller capacity battery tobe used. The relay re-acfivates within a few seconds after AC power restores.

Rgure 5a. AUXILIARY REMY WIRING

(Shows how to wire A.. Relay for .nsupewisd, poweti

slam output.)

- ALARM

r/778910 11et2

AUX REMY )FACTORY DEFAULTS .. Activates for zones 1-8 ~ : : :

0

alms (steady alm : x zoutput) n 2 ;

. No t,meo”t

NOTES/“ ;

. u.. no.-polatiz~ cAN DWW pOWERFROMWE AUX WR 1i“ticati”g devices OUTPUTORFROMSEPAWTE SUPPLY

. wring is not..pemised

. Do not exceed !he +-raflngs of the SUPPIYu=O. 17au. pwr 1output used, thenc.mtined slamc.ment drawn from,“. pwr 1, a.x pwr 2,bell 7 and bell 2.a..ot ,xce&2.3A mm.

figure 5b. AUXIL1~Y REWY WIRING(Show how to ware.“, relay for 4-wire moke deltior wwer 1=.1)

II

&JEOLR

.- 17 –

DIALER OUTPUTSThe 5140XM provides one Wik-in main dialer output, with vokage and currentsupervision, wtich can be programmed to use either rotary (default) orTouchTone dal formats. The 5140XM also allows for mnneti~n of an optk - ~5140DLM back-up dialer module. This module provides a semnd superv~~dialer output which sewes as a back-up to the main output. The 5140DLMmounts to the main PCB shield and connects to the main PCB J3 connectorusing a ribbon cable (supplied with module) as shown in the SUMMARY OFCONNECTIONS dagram at the e~ of this manual. Note: the earth ground screwon the 5140DLM must be mnnecfed to the earth ground screw (terminal 30) onthe main PCB using 16 AWG wire. For Listed Rre Central Station (UL864~FPA71) apphcatins, use either a LORRA abne, the main dialer with the LORRA, oruse the main dialer with the 5140DLM Backup Dialer.

Connect the main and back-up dialer of used) outputs to telephone mmpanyhnes which provkfe bp start sewice using the RJ31 X cables supplied. DO NOTconnect both outputs to the same telephone company line. Connection totelephone co~any fines w~ch prov@e ground start sewice is not permtied.

System zones 74 and 75 monitor the supervision statua of the main and back-pdialer outputs respectively. The pane~s response to fauks on these outputs isdetermined by the zone type programmed in field 3’10 for the correspondingsystem zone. By defauh, zone 74/main tialer is programmed for 24 hour troubleresponse (type 19) and zone 75back-up dialer is programmed for no res~nse(type 00). The supewision circuits on both dialer outputs will trip a fauti when thetip/ring vo~age falls bebw approx. 25 volts (13 voffs for the main tialer when themain PCB blue jumper is cut; 13 VORSfor the back-up dialer when ~s blue jumperis cut) and when handset current is less than approx. 10 mA. Note: The bluejumper should be cut when the dialer outputs are connected to telephone fineswhich have a telephone company MTU installed.

When only the main daler is enabled ([1,0] in field 3.30), the 5140XM will attemptto route all calls over the main output. When both main and back-up dialers areenabled ([1,1 ] in fie~ 3+30), the 5140XM will attempt to route all calls over ~main output until a faui is detected, at which time if will attempt to use the ba%~output. Line fauhs will resuh in a zone 74-DIALER 1 FAULT or a zone 75-DIALER2 FAULT display. The mmmunicator will makeup to 8 attempts to transmt a repotito one or both telephone numbers, dependrrg upon the repon routing optionprogrammed, After the eighfh attempt, the communicator will hang up and aCOMM FAIL will be displayed at the conwle. The dialer attempts are programmedin field 3’21 (default=8; must be restricted to 3, 4 or 5 attempts if a semndaryphone number is programmed).

The 5140XM will transmit reports in the following order alarms (fire, medice~pank,burgla~), fire supervisories and troubles, remaining types of messages. See theSYSTEM COMMUNICATION section for a description of the variety ofmmmunicafion formats and the types of messages transmitted by the panel andfor the dialer programming defauks.

WARNING: To prevent the risk of shock, disconnect phone lines at telm jackbefore servicing the panel.

IMPORTANTIf the mmmunicator is connected to a telephone line inside a PABX, be sure thePABX has a back-up power supply that can supwrf the PABX for 24 hours. ManyPABXS are not Mwer backed uo and connection to such a PABX will resuk in ammmunicafion iailure if Wwer is lost.

-18-

GENERAL The J2 connedor, located in the upper right hand mrner of the main PCB,INFORMATION provides 1 input (labeled INPUT 1) and seven tr~ger outputs (labeled OIJT 1-

,nOUT 7) that can ~ used to interface to the following:

. Remote mnsole sounder

. UL Listed keyewitch

. 5140LED Indcator Module

. Auxitiary alarm signahW quipment such as the Ademm 7620ULF SubscriberRadio

. Event logging serial printer (via4100SM Module)

. PC computer used to dired wire download the pane~s operating parameters(via 4100SM Module)

The pin assignments for the J2 mnnedor are shown in the diagram bebw. Use a4142TR 9-wire trgger oable (1 supphad) to m~e Connations to this mnnmor,The panel does mt supewiae fie~ wiring mnne~ed to this mnnedor.

The trigger output ratings are listed bebw. Note: all outputs are power limited.outputs 1, 5, 7: LOW: 2K to ground

HGH: 10-14 V~ @ 20 MA maxRemsining Outputs: LOW: IK to ground

HGH 10-14 VDC through 5K

Program fields 3.19 & 3’20 are used to Seled the funtions of INPUT 1 an[~ OUT1-7 as indicated in the dagram below.

Kg”,, 6. J2 PIN ASSIGNM ENS mo F“NCmONS

,2 CON

[

-

L04(

:: E#

-19-

*MOTE CONSOLE An optional Amseco PAL328N piezo sounder can be used for installationsSOUNDER where it is desired to remote the sounds produced by the console’s built-in

OPEWTIONNIRING sounder. The panel will remote all sounds (i.e. alarm, trouble, chime, entry/exi,etc.) produced by the console’s Wilt-in sounder except for the short key cl;,’ :associated with console key depressbn. One app~cation of this feature migh~to produce chime sounds in a tiafion whwh is distant from the pane~s wrrsoles.If used, program fiekf3”20 must be set to “W (facfory default) to enable theremote sounder option, and the PAL328N must bewnnecfed to JZOUT5 aashown in the Remote Console %under diagram.

J2 CONNECTOR

-.

-20–

IWMOTE =YSWITCH An optional UL Listed remote keyswitch ~n be used for remote armin@disarmiWOPE-TIONMIRING of the burglary portion of the system and for remotely silencing alarms. If used,

program fieti “15 mu~ be set to “1- or “2” to select a keyswifch operating mode.,- Zone 7 must be assigned a non-zero response type. Also, fie~ 3’20 must b set

to ‘1” t it is desired to use J20UT 1,5 to o~rate keyswifch ARMED a~ RFADYLEDs (if keyswitch provides LEDs). The keyswitc~s normally open momentaryswitch ad LEDs (it used) must be connected to zone 7 and to J20UT 1,5respectively as shown in the diagram bbw. An optional cbsed circuit tamperswitch (ex. Adem ~. 112) can be wired in series wth zone 7 so that keyswifchoperation will be dbsblad when the swfichplate is remved from the wall.

The 5140XM allows 2 modes of keyswitch operation. When field ’15 is set to ‘1-,the keyswtich operates as follows:With System Disarmed and No Alarms Present:A momentary short across zone 7 will arm the system in the AWAY mode, and ashort held for more than 3 seconds will arm the system in the STAY rode. Asubsequent short will disarm the system. The keyswitch LEDs will indicate thatthe system has armed (see table below). NOTE: FauRed zones must ei~r becomecfed or bypassed before the system will arm.

.,-

With Alarms Present:A momenta~ skrt across zone 7 will silence alarm bell and mnsole sounds, atiwill disarm the system if t was armed. The keyswfich LEDs will provtie a memoryof alarm indication (see table bebw). A subsequent short across zone 7 will clearthe alarm memory indkkation and reset 2-wire smoke am glass break detectors (fused).

When field ’15 is set to “2”, the keyswitch operates as follows A mmenfary shortacross zone 7 will silence slam ball sounds ~.e. turn off Bell 1, Bell 2 and aux relayt programmed for alarms) only ti a fire alarm is present. Outputs remain siltmcaduntil a code + OFF is entered to reset alarms and clear alarm displays. Amomentary short has no effect if there are no fire alarms present. Thb mode isintended to be used where it is desired to provide the fire deparfmenu withkeyswitch silence capsbi~iy wtihout compromising the burglary system’s semrify.

LED indications are defined as follows:GREEN RED MWINGOFF OFF DBARMED & NOT R~DYm OFF DISARMED & R~DYOFF ON STEADY ARMED AWAYOFF SLOW FLASH ARMED STAYOFF RAPID FLASH MM MENRYNOTE: Open/close reporting for keyswitch is enabled in field ’40, and the keyswfichreptis as user O

figure 8. KWSW~CH WIRINGIf “w W5.16 .75,. .1. or .2. for dad kwstich retie

m, field 3.20 to ,,t. to .“*I. ED d“w (KLED“~)

J2 CONNECTOR

–21-

5140LED INDICATOR An optional 5140 LED Indicator Module can be used in municipahties whichMODULE require deticated indicators for communicator fault status. The 5140 LED

provides the folbwing indicators:. AC POWER: ON if AC pwer is present.

OFF if AC pwer is mt present. b’. COMM FAILURE: ON if maximum number of attempts were made (fieti 3.21)

to transmit a message to the central station. Enter security mde + OFFfollowing a successful transmission to turn off.OFF t normal.

. DIALER 1 FAULT ON if the main dialer fine is fauked. Correct problem andthen enter secui~ tie + OFF to turn off.OFF if normal.

. DIALER 2 FAULT ON if the ba~up dialer tine is faulted. Correct problemand then enter security de+ OFF to turn off.OFF if norml.If used, program fieM 3“20 must be set to “2 to enable tMs option, and the5140 LED module must be connected to J20UT 1, 3, 4, 5 as shown in thediaaram below. The 5140LED is desianed to be mounted into a standardSindle aana elacfrbl box. Follow the st~Ds below to install tMs module.

1.

2.

3.

4.

Pull fires from the pane~s J2 mnnector through an opening in the siWlegang box and splice these wires to the module’s flying leads. Solderlesssphces maybe used.Mount the module’s PC board onto one side of the PC bard retainer bratiet(supplied),Slide the pC board retainer bra~et into the box and fasten with screws(supplied).Mount the stainless steel decorative cover (supphed) onto the box.

figure 9.5140 LED INDICATOR MODULE WIRINGIi “%d, St field 3.20 TO ‘2”

J2 CDNNECTOR

414~ CABLE WIRES COLORS

5140KD MODULE

“ ~

1111 AC POWER 8R0wN I

%

DIALER 2 FAULT GREEN

COMM FAILURE OwNGE

DIALER 1 FAULT YELLOW

BLUE

VO ERM 11) RED

+TO :fi:”~R 1 RED

0mRM12) BMGK

BMCK

t

o AC POWER

o COMMFAILURE

o DIALERI FAULT

o D,,,,,,,,”,,

o FUmRE USE

5140LEQ MODULEWIRES COLORS

–22–

AIWXILl,hRY ALARM The J2 connector provides triggers for fire alarm, burgla~/audble pank alarm,SIGNALING silent panic/duress alarm, fire supervisory, trouble and open/close triggers.

EQUIPMENT These triggers may be used to trip auxiha~ alarm signating equipment such as-,

Ademco’s 7620ULF, 7720 and 7920SE Long Range Radios, 346 polarityreversiW re[ayand 445 high hnesecurity transmitter. Note that not all of thesetriggers are available for all setting of field 3’20. Consult the J2 PINASSIGNMENTS AND FUNCTIONS diWram shown eartier.

The open/close trgger is LOW when the burglary system is armed, and HIGHwhen disarmed. The remaining triggers are normally LOW and go HIGH when thecorresponding fault co~~onowurs. The fire, burglary/audible panic atisilenlpanic/duress alarm triggers remain HIGH until the semrfiy code+ OFF is entered.The fire supervisory and trouble triggers remain HIGH until the fault mnditon isremoved and the swrify de + OFF is entered.

The diagrams below show how to make mnnections to the 7620ULF, 7920SE,346 and 445. Consuk the UL INSTALLATION CHECKLIST section for adescription of the spscifc 5140XM trigger connections and programming optionsrequired for each of the various UL Listings.

Wg”re ?0. 76211ULF WIRING DIAGWM

.!, CONNECT.*

7920SE WI RI NG DIAGWM

,2 coN,,.moR

EQU,, 17, ~MRIW RWERSING REUY WIRING

“vOTERM*a

,, CONNECTOR

m

fio”m 12. w, HIGH L(NE SECURIW DIRECT WIRE TWNSMl~ER WIRING

.-.1 . . . . .rrl.. from 0...( !0 7920SE !.I

uu-... ,”,,;, ,.. .,,. .“.,,, ,,, ., -,,,,, =,.”! !.. . . “...“.... . ..”. ”..,........!,., s,. .,,,.,,s., ,s., ..,!. -23-

E~NT LOGGING The 5140XM allows its event log to be printed on a local serial printer. If used,PRINTER program field 3*1 9 must be set to”1”. NOTE: This setting overrides the functions

CONNECTIONS selected for INPUT 1 and OUT 2 made in field 3’20. Connect a UL EDP Listedserial printer to the J2 mnnector using an Ademco 4100SM Intedacs modui~ ~sshown below. Refer to the EVENT LOGGING PROCEDURES section O-,Smanual for a description of the console commands which initiate event logprinting,

NOTE 1: Printer must be configured as follows:.8 data bfis, no pa~y, 1 stop bi.300 or 1200 baud (1200 preferred). Har*are handshaking using DTR signal

NOTE 2: The4100SM module is supphed wih a 10 foot RS232 cable. A longercable or an efiension cable can be used f the 5140XM and serial printer areseparated by more than 10 feet, but the total cable length should be less than 50feet.

NOTE 3: Most printers either ignore the CTS, DSR and CD signals, or requirethem to be high ~.e. 3-15VDC as measured on RS232 DB25 connector pins 5, 8& 8 respedtvely wtih respect to grouti pin 7). The 41 OOSM module sets thesepins Mgh. If the printer being used will not operate with these pins high, then” ctipthe blue (CTS), whfie’ (DSR) or red (CD) jumpers on the 4100SM module to setthe corresponding signal fbating. Important pins on the RS232C cable are pin 3(data out), pin 7 (gmuti) ati pin 20 (DTR - ready).

NOTE 4: The DTR signal, as measured at 41 OOSM TB1, should be high (9.5-14VDC) when the printer is powered, properly connected, on-line and ready toprint, This signal will be low (O-1 .5VDC) when the printer is not powered, notproperly mnnecfed, oft-fine or out of paper. The 5140XM will not send printingdata to the printer unless the DTR signal is high.

NOTE 5: If earth grou~ fauk sensing is enabled:You may get an earth ground fault indcation when the 41 OOSM N ‘eis clipped directly onto a sidewall of the 5140XM cabinet. If this o*,use an insulator to insulate the 4100SM’S clip-on bracket from the5140XM cabinet side wall. Later production versions of the 4100SMhave the chp~n bracket isolated from the circuit ground (terminal 7) andwill not have this problem.

You may alw get an earth ground fault indication if you use a printer (orPC) which has a 3-prorrg, grounded pwer cord. [f this occurs, first verifythat pin 1 (chassis ground) is isolated from pin 7 (signal ground) on the4100SM’S RS232 @nnector (early production versions of the 4100SMhave an unma~ed, 3/8 long, bare wire jumper lying near the pin 1 stieof the RS232 connector which must be cut to isolate these pins). Thenverify that these pins are isolated on your prirrtefs RS232 connector.Follow the instructions provided wfih your printer to isolate these pins ifrequired.

Figure 13. ~E~ LOGGING PRINmR CONNECTIONS,, .*, x, ,.,, s.,,,. .,.

–24-

DIRECT WfRE The 5140XM can be downloaded witbut using a modem or telephone line byDOWNLOADING using 4130PC Downbading Software ati a4100SM Serial Module. Ttis met~d

of downloading is referred to as DIRECT WIRE downloading. Connect a PC whch,- runs the downloading software to the 4100SM module as specified in the

mdule’s inatwcfiona. Connect the 41OOSM to the pane~s J2 headeras shownbelow.

IMPORTANT: The connection between the 5140XM and the41OOSM are different than those shown In the 41OOSM Installationlnatructions. Seediagram below forcorrect connections. Inaddition, when the“green” wire is referred to in step 2 of the IN CASE OF DIFFICULV section of the4100SM Instructions, use the “vlolat” wire.

Note also that the 4100SM violet wire connection for computer terminalsdiffers from that used when conneting a serial printer.Direct wire downloading can be intiated by following the procedures described inthe 4100SM’ instmtion sheet.

mg”re 14. DIREU WIRE WWNLOADING CONNEaONS“m.,,

+..

I /

Nm Em,. m, ,Nw.mmCODE + [q + [51TO INXREmWLOADING BEFORE MKINGrnE AWE cONNE~ONs TOAVOID 7R10aERIN0 A FAULT ONIWn 1.

,,-

-25-

IV. MOUNTING

MOUNTING THECABINET

MOUNTING THECABINET LOCK

ADVISORY

-26–

AND POWERING THE SYSTEM

Mount the cabinet to a sturdy wall using fasteners or anchors (not supp~ed) ir ~clean, dry area w~ch is ~t readily accessible to the general pubtic. The bac~,the cabinet has 4 holes for this pu~se. Installations which are intended toprovide hsted brgla~ sewke have special attack resistance considerations formounting the cabinet which are described below.

Grade A Mercantile Premises Llstlng. The panel door must be supervised, Mount the clip-on tamper switch

(supplied) to the cabine~s rghf side wall as shown in the diagram below andwire it to zone 6.

. Use a bell with a tamper protected housing such as the Ademco AB12. Thebell busing’s tam~r switch and inner tamper linings must also be wired tozone 6.

. Program zone 6 for day trouble/night alarm (type 5, field ‘02)) resWnse andenable the zone 6 akernate tamer function (field 3“1 7).

. All wiring between the ball ati panel must be run in conduit. Remaining wiresdo not need to be run in conduit,

. All wiring which is wt mn in conduit must exit from the knock-out openi~s onthe bottom or back of the cabinet.

. All unused knockouts must be plugged using the disc plugs and carriage hhs,supphed, as indicated in the diagram below

. Fasten the cabinet door to the cabinet backhx using the 16 one inch longphitips heads screws (supptied) after all wiring, programming and checkoutprocedures have been mmpleted

Grade A Mercantile Safe and Vault Listing. Follow the instructions given above for Mercantile Premises fisfirrg, except as

noted below.. Mount a shock sensor such as Sentrol No. 5402 to the pane~s backbox. Fc’’+,v

the manufacfurets instructions on proper sensor mounting. This sensor “._,.,talso be wired to zone 6.

1.

2.

Insert the key into the bck. Position the lock in the hole mating certain thatthe latch will make contact with the latch bracket when the door is closed.

While holdng the Iwk steady, insefl the retainer chp into the retainer slots.Postiin ckp as illustrated in the diagram to facilitate easy remval.

Make certain that the PCB mounting screws are reasonably tight to insure thatthere is a good ground connection between the PC board and the cabinet. Also,dress field wiring away from the microprocessor (center) section of the PC board.The cabinet provides 2 hops on ifs left and right sidewalls for anchoring fieldwiring using tie wraps. These steps are important to minimizing the risk of panelRF interference with television reception.

‘+D KNOCKO~/,,&,,,,,:,,:L:R:F -TO ,,”. A. “.”,,0 KNOCKOUT O, E.ING, R,..., KNOCKO”T AN.,.s,,.,. ,.,. OF 0,s. ,,”.s AND A CA..,.., 80,,.s SHOWN

0,,.,..

,,”. ,.,s .“. AL, REM,.,..

K.ocK.om w,,,,,..” H,., >’ - c’””’’”“o”

n GENERALINFORMATION

:;uRFj\cE MouN~,NG

~.,

MOUNTING THE CONSOLES

As indcated in the REMOTE CONSOLES section, at least one mnsole (i.e.: the‘main” console) must ether be mounted on the ca~net door or mounted on anelectrical box located near (within 3 feet of) the cabinet. Run wires in conduitbetween the electdcal box and the cabinet. Follow the SURFACE MOUNTINGinstructions, below, when mounting this console. Additional supplementalconsoles can be surface or flush munted where desired and do not require theuse of an electr~al hx.

1.

2.

3.

4.

Remove the console’s back cover. The securing screw at the tront of thewnsole must be removed to release the back cover as shown in the dagrambelow.

For Dry Wall: usiW the back cover as a guide, make holes in the d~ wall forthe mnsole mounting screws and interface wiring. Pass the wiring throughthe opening in the back wver, then munt ibis cover to the wall surface.

For Cabinet Door: use a 1/4 drill bit to enlarge the 3 holes on the door.Mount the back cover to the door using 2 holes for console mounting screwsand 1 hole for interface wiring.

For Elecfri~l ~x: using the elecfriml box as a guide, make holes in the backcover for the console mounting screws and interface wiring. Pass theinterface wiring through the opening in the back cover, then mount this roverto the box.

Splice the interface wiring to the console wires. Insulated solderless wiresphces (i.e.:311) maybe used for splicing,

Attach the main body of the @nsole to the mounted back cover. The mnsoleis properly attached when it snaps into place. Use the secuting screw(previously removed) to secure the console to the back cover,

Back ,.,,, ofVISTA Console

that is mounted to the wa!l.

wiring through hole

\ and SPfice to Console wire*.

\ VISTA Cons.,,

IIsecuring ,Cre;

Figure 16. SURFACE MOUNTING CONSOLES

-27-

FLUSH MOUNTING 1.MTH TRIM RING KIT

(5137TRK) ~

3.

4.

5,

Cut out a 4-3/4 high by W wide opening in the wall between studs, no lessthan 1-1/2 from ether stud. Use the template provided to mark the cut-ut.

Insert the four l-1/Z bW #6 screws through the mounting holes in the TrimRing and then attach the four metal securing clips, as shown in the diag~ I.Use only two or three turns of each screw, allowing the metal chps to ~gfreely. The clips must mt protmde beyond the sides of the Trim Ring or youwill Mt be able to install the Trim Ring into the wt-out in the next step.

Install the trim ring into the opening in the wall with the hinge clasps to theright. Mating sure tha trim ring is straght, tighten each clip screw, makiW ~rethat the attached chp sfides down info is guide track.

Install the Console as follows: Engage the hinge clasps on the trim ring withthe notches located in the back (fght-hand side) of the Console’s front panel.Swing the left side of the panel toward the trim ring (the panel will pivot on thehinge clasps), ati press firmly until the panel “snaps” closed.

Use tha panel securing screw (supplied with the Console) to secure the leftside of the panel.

figure 17. FLUSH MOUNTING CONSOLES

ADJUSTING THE Insert the end of the small, key-shaped tool (supplied) into the small hole to theALPHA CONSOLE LCD left of the console tisplay window (the adjustment screw is recessed in this ~le).

WEWNG ANGLE Turn the adjustment screw to the left or right until optimum viewing is achieved.Be sure to take the heiaht of the users into account when maMnrr this

-28–$,,...,..

k-%?

Fg”re t 8. ADJUSTING VIEW ANGLE

,-,

POWERING THE SYSTEMAC POWER The Ademco 1451 transformer with enclosure (supplied) is used to supply AC

power to the 5140XM panel. The 1451 consists of a transformer (with 120VAC/1.0 Amp prima~, 18 VAC/72 VA secondary rating), and a manuallyreseffable circuit breaker munted inside a protective enclosure.

1.

2.

3.

4.

5.

Remove the front cover of the enclosure.

Mount the enclosure to the wall near the 5140XM panel. The enclosure has 4mounting holes on ifs back sutiace for this purpose.

Run 120VAC wiring to the enclosure in conduit. NOTE: A dedicated circuitmust be used. Use wire nuts to splice the 120VAC wires to the transformer’swhite and black primary leads. Connect the eaflh ground post on the back ofthe enclosure to a good earth ground (see EARTH GROUNDCONNECTIONS kbW),

Use wire nuts to splice the transformer blue secondary leads to 16AWG wirewtich is run in conduit to the panel. These wires are connected to panelterminals 1 &2.

NOTE 1: Use wires having insulafiin rated for at least 90°C operation andsuitable for non-pawer fimfied applications.

NOTE 2: Use care to keep 18VAC wiring separated from all other wiring ins tiethe panel’s enclosure. This must be done by running non-power Iimfied18VAC wiring into the panel’s enclosure via one of the knockouts on the lefthand side of the encbsure, and then tie wrapping these wires to the tie wraploops located near the knockout.

Replace the front cover of the enclosure and fasten with the screws supphed.

PANEL EARTH Connect theeaflh ground post irrsidethe 1451 enclosure toagood earth groundGROUND (use grounding methods specified inthe National Electric Code) .Runal6AWG

CONNECTIONS wire from this post to the panel’s earth ground terminal (terminal 30), T~s method

- of connection avoids ground Ioops that mayoccur when the 1451 and panel areconnected to different earth ground systems. NOTE: The panel requires thisconnection in order for ~s lightning transient protection devices and eadh groutisupewision to funcdon properly.

NOTE WHEN CONNECTING BAnER!ES IN PARALLEL

oUSE BA~ERIES FROM THE SAME MANUFACTURER

AND WITH THE SAME VOLTAGE AND CAPACIV MTING.

. USE BA~ERIES W ITH APPROX1 MATELY SAME AGE AND

Hgure 19. BA~ERY CONNECTION DIAGRAM

BA~ERY TABS

.:= ‘1–

kUSE THE 2nd PAIR OF BA~ERY

TABS ANDTHE 2nd PAIR OF+ REO ~AnERy HARNESSE$S”ppL,ED

L-UJ

TO CONNECT ONE OR WO

ADDITIONAL BA~ERIES IN

PAMLLEL

DUAL BA~ERYHARNESS(2 PAIRS SUPPLIED)

MAIN PCB

OBSERVE POMRIN !

& ‘4c*k

,-

-29–

BATTERY As a function of the 5140XM control, battery voltage is montored once every 60SUPERVISION seconds. Under normal Wndifions the battery votiage should be approximately

13.65VDC. If battery voltage drops below approx. 11.5 volts, a low batterymessage is sent to the central station and annunciated on the local mn$eis.Battery lead supervision can be tested from the panel. The recomme}.>procedure is to disconnect the battery harness from the 5140XM at the tabfacations found on the left side of the 5140XM. Within 60 seconds a low batterysignal will be sensed and the control bagina communicating the information to thecentral station.

BACK-UP POWER The panel provides a circuit for float charging a 12 VDC, 12 AH rein/34.4 AH maxCALCULATIONS lead acid (gel cell) back-up battery. The. float charging voltage is set to approx.

13.7 VDC. UL requires that the battery’s capacity be sized to provide 24 hours ofstandby time for fire or for comMnaton fhe/burglary appkcations. This can be*ne as follows:

1.

2.

3.

Rll out the POLLING LOOP CURRENT DRAW WORKSHEET, shown on nexfpage, to determine the total current drawn from the poifing loop (skip this stepif ~lling faop not used).

Hll out the TOTAL STANDBY/AMRM LOAD WORKSHEET, shown on nextpage, to determine the total standby and alarm load drawn from the pane~spwer supply.

Hll out the BATTERY CAPACIW CALCULATION WORKSHEET, sbwn onnext Daae. to determine the reauired caDacffv for the backuo batferv. Selectone of fie batteries given in the BA~ERY SELECTION TABLE, sfiown onthe nefl page.

POWER-UP Connect all zone, polling loop, mnsole, auxifiary device and bell circuit wiring.PROCEDURE Wire and plug-in the 1451 transformer. After a few semnds the console’s green

POWER indicator should tight. If not, check that the 1451 transformer issupplying proper voffage to the panel (about 17-19.5VAC when the power tinevoitaae is 11O-120VAC).Mea~ure the voffage across the “+” and “-” battery teminals on the main PCP ‘ocheck that there is proper float charging voltage (13.5-13.8VDC). If not,\_,2auxiliary power terminals may have been loaded in excess of their ratings.Connect the back-up battery(s) using the batte~ harness supplied as shownbelow. The panel performs a brief teat every 60 seconds to determine if there is abattery connected, and performs an exended test eve~ 24 hours to check thebattery’s condiion, and provides a “SYSTEM LOBA~ indication when it findsthat the batiev vokage is bw (less than approx. 11 .5VDC; see the TESTING THESYSTEM section for mre information). Batteries which are low in vokage maytake up to 46 burs to fully recharge.The consoles will display the installer’s message (default message is“DISARMED-READY TO ARM”) if all zones are intact and there are no systemproblems. If Mt diWlayed, correct zone and system problems as needed.

-30-

POLLING LOOP CURRENT, DRAW WORKSHEETRefer to the POLLING LOOP sedion for device restftibns for fire and bur la usa e.

~--, ” “.- , ,!, 1

4196 Quad PIR

4278 Quad PIR

41W 2-Zone RPM

4190 2-Zona RPM

, .“, ,,” t I

1.OmA,n-. I I I,.” ,,,fi

1 mA (LOW;

2 mA (HfGH)

4208 a-Zone RPM 16 mATOTAL -“”a .x-d MmA.

. The total current cannot exceed 64mA. k total badexcesds64mA,thena4197 loop etiender module can be used.~s module is ~wered from the pane~s auxitiary power and provides a separate ~lting Imp otiput which cansupprt an additional WmA bad. Note that the4197 is Isted for commercial burglary use only and that the totalnumhr of pints mnne~ad to the panel cannot exwed 56.

TOTAL STANDBYIALARM LOAD WORKSHEETS70 Cclculate the total current for the Aux. oower 1. A“x Dower 2. bell 1 & ball 2 OUtDUtS a“d 00 IIIn”

l(~op Cljrrent, multiply the

1) Enter davlces usedon aux. power 1output, calculetestandby and alarmcurrents, then add toget aux. power 1current subtotal.

,-,

each device’s s~andby and/or ‘alarm c~rrent by” the n-umbe~-o-f ~“n~tsr~se~.

AUX. POWER 1 OUTPUT Total CurrentDavice Model # Device Current X # of Units ❑ Standby Alarm

.-

2)

3)

Entar devices usadon aux. power 2output, calculatestandby and alarmcurrents, then add toget aux. power 2current subtotal.

Enier devicescormected to bell 1output, calculatealarm currents, thenadd to get bell 1oulput currentsu13t0tsl.

Aux. Power 1 Output Subtotal(tarminals108 11) 1.OA_ 2.% m

AUX. POWER 2 OUTPUT I Total CurrentDavice Model # I Device Currant X # of Units = Standbyl Alarm

I I I I 1

I I I I

I I I I

Aux. Power 2 Output Subtotal(connetior J4-pin 5) 4~mA mm ~mA ma

BELL 1 OUTPUT Total CurrantDevice Modol # Dovico Current X # of Units ~ Standby Alarm

Xxxxxx

Xxxxxx

~Bell 1 Otipti Subtotal (terminals 3 & 4) 2.3amp max

–31–

4)

5)

6)

7)

8)

9)

Enter devices” BELL 2 OUTPUTconnected to bell 2

Total CurrentDevice Model #

output, calculateDevice Current X # of Units = Standby Alsrm

slsrm currents, then Xxxxxx

add to get bell 2 Xxxxxxoutput currant deubtotsl.

Xxxxxx

XxxxxxXxxxxx

Xxxxxx

Xxxxxx

Bell 2 Output Subtotal (terminals 5 & 6) 2.3amp m= Xxxxxx

Enter the total polling pOLLING Looploop current using

Total CurrentStandby Alarm

values calculated inthe polling loop (E”twwwbh=t mtiinkm smdby&d=m-lumns) P0Lkn9 Loop Subtotal Iworksheet.

Enter the calculatedeubtotals of all listedoutputs then add toget combinedcurrent.

These vslues arefixed.

Enter the calculated

COMBINED AUX. POWER, BELL AND POLLING LOOP Total CurrentStandby Alarm

Aux. Powerl Output Subtotal IAux. Power 2 Output Subtotal

Bell 1 Output Subtotal

Bell 2 Output Subtotal

Polfing Loop Subtotal

Add all subtotals

I (Cannot axceed 1.0 amp m=. standby; 2.3 amp m=. alarm) I I I

~

Includes Z.wire smoke detetior loading on zonas 1 & 2 and ttigger

acuay raws m w enac ve. owever,sin=tiderament, mdsinwmtin dderisinactive when5140DLM inactive, 5l4ODLMimposes only 15mA* wmton mww sumh..,, ,

~TOTAL POWER SUPPLY LOAD I Total Curremcombined currentsthsn edd to total PCB

Standby Alarm

current. Comtined aux. wwer, bell and piling Imp total

Total PCB current

Total power supply load

Using the totsl BATTERY CAPACITY CALCULATION WORKSHEETcalculated powersupply load (step 8),celculate the battsrycapscity required forthe installation.

10) Using the battsrycapacity from step9, sslect theappropriate battery.

(For 24 hour standby followsd by 5 minute fire or 15 minute firehurglary alarm)

Cspacity Formule Calc Value

Standby Capacity totaistandby load X24hours X1.1 mntingancy fader(use total standby Ioad from pravious wo~sheet)

Alarm Capzity total alarm load X O.OWhours (5 minutes)0.29 houm (t5 minutes)

1(use total alarm Ioad from previousworksh’act) ITotal Capacity A6d standby and alarm capacities

BAITERY SELECTION TABLE(The following batteries will fit insida the5140XM catinet)

~

Yuasa NP7-12 mnne&2in arallel

Yuasa NP12-12 conne@2in arallel

Yuasa NP7-12 conneti4in arallel

3.4 AH I Yuasa NPG18-12 (connect 2 in parallel)

-32–

V. SYSTEM OPERATION,.-

GENERALINFORMATION

IINSTALLERS CODE(lISER #1/Authorl@

Level O)

SECURIW ACCESS CODESThe 5140XM system allows up to 99 4-digit security access codes to beprogrammed. When programmed, each code is assigned a user ID number andan authority level, which determines the system functions that code can be usedto perform. There are seven authotity levels as fisted in the table below. Asidefrom the installer, who programs codes at installation time, the system allowsmaster and manager level users to program codes on an as needed basis. Thesecodes are intended for use by those who need limited and/or temporary controlover system operation.

A Quick Arm feature can also be programmed (field ’29) which enables the [#] keyto be pressed instead of entering the security code when arming the burglaVsystem. The security code must still be entered when disarming the system. Notethat open/close reporting of Quick Arm is enabled if User 2 is enabled foropen/close reporting, and that Quick Arm repons as user O.

TABLE OF AUTHORITY LEVELSkvan Itle Enter Armml=rm S!lmm dlChang B Act!vate

Pro ramtMO e

e %urlfy ZO~e~ Test Modes:;f:~ ::PT2 ties

TroubleO-lnsmlbr yes Yp, m y-

d]sam only if L?;?ay E$%~ ~g;;:alku=d b m ititing fue zones if tests,tiredill

installerlevel maw)1-tister m yes yes yes,levels2- ye~,b“~

6Wlyy=, buq.

zow (md walk tes!, tirefire zones if dtill onlymaH&)

2-Maager m yes yes ~;;yls % y=, burg b

Y zmes Mb Uali t$s?

3a per~w A m yes yes m yes, burgla~ mzones mly

4ap eratw B m Y Ves m m m

~peramr G m y;, mdtsam only if

yes m m m

u=d to am%-Duress m yes, sen& yes m m m

s]lent WnicEpon

As shipped from the factory, the installer’s code is pre-programmed to 5-1-4-0and can be changed by the installer to any desired code (field .00).

The installer’s code is intended to be known and used only by the installer and his

aPPointed se~ice representatives. Durin9 intial installation, the installer uses thiscode to program security codes for master, manager and lower level users whowill operate the system on a day to day basis (see procedures following). Theinstaller’s code is the only code that permits entry into programming mode, wherethe system’s operating parameters can be changed. The installer’s code is alsothe only code which permits fire system walk test ati!vafion and can be enabled topermit fire sensor and system zones to be bypassed (field 3.85), The installer’scode can be used to perform all normal system functions except that, for addedsecurity, this code can be used to disarm the burgla~ system only if it was used toarm the system. Note that open/close reporting for the installer is enabled in field.39.

The system also provides an [nstaller Code lock-out feature, which prevents theuse of the Installer’s Code from re-accessing the Programming mode after theinitial programming. This feature is activated by pressing ’98 to exit Programmingmode. The only way to access Programming mode once this feature is activated,is by powering down the system and powering up again, and then pressing bothIhe ‘ and # keys at the same time wifhin 30 seconds of power up. If re-access toProgramming mode using the Installer’s Code is desired after initial programming,then exit Programming mode by pressing “99.

-33-

To ADD a Master,Manager or Operator

cod=

To CHANGE a Master,Manager or Operator

code:

To DELETE a Master,Manager or Operator

code:

To WEW UserAuthori& Level

Enter Installer Code + [8] + new User # + new Usets code(ex. 5140+ [8]+ 02 + 1234)Console will prompt for Authority level. Enter the desired level number from thetable above

Console will then prompt for Open/Close reporting optiont. Press O (NO) or “Y’(YES). The console will display the user ID number and associated authority levelwhen the new code has been successfully entered.

Enter Installer code + [8]+ User number+ new code for that userThe system will detect that the user number is already assigned and will prompt ifthis is a new user. Press O (NO). The system will then confirm that the change isallowed based on authorization level. If the user number is the same as theInstaller’s, the system will prompt for the new code to be reentered. This preventsaccidentally changing a high level code.Enter Installer code + [8] + User number+ Installer codeThe system will prompt if this code should be deleted. Press O (NO) or 1 (YES). [fyes, that users code will be removed and the authority level and all otherinformation about that user will be deleted. Note that a user can only be deletedby a user with a higher a~thority level. A user cannot delete himseM.

TO EXIT THE USER CODE ENTRY MODE, either press [*] or [#], ordon’t press any key for 10 seconds.

Once a user code has been programmed, its associated user ID number andauthority level can be viewed by enteting that user’s code + ~] + ~].

User numbers must be entered as 2-digit entries. Single digit user numbersmust, therefore, always be preceded by a “V (example, 03, 04, 05, etc.). Makesure the end user understands this requirement. Tempora~ codes are enteredas 4-dfgit numbers.

IMPORTANT!: Unless Ademco Contact ID repofiing is used, only user code,#1 #15 can uniquely report to the central station using the communicafionwformats provided. Users #16 - #99 will repofl as User #15, if enabled foropen/close reporting, for the other repoding formats.

IMPORTANT!: During user code ent~, normal key depressions at otherconsoles will be ignored. However, panic key depression will cause an alarm andterminate user entry.

t OP”EN/CLOSE REPORTING NOTE: When adding a user, the SyStem willonly prompt for OpetiClose reprt capabilfiy if the user is being added by theInstaller. When a Master or Manager adds a new user, the new users OpeWCbsere~rfing enable will be the same as that of the Master or Manager adding theuser. If Open/Close reports are required to be selectable by the Master orManager, the Installer should assign two Master or Manager user codes: one withOpen/Close repofling enabled, and one without Open/Close repoting.

–34-

Ml\STERfMANAGER As shipped from the factory, there are no master or manager codes pre-~SODES (Authority programmed. The installer must program at least one master code during initial

Levels 1/2) installation.

Generally speating, the Master Code is intended to be known and used by thebuilding owner. Themanager code isintended to be known andused by thebuilding superintendent, the building security officer or the like. These codesallow full control over burglay system operation. They can be used to programIowerlevel codes on arias needed basis, for use by those who need limitedand/or temporary control over system operation such assupewisors, employees,cleaning personnel, tenants, etc. To add, change or delete user codes, followthe procedure described in the INSTALLER CODE paragraph, substitutingmaster or manager code for the installer code. Note that a master user canprogram codes for a manager or lower level user, and cannot change a masterlevel code. A Manager can program codes foranoperator ortorduress, andcannot change a manager level code.,

Master Codes and all Iower level codes can be used interchangeably whenpeflorming system functions (a system armed with an operator’s code can bedisarmed with the Master Code), with the exception of the Operator C Codedescribed later in this section.

OPEN/CLOSE REPORTING: Note that open/close reporting enables foradded users are the same as that of the master or manager adding the new user.

OPERATOR CODES Operators can arm and disarm the system to the authority assigned, but cannot(Autllority Levels 3-5) addormodify any user. lfOperator C isselected, that operator’s code cannot be

used to disarm the system urrless the system was armed .with that c~de. Thiscode is usually assigned to persons who may have the need to arm and disarmthe system at specific times only.

OPERATOR LEVELS OF AUTHORIWLevel Title Functions Permitted

3 Operator A Arm. Disarm, Bypass4 Operator B Arm, Disarm5 Operator C Arm, Dsarm only if armed with same mde

DURESS CODE The duress code is a means of sending a silent alarm to a central monitoring(liuthority Level 6) station if the user is being torced to disarm (or arm) the system under threat. This

feature is only useful if the system is connected to a central station using the built-in dialer or a LORRA. Duress has its own unique report when digitallycommunicated, but issignaled onthesame trigger that signals silent panic whencommunicated viathe LORRA. When used, thesystem will disarm (or arm), butwill also send asilent alarm tothecentral sfation. There will benoindicafion at theconsole that an alarm was sent.

-35-

, .~

KEYPAD FUNCTIONSGENERAL Note that if QUICK ARM is enabled (field ‘29), the [#] key can be pressed instead

INFORMATION of entering the secutity code, for any of the arming procedures (Away, StanInstant, Maximum, etc.). ,

The keypad allows the user to enter commands to silence/reset alarms, to armand disarm the burgla~ poflion of the system, and to perform other systemfunctions, such as bypassing zones, view messages from the central station anddisplay zone descriptors. Zone andsystem conditions (alarm, fire supewisoy,trouble, bypass) are displayed in the Display Window.

When an alarm occurs, console sounding and external sounding will occur, andthe zone(s) in alarm will be displayed on the console. Pressing any key willsilence the console sounder for 10 seconds. Entering any security code willdisarm the burgla~ system (if it was armed) and will silence both console andexternal sounders. When a fire alarm is silenced, consoles will display themessage FIRE BELLS SILENCED to indicate that a fire alarm condition may stillbe present. Any zones that were in an alarm condition will be displayed (memovof alarm). To clear ths display and to reset 2-wire devices such as glass break andsmoke detectors, simply reenter the security code andpress the OFFkey. Notethat the display will clear only if the zone alarm condition is no longer present.

The consoles also feature ctime annunciation, and 3 panic key pairs (for silent,audible, fire or personal emergency alarms) which can notify the central station ofanalarm condition, ifthat sewice is connected.

ARMING FUNCTIONS The following is a brief list of system commands. For detailed informationconcerning system functions, refer to the User’s Manual.

Disarmed Not Ready Before arming, the system must be in the READYcondition (all zones must be intact). If the “NOT READY message appears, pressthe READY ~] key to display faulted zones.

Arming Away Enter code + AWAY [2].

Arming Stay Enter code + STAY [3]._.

Arming Instant Enter code + INSTANT [7].

Arming Maximum Enter code + MAXIMUM [4].

Disarming Enter code + OFF [1].

Bypassing Zones Enter code + BYPASS [6] + zone number. Toautomatically bypass all faulted zones, use “QuickBypass” method: Enter code + BYPASS+ [#].

Chime Mode Enter code + CHIME [9]. To turn chime mode off, entermde + CHIME again.

.,

-36-

‘VIEWING CAPABILITIESOF A USER

VIEWINGDOWNLOADED

MESSAGES

USING THE BUILT-INUSER’S GUIDE

DISPLAYINGDESCRIPTORS

PANIC KEYS

Enter a security code + [*] + [*] to view the user ID number and the authoritylevel for that code. These items will typically be displayed as follows:

-The user’s OpetiClose repod capability is shown by the dot following theauthority level. If Open/Close is not enabled for a user, the dot will not appear.

Users may occasionally receive messages on the console display from theirinstallation company. Whenthis omurs, theconsole will display ’’Message. PressOfor5secs.”. instruct theuser topress andhold the Okeytodisplay the centralstation’s message. Note that the system must be in the READY state to viewthese messages.

An abbreviated User’s Manual is stored in the system’s memory, and can bepatiicularly useful to the end user if the ptinted User’s Manual is not convenientlyaccessible when the user needs to peflorm a seldom used and unfamiliar systemprocedure. The Built-in User’s Guide is displayed by simply pressing any of thefunction keys (e.g., OFF, AWAY, STAY, MAXIMUM, BYPASS, INSTANT, CODE,TEST, READY, #, and CHIME) for approximately 5 seconds and then releasing it.Abbreviated instructions relative to the key that has been pressed will then bedisplayed (2 lines of text are displayed at a time). This function is available whenthe system is in the armed or the disarmed state.

The Alpha Consoles candisplay allprogrammed descriptors, which is useful tothe installer when checking entties, and can be helpful to the user when there is aneed to identify zones. Todisplay descriptors, press and hold the READY keyuntil the built-in instructions for that key appear, then release the key. The zonedescriptors will appear one at a time, for about 2-3 seconds each. For fasterviewing, press the READY keyto display the next descriptor in numerical orderand soon. When alldescriptors have been display ed, the Control will exit displaymode. Toexitdisplay mode before alldescriptors have been display ed, enter thesecurity code and press the OFF key.

There are three pairs of keys (~ + 1], [# + 3], ~ + #]) that, if programmed, can beused to manually initiate alarms and send a repofl to the central station. Each pairof keys can be individually programmed for24Hour Silent, Audible or Auxiliaw(Emergency) responses. Thepanic function inactivated when theapproptiatepair of keys are pressed at the same time.

The panic functions are identified by the system as follows:

PANIC PAIR Dis~laved as 7one

‘+1 95

#+3 96

“+# 99

These panic keys can also be programmed with an alpha descriptor.

IMPORTANT: For the Panic functions to be of practical value, the system must beconnected to a central station.

—.

-37-

FIRE SUPERVISORY AND TROUBLEGENERAL

INFORMATION

SUPV & “CHECK”MESSAGES

OTHER TROUBLECONDITIONS

POWER FAILURE

The word “SUPWont heconsole’sd isplay accompanied bya rapid beeping,indicatee that afire supewisory condition exists. The word “CHECK on tb””Console’sdisDlav. accompanied bvaraDid “beeDina’’a ttheConsole.i ndicatet-’that there is a tr~uble condfion in tfie system. The a~dible warning sound can besilenced by pressing any key.

. A display of “SUPWaccompaniedbya sensor zone number (l-64) andanalpha descriptor (if programmed) indicates that a fire supervisory conditionexists on that zone which can compromise the operation of the fire alarmsystem. lnstmct theuserto CALL FOR SERVICE immediately.

. Adisplay of''CHECK accompanied byasensor zone number (l-W) andanalpha descriptor (if programmed) indicates that aproblem exists onthat zone,The user should first, determine ifihe zone(s) displayed are intaci and makeihemso iftheyare noi. Theuser should then enter asecurtiy code and pressOFF to clear the display. Instinct the user to CALL FOR SERVICE immediately ifthe display does not clear.

. Adisplay of theword ''CHECK acmmpanied byasystemzone number (7O-99)and an alpha descriptor (if programmed) indicates that a problem exists with thesystem wtich can compromise system operation. Instruct the user to CALLFOR SERVICE immtiately,

. Adisplay of''COMM. FAILURE atthe Console in@caies ihaiafailure occurredin the telephone communication portion of your system. Instruct the user toCALL FOR SERVICE immediately.

. Adisplay of''SYSTEM LO BA7indcates ihaialow batie~@ndtion exisiswiththe system’s backup battery. Instruct the user to CALL FOR SERVICEimmediately.

If the POWER indicator is off, and the message “AC LOSS is dsplayed, thesystem is operating on battery backup power only. Instruct the user to CALL FOR.=SERVICE immediately if AC power cannot be restored.

As shipped, the panel is pre-programmed (field’19) to send an AC loss report tothe central station between 6 and 12 hours after the loss of power. The actualtime of transmission within this interval is random so as not to simultaneously floodthe central station with reports from many panels installed in the area of Wweroutage. (UL requires this setting for field’19 for commercial fire installations.)

–38–

SETTING THE REAL-TIME CLOCKThe panel uses the real-time clock to trigger test report transmissions and totime/date stamp events written into the event log. The clock must be set for thesefeatures to work properly. The clock can be set from fhe console using theprocedure below or via the downloading software.

To enter real-time clock mode, enter installer code + #63. The display willshow:

-The “? indicates the current mode. The [6] key changes the mode from DAY toHOUR to MINUTE to MONTH to DATE to YEAR. The [4] key changes the modein reverse order.

The [3] & [1] keys are used to set the TIME/DATE values. T~e [3] key moves theTIMHDATE ahead, the [1] key moves the TIM HDATE backward.

To Set the day, use the [3] or [1] key to change from ? ON to MON to TUE,etc.

To set the time, press [6] until the “? appears in the hours position, then usethe [3] or [1] key to set the hour. Press [6] again and use the [3] or [1] key to setthe minute. Use the [~ key to set AM or PM.

To set the date, press the [6] key until the “?” appears in the month position,then use the [3] or [1] key to set the month. Press the [6] key again and use the[3] or [1] key to set the date. Press the [6] key again and use the [3] or [1] key toset to set the year.

To exit clock mode, press either the [8] key or the p] key. Exiting wilh the [8]key will save all changes. Exiting with the p] key will exit without changing any ofthe values (used when viewing the time settings, but no changes are desired).

–39–

1

EWNT LOGGING PROCEDURESIMPORTANT: In order for time and date stamping to occur, the system’s real-time clock must be set.Refer to the SETTING THE REAL TIME CLOCK section for details.

GENERAL The system has the atihty to record vafious events in a histo~ log (224 eveniuINFORMATION capacity) wherein each event is recorded in one of five categories (alarm,

supewiso~/check, bypass, open & system), with the time and date of itsoccunence (if real-time clock is set). The log maybe viewed (Display Mode) on thealpha console, or can be ptinted (Ptint Mode) on a sefial ptinter (connected to thesystem via a 41 OOSM Serial Module; see TRIGGER OUTPUTS section forconnection details).

EVENT LOG MODE COMMANDSDisplay Mode: Enter user code + [#]+ [6] + [0]Print Mode: Enter user code + [#]+ [6] + [1]

Clear Event Log: Enter user code + [#] + [6] + [2]To EXIT Event Log Mode: Press [*] at any time.

PROGRAMMING The system can be configured for the following event log activities.

.

.

.

.

To-either record even~s but not print them unless commanded to do so, or toautomatically ptint the events as they occur (field 1’72).

Specific categories of events to be logged can be selectively enabled (field1.70).

The time stamp can be programmed for either 12 or 24 hour formats (field1’71).

The printer baud rate can be set to either 300 or 1200 baud (field 1.73).

Set event log fime/date repoti enable (fields 1-40& 1’41 ).

Enable reDoflino of event Ioa caDacitv (i.e.. 50”/0 full, 907~ full & overflow)programmed in fields 1“40 & 741 ~ -

EWNT LOGGING Afler entering either mode, the following will be displayed:DISPLAY & PRINT

‘oDES ~

The Event Log holds up to 224 events, and can displayptint all events in a catego~ (complete), or only tho~w”events in a catego~ occurflng since the last Clear EventLog command (recent). Note that once the Event Log isfull, the oldest event will be erased upon the logging of anynew event. Press the desired display mode key, O or 1.

For display and printing purWses, events are groupedinto five categories as follows. Use the [3] & [1] keys toscroll to the next or previous category screens

~ ~~~~~ebeenrestored.

Displays time/date for zones that have either caused an

~

Displays time/date for zones that have caused a troubleor fire supewiso~ condition.

~

Displays time/date for zones that have been bypassed.

~Displays time, date and user number for each arming anddisarming of the system.

~

Displays fime/date for system problems, such as ACLoss, communication failure, etc.

~

Displays all categories of events in chronological order,from most recent to oldest.

SCREEN DEFINITIONSRECENT Events since last CLEARCOMPLETE Displavs all eventsWPE Type of event (Burg., fire, etc. ) -,

ccc Zone (contact) numberUuu User number

-40–

To display the events In a particular category, press [8] at the desiredcatego~ screen. If in tisplay Mode, events will appear one at a time from !he mostrecent to the oldest, Press [8] again to display each subsequent event. If in PrintMode, the first press of [8] will cause the printer to print all events in that category,with each event automatically scrolled on the display console. The following is atypical display:

~Shows burgla~ alarm omrred in zone 3, at 12:02AM on January 1,

After the last event in the selected category has been displayed, the following willappear for a few seconds:

~

The system will automatically return to the RECENT/COMPLETE selectionscreen described earker.

CLEAR EVENT LOG To clear the Event Log:

Enter user code + [#] + [6] + [2]The following will appear

~Press [1] if Event Log is to be cleared from memory. All events in the log will stillredisplayed ifthe COMPLETE option isselecfed. Only those even:s occurringfrom the time of the CLEAR command will be displayed if RECENT display optionisselecfed. Press [O]ifevenf logianot to becleared atthisfime.

If [1] ie pressed, the following will appeac

~Press [l]if it isdesired toclear the event log. Press [O] if event Iogisnot to becleared.

-.

–41–

VI.SPLIT/DUALREPORTING

ADEMCO LOW SPEED

SESCOMWDIONICS

4+2 REPORTING

4+2 EXPRESS

SYSTEM COMMUNICATIONDual reporting ~51 ) sends all reports to both primary and seconda~ phonenumbers. Split reporting allows reports to be dwided between the phone numbers-according to the fields (1 ’34) selections. SpliVDual re~rfing can be selected byenabling dual repofiing and enabling one of the spht reporting options in field1“34. If option [1] is selected, all alarms, alarm restores and cancel reports will go toboth phone numbers, while all other reprts will go to the secondary phonenumber only. If [2] is selected, opeticlose and test messages will go to both phonenumbers, while all other reports will go to the primary phone number only,Followin are the S fit/Dual Re orting options:

=ADEMCO LOW SPEED is a pulsed format which responds to a 1400 Hzhandshake and kiss-off, and transmits data wth 1900Hz pulse tones @ 10pulses per second (pps). A typical message consists of Wo rounds which mustbe verified by the receiver. A complete standard report consists of either a 3 or 4-digit account number followed by a 1-digit alarm code. Though 2 rounds are sent,only the valid report is displayed.

In expanded reWrfing, two messages are serif, MO rounds per message, the firslbeing the acwunt number and alarm code, the semnd being the zone ID code towhich the alarm was assigned. A mmplete expanded reporf consists of a 3 or 4-digit account number followed by a l-digit alarm code, then the alarm code isrepeated, followed by the channel number.

EX. Standard: CCCC E where: CCCC = amount numberExpanded: CCCC E E = event code

EEEE Z Z = zone ID code

Standard and expanded reporting in the SESCONRADIONICS format is virtually >,the same as ADEMCO Low Speed except for the following:1. The handshake and Kss-off frequency is 2300 Hz.2. The data is transmitted with 1800 Hz puls+ tones.3. The rate of transmission is 20 pps.

A 4+2 repofl consists of a 4-digit accounf number and a 2-digit alarm code, orevent code. 4+2 repotis can be accomplished either in ADEMCO Low Speed (1Opps), or SESCONRADIONICS (20 pps) format.

In 4+2 reporting a unique 2-digit code for each zone is reported. A 4-digitaccount number followed by a 2-digif code is sent, where the first digit is fheactual event, such as in ALARM, RESTORE, or TROUBLE, etc., and the seconddigit of the code represents the “zone” where the event occurred. (but notnecessarily the actual zone number). Each code in itself is unique to a specificzone. If desired, the actual zone number can be reported by entering thecorresponding 2-digit zone number (ex. zone 1= [0] [1]; zone 63= [6] [3]). AreWrf might appear as:

1 234 5 9 (“5 9 might be a unique “TROUBLE RESTORE, ZONE 25).

ADEMCOS new Express format provides the same information as the 4+2format, but with three differences:

1

2.

3.

The data is transmitted in DTMF, (Dual Tone Multi-Frequencv, known as“TouchTone”, at the rate of 10 characters per second), This ~ y decreasesthe time it takes a report to go through to central station. An a,=;age 4+2 LowSpeed report might take as long as 20 seconds to complefe its report, but4+2 Express takes under 3 sees.

Two message rounds are eliminated by the use of a checksum digit. Insteadof the communicator sending 2 rounds per report, if sends only 1 round witha checksum digit at the end. Doing this also helps in decreasing the time itakes for a repofl to be sent. \

The handshake frequency is 1400 Hz followed by 2300 Hz, and the tissofffrequency is 1400 Hz.

–42–

,ADEMICO HIGH SPEED ADEMCOS Hgh Speed format transmits data in DTMF at a rate of 10 characters perREPORTING second. The handshake frequency is 1400 Hz followed by 2300 Hz, and the

kissoff frequency is 1400 Hz. The message contains 13 dighs as follows: A 4-digff,— account number + eight channels of zone information (1-8 or duress plus 9-15) +

one status channel, which identifies the type of events being repcrfed in the eightzone locations, A typical High Speed re~fl will be Kssed off in under 5 seconds.Channels 1 through 8 could have one of the following conditions:

1 = NEW EVENT2 = OPENING (Status Channel Afways = 2~3 = RESTORE4 = CLOSING (Status Channel Afways = 4~5 = NORMAL, NO EVENT TO REPORT6 = PREVIOUSLY REPORTED, NOT YET RESTORED

“ NOTE: Channel 1 will contain the user ID 1-9, A-F if OpetiClose reporting isenabled.The status channel might have one of the following mndfions:

1 = DURESS (For Duress Plus Channels 9-15 Only)2 = OPENING3 = BYPASS (For Channels 1-8 Only)4 = CLOSING5 = SUPERVISORYflROUBLE (For Channels 1-8 Only)8 = SYSTEM STATUS: . AC LOSS in Channel 1

- LOW BATTERY in Channel 2. PROGRAM TAMPER, BELL 1 TRB,

BELL 2 TRB in Channel 3. POWER ON RESET in Channel 4. DIALER 1 TRB, DIALER 2 TRB in

channel 8. BELL1 , BELL 2, DIALER 1 AND

DIALER 2 BYPASS in channel 7. WALK TEST START, END in channel 8

7 = NORMAL ALARM STATUS (Chnls 1% Only)9 = TEST REPORT

A fypi~l high speed reprf may look as follows:1234511555557 (A@ #1 234 wtih alarms on channels 2 and 3)

LIMITATfONS1. When using Ademco high speed, remember there are only 15 channels

available, plus a duress channel. If more than 15 zones are being used, theywill have to share channels.

2. Wth Ademco High Speed repoting, channels 9-15 cannot report troubles orbypasses. Use these channels for zones that will not report these conditions.

3. Only user numbers 1-15 can be uniquely reported wth open/close reports inAdemco High Speed.

CONTACT ID This is the only format that can identify all M protection zones by their uniqueREPORTING zone (Contact) ID numbers, and provides a 1-digit event qualifier and 3-digit,

specifically defined event code which quickly identifies the condition beingreported.

Contact ID repons in DTMF (Dual Tone Multi-Frequency @ 10 characters persecond) and responds to a 1400 Hz followed by 2300 Hz handshake, and a 1400Hz kissoff. T~s format also uses checksum instead of two message verification, Acomplete report takes under 3 seconds.

Contact ID Regofina takes the format: CCCC Q EEE GG 222 where:Cccc =Q=EEE ——

Yz :

Cus6mer (subscriber) number.Event qualifier, where: E=new event(1) and R= restore (3)Event code (3 hexadecimal digits), defined in the table on thenext page.May be 00 or 01.Zone/contact ID number repoting the alarm (001-099), or usernumber (001 -099) for opeticlose reports. System status messages(AC Loss, Walk Test, etc.) contain zeroes in the 222 location.

-43-

ID EVENT CODESTABLE OF CONTACT~Codel Definition Code[ ‘-’: -’”-- i

97. I ,110 Fire Alarm

111 Smoke Alarm.113 Water Flow Alarm

121 Duress122 Silent Panic

123 Audible Panic

131 Perimeter Burglary

132 Interior Burglay

133 24 Hour Burgla~

134 Enl~/Exit Burglary135 Day/Night Burglary142 Polling Loop Shofl Alarm

150 24 Hour Auxiliary

200 Hre SupemisO~Qol AC LOSS,09 l.ow System Battery

..- , System Reset

’306 Program Tamper

309 Battev Test Fail310 Ground Fault321 Bell 1 Trouble322 Bell 2 Trouble332 Poll Loop Shon-Trouble

351 Main Dater Trouble352 Backup Dialer Trouble

.Ttis re~fl is msmi~ whenever m aim is Awd on a zone progmmmed for fire Alam w~eflfi~tio”.

ADVISORWAdem@,s new ConmdlDm dn is=pableof uni~ely re~fing al164zones ofinbrmatbn, aswell“r i128usem, tom”rdstitions equippedw!t the tia685etier usiysoWaw kw14.50r higher. 685soW%e

Contict ID Epting. For information regting u@ting tie 685 receiver, antiti A&mm<s TWhni~l S“ppoti gro!8W4W-9469 (CA).

Field # I L46 hoose

V=, ,,, ,,, ”,,

Fre Loop Troubler.n,, h!. ,-I”A.1, I

r HrM Supewision 1-

--- , ...&ensor Tamper401 O/C By User403 Power-Up Armed406 Cancel by User407 Remote Arm~sarm (Download)408 Qui& Arm409 Keyswitch O/C411 Cal I back Requested441 P.--d QTAV521 BeIll Bypass522 Bell 2 Bypass524 Auxihaw Relay Bypass551 Main/Backup Dialer Bypass570 Bypass602 Communimtor Test607 Fire and Burgla~ Walk Test621 Event Log Reset622 Event Lq 500A Full623 Event Lq 90% Full624 Event Log Ovedlow625 TmelDate Reset

5140XM COMMUNICATION PROGWMMING GUIDE

i,;,3’40-

.$.,. .

=,!. 1,> ----- !- ? Qa Noetim

bles slam restores Enables slam mstoms,Y. eled Ati cbcksum dlgltIst dgn mables e~n Isl.dglt ~ables EPfl

} selms 4+1 or 4+2 if it is non-zero if [t ISnon-zero~hnes alamlhre En* bs Ems AsstgnsPpomng tinlw~tisoy evmt * br all repoti kom tis

‘-Ie. E“abks alm Rpm

I sdws4+l or4+2 I,... enw

, 1 .“

I Whnes tie ad NOeffed No

,,.nmd.

as o nings and dosi”gs for allPIev s Mow 4.5 mnnot suppon

Jp at 1S~+45 .7492 (NY) or 1-

=

x r- .,

oeea

oe e

na es a am restores

oe eu

enem sm

sdem 4+f or 4+2nesa m event

& I

3e nes

=iedS 4+1 0?4+2

=T=l:t%;t%f, tk2dgit evmt de.NOTE: NOrestoresIfemt wt sent

oeti

-44-

V1l. PROGRAMMING THE SYSTEMGENEWL PROGRAMMING PROCEDURES

GENERAL INFORMATION

lISER-FRIENDLY ZONE.IDEVICE & ALPHA

PROGRAMMING (#93Menu Mode)

,-.

COMMUNICATIONDEFAULT

PROGRAMMING

F)RoG]~MMING STEPS

The system is shipped with a set of pre-programmed values that are designed tomeet the needs of many installations. These can be changed by the installer tosuit specific needs if desired, In addition, four sets of pre-programmedcommunication default values can also be loaded by the installer, each setdesigned for a specific communication format. These too can be changed to suitthe needs of a patiicular installation.

Changes to these pre-programmed values can be programmed directly from theconsole or from an IBM compatible computer terminal either remotely (using aHAYES 1200 SMARTMODEM) or at the job site (using the 41OOSM SerialModule). NOTE: Remote downloading is not a UL Listed feature. Both methodsuse the 4130PC Downloading software (be sure that the software version usedincludes a 5140XM menu selection). See the DOWNLOADING section for moreinformation.

For alpha consoles, Engfish Language descriptions of the zones and a custominstaller message (which appears when the system is ready to arm) can beprogrammed using the built-in vocabulary of words (see #93 MENU MODE,ALPHA PROGRAMMING paragraphs later in this section),

To help set up the syetem quickly and accurately, Ademco has provided atremendous aid to the programming process. Instead of the traditional method ofprogramming all the fields associated with zones, you may now logi~lly program azone for all its characteristics as prompted by fhe 5140XM (refer to the W3 MENUMODE, ZONE PROGRAMMING section for details). This ensures that a zoneresponse type has been assigned to each zone.This user-friendly scheme for programming eliminates the possibility of youforgetting to enter a field properly or simply forgetting it altogether! The systemcan now be programmed the way you approach your installations, by zones!Ttis User Friendly Menu Mode can also be used for programming remte consolecharacteristics, and for entering alpha descriptors.

There are five sets of pre-programmed defaults available (one standard, plus fourdifferent communication defaults). Any one of these can be loaded into thesystem’s memory. Refer to the COMMUNICATION PROGRAMMING section forinstructions.

1.

2.

3.

4.

Enter Programming modeProgramming mode can be entered in one of two ways.1) By depressing fhe ~] and [#] keys at the same time within 30 seconds

after power is applied to the Control.2) By keying the installer code, followed by depression of CODE + O + O

keys. The facto~ installer code can be changed once in the programmode.

Immediately following entry into the program mode, the following will bedisplayed: Program Mode

● Rll # Mew . OoFollowing the above display, the system is ready to be programmed for thecommunication fomat parameters, or accept data entries.Set Standard and/or Communication DefaultsRefer to the PROGRAMMING COMMUNICATION DEFAULTS section forfurther instmct;ons if one of the four communication default programmingsets is used.

Program data fields for system parameterProgram all system programming fields, including phone numbers andaccount numbers, as well as any other programming fields required tocustomize the system to the needs of the installation. Refer to thePROGRAMMING DATA FIELDS section for specific commands andinstructions.

Use #93 Menu Mode for zone programmingRefer to the ZONE PROGRAMMING section to program zone response

types.

—45—

PROG~MMiNG STEPS(cont.)

5. Use #93 Menu Mode for device programmingRefer to the DEVICE PROGRAMMING section to assign console ID numbers,and to selectively suppress certain console soundng.

6. Use #93 Menu Mode for programming alpha descriptorsRefer to the ALPWA PROGRAMMING section to enter zone descriptors and ‘“’a custom installers message.

7. Exit Programming ModeExit programming mode by pressing either ’98 or ’99. A second entry of ●99is required if the exit is being done from fields 1’00 to 1’99, and a ttird entryof .99 is required if exit is being done from fields 700 and abve. To preventre-access to Programming mode using the Installers code, use ’98. The onlyway to re-access Programming mode is by depressing both the ~] and [#]keys at the same time within 30 seconds of power up. Exiting by using ’99always allows reentry into Programming mode using the Installer’s code.Either way of exiting will allow access via downloading.

–46–

GENERALINFORMATION

LOADINGIGOMMUNICATION

DEFAULTS

To help expedite the installation, Ademco has incorporated 4 differentcommunication defauffs in the Control (Low Speed, Ademco Express, AdemcoHigh Speed &Ademco’s new Contacted). These defaults automatically programindust~-standard code assignments for zones, keypad panics, non-alarm andsupervisory conditions, and can be loaded at any time without affecting non-communication program fields. Using these defaults saves programming time!After loading one of the communication defaults, you only need to wire thedevices to their appropriate zones, and program the following:

. Central station phone number(s), fields”33 & ’34

. Subscnbe~s aaunf number(s), fields’32 &*90

. Zonety~ responses, fields ‘02-’05, 1’01-1’05 & 710

.Belll, Be112and Aux Relay assignments, fields Y15, V61,3’70-3’81.

. Delay s, timeouts, ati miscellaneous ~ntrol options.

The system is then operational.

NOTE: Defauff communication wmmands are in second set of programmingfields (fields 1’80, 1’81, 1“82 & 1“83).

Once the Programming mode is entered, clear tha system’s memory by pressing“97. TMsensures allprogram tieldsare settotheir factoVset, pre-programmdvalues. If desired, foadone of thecommunication defauff programming sets byfirst changing to the 1’XX set of fields (press ‘94), then entering one of thefollowing field numbers:

The program fields that are affected by loading one of the communicationdefaufts are fields’45 -’82, 1’40,1.41740-3’42, 3’50-752. Defauk values foreach communication default are listed at the end of this manual. For detailedinformation about reporting formats, see the SYSTEM COMMUNICATIONsection. Affer loading one of the defauff sets, proceed to program the systemdata fields as described in the PROGRAMMING DATA FIELDS section.

EA,SY-TO-PROGRAMCOMMUNICATION

FIELDS

The programming scheme eliminates the need to program zones to channels,and then channels to codes. If programming communication fields manually,simply enter whatever code (3+1, 4+1, 4+2 or Ademco Express) is to be sent foreach zone (including panics, non-alarm males and supervisory codes). NOTE:Enter”1 O to transmit an “W, which appears as “O at the receiver.

All zones are separated into groups of 8, with common rastore, trouble andbypass codes for evey 2 groups (16 zones). There are 2 double-digit entries foreach code. For 3+1, 4+1, 4+2 and Ademo Express, the first entry is the alarmcode for a standard reporf. The second entry is the ID digit for an expanded 3+1or 4+1 re~rt, or for a 4+2 or Ademco Express report. If the second digit is O,only 3+1 or 4+1 (or 4+1 express) non-expanded messages will be sent. If onlythree digits are entered in the account number field, the ID or second dgits areignored, if entered. For Ademco Mgh Speed format, the first digit entry is thechannel assignment for that zone, and the second digit is ignored, if entered.For Contact ID reporting, the first digit entry (any non zero entry) enablesreWrting for that zone, and the second digit is ignored.

NOTE: Restoral reports for an event will not be sent if the event ifse!f is notenabled, even if a restore code is programmed for that event.

.-

—47—

SUMMARY OFDEFAULT

CONSEQUENCES

Low Speed (’94’80)Loading “ttik default doee the following:.

.

.

Selecte low epeed, etandard fo~mat with no checkeum, tor Botn pnonenumbere.Assigns the following report codes:

.-.

03 for zones 3-47,56-61,64Olforzonesl,2& 46-55 (fire zones)02 for zones 62,= (panic trans), & 95,96,99 (keypad panics)09 for all alarm restores

Enables all zone type restores.

ADEMCO Express ~94*81)Loading this default does the following:. Selects Ademco express raporfing format, wilhchecksum, for both phone

numbers.. ReWticodes for sensor zones l-64 andsystem zones 70-99 aresent as their

respective zone lDnumbers (01-99), Duress issentas''DW. Alarm restore is”E+ 2nd digit,

. Enables allzone type restores.

ADEMCO High Speed ~94*82)Loading this default does the following:● Selects Ademco Hioh SDeed format. with no checksum, for both phone-,

numbers.. Repofling is aseigned to the following channels:

Channel 1 for zones 1,2& 48-55 (Rre zones)Channel 2 for zones 3-8Channel 3 for zones 9-16Channel 4 for zones 17-31Channel 5 for zones 32-47Channel 6 for zones 56-61 & WChannel 9 for zones 62 & ~Channel 7 for system zones 70-77&97Channel 8 not used

Channels 10, 11 & 12 for keypad panics 95,96&99 respectively. Enables all zone type restores.. Enables Duress to be sent.

ADEMCO’S Contact ID ~94*83)Loa@ng this default does the following:. Selects Contact ID format for both phone numbers.. Reporting is en2bled for all zones.. Enables all zone type restores,. Refer to the SYSTEM COMMUNICATION section for event code definitions.

.,

–48-

PROGRAMMING DATA The programming fields are grouped into three sets (or “pages”), as representedFIELDS in the diagram below. The fhst set is awessed as soon as programming mde is

entered. To access the other sets of fields ~ndicated on the programming form by,- a”1” or”3 in front of the 2digit field address), press “94. Note that the alpha

wnsoles dsplay the words ALT PROGRAM MODE to indicate the higher set offields. To return-to the previous set of fietis, press “99. When programming datafields, the fields fisted in the table in the ZONE PROGRAMMING section can beskipped, eince they can be programmed using the user-friendly ZONEPROGRAMMING Mew Mode.

Code + [a] + [0] + [0] to~enter programming mode

mw or W8 + EMT

’94J ●:9m

“94$ “:9

m

To program specific data fields, press p] plus the 2-digit field address,

then make the required entry. The console will beep when a field has beenmmpletely programmed and will automatically dtsplay the neti field in sequewe.If the number of digits that you enter in the data field is less than the maximumpermitted (ex. phone number), the console displays the last entry and waits. Toproceed, the next data field to be pr~rammed must be entered manually (ex.press ‘05).

To view the contents of a data field, press [#] plus the 2-digit fieldaddress. The fields entries will be displayed, but no changes can be made.

In case of errors: If an address is improperly entered, the console will &splayFC If a program entry is improperly entered (for example, a larger number thanthat which is permitted), the mnsole display will go blank. In either case, simply re-enter the correct number.

KEY COMMANDS●94 NeX’set of fields“99 Previous set of fields or exit prog ramming mode

#93 Enter ZonelAph~evice Pragrarnming mode●98 Exft Programming mode wth installer lo&.out

—49—

#93 USER FRIENDLY MENU MODEGENEW INFORMATION After programming all system related programming fieUs in the uwal way, pres

W3 to display the first choice of the three menu driven programming funtions,which are: Zone Programming (for programing zone types), Alpha PmgramfiW _(for prqramming alpha descriptors) & Device Programming (for programmingconsole characteristics). Press O (NO) or 1 (YES) in res~nse to the selection.Pressing O will display the next choice in sequence. Refer to the ZONEPROGRAMMING section for instrutilons for programming zone characteristics,the DEVICE PROGRAMMING section for instructions for programming remoteconsoles, and the ALPHA PROGRAMMING section for programming alphadescriptors. The hst of commands used while in the menu mode is shown at theright.

zoNE PROGmMMING The following fields can be programmed by using the ZONE PROGRAMMINGMenu Mode:

1,

2.

3.

4.

ZONE PROGRAMMING FIELDS‘02-’05 Zone response types for zones 1-27, 95-991’01-1.05 I Zone response tvpes for zones 28-M3’10 Zone reswnse typ es for system zones 70-75

Enter Programming mode, then press *3 to display “ZONE PROG?”. Press1 to enter ZONE PROGRAMMING rode,Enter the zone number to be pr~rammed (01-~, 70-75, 95, 96,97 or 99).Press p] to accept entry,

Enter the zone response type for that zone (01 -19). The screen willautomatically dsplay the zone type for the number entered. Press p] toaccept ent~. If a different zone res~nse type is desired, enter a differentnumber and press ~].

The display will repeat with the zone number question for programming theother zones in the system. Enter 00 to exit back to normal programmingmode. -.

W3 MENU MODE KEY COMMANDSm Enters Menu mode

[*] Sewes as ENTER key, Press to have console accept entry.[#] Skips to next screen displav without changing existing entries,o Press to answer NOf Press to answer YES

0149 All entries are 2digit entries00 Ewapes from menu mode. back into field programming mode

DWICEPROGRAMMING

NOTE 1: Console 10 number 00 is permanently enabled and set for no soundersuppression. TMs cannot be changed.

NOTE 2: The panel is factory pre-programmed with all console ID numbers (01-30) enabled and set for no sounder suppression. Use the DEVICEPROGRAMMING mde ‘at initial installation only if it is desired to changethe sounder options for one or more mnsoles

1. Enter Programming mode, then press H3 to display “ZONE PROG?”. PressO (NO) to display “ALPHA PROG?”. Press O again to display “DEVICEPROG?. Press 1 to enter OEVICE PROGRAMMING mode.

2. Enter the 2-digit console ID number as set by its DIP switches (01-30). Pressp] to accept entry.

3.4.

5.

Enter 01 and press ~]. Enter 01 again and press ~].Enter a number 00-03 for the console soundhrg suppression options desiredfor this console as follows:

Enter 00 for no suppression.Enter 01 to suppress artidisann & entry/exit beeps.Enter 02 to suppress chime mode beeps only.Enter 03 to suppress ar~disarm, entry/exit and chime ~de beeps,The screen will display the next console number to be programmed.press 00 to exit Menu Mode.

–50–

IiLPHJi PROGRAMMING Assigning Zone DescriptorsA user friendly Enghsh language descriptiotilocation of all pri:~~ctionzones and

system zones can be programmed into the system. Each description can becom~sed of acombination of words (up to a maximum of 3! that are selectedfrom a vocabulary of approximate~ 220 words stored in memo~, and any wordcanhave an’’s’’ os”addedtoif to if. In addition, upto20installer-defined wordscan be added to those already in merno~. Thus, when an alarm or trouble occursin a zone, an appropriate description for the location of that zone will be dsplayedat the console. An installers message can also be programmed which will bedisplayed when the system is “Ready” (ex. THE PETERSONS).

To program alpha descriptors, enter Programming mode, then press #93 todisplay “ZONE PROG?”. Press O (NO) to display “’ALPHA PROG?”. Press 1 toenter ALPHA PROGRAMMING mode. There are 5 sub-menu selections that willbe displayed one at a time. Press 1 to select the mde desired. Press O.to displaythe next mda available. The alpha sub menu selections are:

ZONE DESCRIP.? for entering zone descriptors.DEFAULTSCREEN? for creating custom message; shows when system ready.CUSTOM WORD? for creating custom words for use in descriptors.PART DESCRIP? Not UsedEX~ EDIT MODE? Press 1 to exit #93 Menu Mode.

Entering Zone Descriptors1. Select ZONE DESCRIP mode.

The console keys perform the following functions:[3] Scrolls both alphabet and actual words in ascending alphabetical order.[1] Scrolls both alphabet and actual words in descending alphabetical order.[2] Adds or remves an “s” or”’s” to a vmablary word.[6] Toggles between alphabet and actual word fist; used to accept entries.[8] Saves the zone description in the system’s memo~.

[#] # plus zone number will dsplay the description for that zone.

2. Key ’01 to begin entering the description for zone 1, (key .02 for zone 2,’03for zone 3 etc.). The following will be displayed:’ ZN 01 A

Note that the first letter of the alphabet appears after Itle zone number, andthat the zone number is automatically included with the description.

3. Select the first letter of the desired description (note that “A” is alreadydisplayed), Use key [3] to advance through the alphabet and key [1] to gobackward. For example, assume the desired description for zone 1 is BACKDOOR. Press key [3] repeatedly (or hold down the key) until “W appears,then press key [6]. to display the first available word beginning with B.Repeatedly press key [3] to advance through the available words until theword BACK is displayed. Press key [1] to move backward through the wordfist.

To add an “s” or”’s”, press the [2] key. The first depression adds an “s”, thesecond depression adds an”’s”, the third depression displays no character(to erase the character), the fourth depression adds an “s’”, etc.To accept the word, press the [6] key, which toggles back to alphabet list.

4. For selection of the next word (DOOR), repeat step 3, but press key [3] untilthe desired first letter of the next word appears on this example, “D). Thenpress key [6] to display the first available word beginning with “W. Press key[3] repeatedly until the desired word (DOOR) appears. To -accept the word,press the [6] key, which again toggles back to alphabet hst.

5. When all desired words have been entered, press key [8] to store thedescription in memory.

6. To review the zone descriptions, key [#] plus zone number (e.g., #01). Toedt zone descriptions, key ~] plus zone number (e.g., ’01)

7. To exit the zone description mode, key 00.NOTE: Alpha descriptor entry can be entered locally at the console or remotelyusing a 4130PC Downloader.

—51—

–52-

Addlng Custom WordsUp to 20 installerdefined words mn be added to the built-in vocabula~. Each of the 20‘words- can sdually mnsist of seversl words, bti bear in mind that a maimum of 10charatiers =n be used for esch word string.1. Seld CUSTOM WORD mode. The keys pefiom the following fundions:

[3] Advanms through alphabet in a=enting order.[1] Advanws through alphabet in dewending order.[6] Selds desired lette~ moves the cursor 1 space right.[4] Moves the cursor one space to the left.[7] Insetts a space at the cursor location, erasing any charader d that location.[8] Saves the new word in the system’s mamo~.[.1 Returns to description entv mode.

4.

5.

6.

7.

6.

9.

10,

11.

Key the number of the cutiom word or word string to h creatd (01 -2o). For example,f you are creating the first word (or word stting), enter 01; when creating the semndword, enter 02, and so on. A cursor will now appear at the beginning of the secondline.

Use the [3] kay to advance through the alphabet (numbers, symbols and specialchara~ers ara includd). Use tha [1] key to move back through tha alphabt.

IMPORTANT Custom words must begin whh m alphabetic charader. If numbers orsymkls are used as the first charatier, the word will not be saved.

When you have reached the desired character, press the [6] key to seled it. Thecursor will then move to the right, in psition for the next charader.

Repeat steps 5 and 6 to create the desirsd word (or words). Note that the [4] key mnbe used to move the cursor to the left h necessa~, and that key ~ can be used toenter a blank (or to eraae an existing character). Each word or word string cafinotex~ed 10 charatiers.

Pre= the [8] key to save the custom word(s) and return to tha’ ED ?? display. Thecustom word (or string of words) will be automatidly added w the buik-in vombulayat the end of the group of wrds beginning wtih the same letter.

Repeat steps 4 through 8 to create up to 19 addhional custom words (or word sttings).

Pre- the ~] key to return to the .ZN ?? display, and follow the zone description entypmcadure to assign the new words to a zone description.

Kev 00 to ext the zone dosctiption programmiw mode.

Creating A Custom Message Display (Installer’s Message) \Normally, when tha system is in the disarmed state, the folbwing display is prasent on thetinsoli.. ..’DISARMEW.’ READY TO ARM

Pan or all of the ahve message can be modified to create a custom installer massage.For example. .’”’DISARMED”” on the first line or READY TO ARM on the samn.c finemuld be replaced by the installation ampany nama or phone number for sewice. Notethat there are only 16 charadar spaces on each of the WO lines. To craate a customdisplay message, proceed as follows:

1.

2.

3.

4.

5.

Sele@ defauk screan mode. Enter 1.

The following will appear

‘“.. DISARMED””.RMY TO ARM

A cursor will be present at the etireme left of the first fine (over the first “star). The[6] key is used to move the cursor to the right and the [4] key to move the cursor tothe left. Key [~ may be used to insefl spaces or erase existing charaaers.

For example, to replace READY TO ARM with the message SERVICE:424-01 77,pro~ed as follows:

Press the [6] key to mova the cursor to the right, and wntinue until the cursor ispsnioned over the nrSt 10CaflOnon the sewnd line.

Press the [3] key to advance through tha alphabet to the first dasired character Onthis case, “S”). Use the [t] key to go bactiard, when nacessa~. Whan the desiradcharatier is reached, press [6]. The cursor will then move to the nati Wsition, readyfor ent~ of the next character On this axample, “E”). When the cursor reaches a~sition over an existing charader, prassing the [3] or [1] key will advance or back upfrom that character in the alphabet. Proceed in this manner until all charaders in themessage have been entered.

To store this new display message in memo~, press the [6] key.

Press the ~] key to return to the “ ZN ?? display. To confirm that the new messagk—.has been stored in memov, press 00 and then press 00 again. The new messageshould be displayed.

Key O to exit the desctiptorfprogramming retie.

.—.

Tr—_,AURM

ALCOVEALLEYAMBUSHANTENNAARwAPARTMI:NTARTA~lCAUDIOAUXAUXILIARY

BABYBACKBARBARNBASEMENTBATH RO12MBEDBEDRCOMBELBELL-IBELL-2BLOWERBOILERBOTTOMBOXBREAKBUILDINGBURNER

CABINETCALLCAMERACARCASECASHCCN

- ::~L~:

CENTRAI.CIRCUITCUP

Voc~

COLDCOATR~MCOLLECTIONCOMBUSTIONCOMPUTERCONTACT

DAUGHTERSDELAYEDDENDESKDETECTORDIALER-1DIALER-2DININGDISCRIMINATORDISPWYDOCKDOORDORMERDOWNDOWNSTAIRSDRAWERDRIVEWAYDRUGDUCT

EARTHEASTELECTRICEMERGENCYENTRYEQUIPMENTEXECU7VEEXITEXTERIOR

FACTORYFAILUREFAMILYFATHERSFENCEFILE

IULARY OF WC~

FLOWF~LFOYERFREEZERFRONTFURFURNACE

GALLERYGARAGEGAsGATEG~SSGROUNDGUESTGUN

HALLHEATHIGHHOLDUPHOUSE

lNF~REDINSIDEINTERIORINTRUSION

JEWELRY

KITCHEN

LAUNDRYLEFTLEVELLISWRYLIGHTLINELIQUORLIVINGLOADINGLOCKL~P

)S STORED IN~

LOWER

WCHINEMAGNETICMIDSWINWSTERMATMEDICALMEDICINEMICROWAVEMONEYMONITORMOTHERSMOTIONMOTORMUD

NORTHNURSERY

OFFICE~LOPENOPENINGOUTSIDEOVERFLOWOVERHEAD

PAINTINGPANICPA~VEPATIOPERIMETERPHONEPHOTOPOINTPUICE

POWER

QUAD

EMORY’

~

RECREATIONREFRIGREFRIGERATIONREUY-IRFRIGHTR~MR~F

SAFESCREENSENSORSERVICESHEDSHOCKSHOPSHORTSHOWSIDESKYUGHTSLIDINGSMOKESONICSONSSOUTHSPRINKERSTAMPSTATION:::~:o

STORAGESTORYSTRESSSTRIKESUMPSUPERVISEDSUPERVISIONSWIMMINGSWITCH

TAMPERTAPETEL@

~

TEMPERATURETHERMOSTATT~LT~NSMl~ERTRAPTRIGGERs

ULTWUPUPPERUPSTAIRSUTILITY

VALVEVAULTVIBRATIONVOLTAGE

WALLWAREHOUSEWASHWESTWINDOWWINEWINGWORK

XMl~ER

YARD

ZONE

o1ST2ND3RD4TH5TH6THTTH8TH9TH

*lNote: “This factoy-provided vocabulay of words is subject to change.

-53–

VIII. DOWNLOADING PRIMER(Remote Downloader is not a UL aDDroved feature)

WNAT isDOWNLOADING?

HOW DOESDOWNLOADING

WORK?

ADWSORIES

Downloading allows the operator t; “remotely access: program, and control thesecurity system over normal telep~ne tines. Anything that can be done direct.-from the keypad can & done remotely, using DOWNLOADING. To Download,the following is required:1.

3.

4.

An IBM PC, or compatible com~ter with MS DOS 3.1 or higher, to run theDOWNLOADING program. MS DOS stands for: Microsoft Disk OperatingSystem.

A HAYES 1200 SMARTMODEM (external: level 1.2 or highe~ internal: level1.1 or Ngher). If these levels cannot be found locally, an external modem canbe purchased from ADEMCO, or contact HAYES for a free update, Ofherbrands are not corrrpatib/e, even if c/airrred to be 700% mrrrpafib/e.

4130PC V-LINK@ DOWNLOADING software, from ADEMCO. This software isavailable in kth 3-1/7 (4130 P3-3) and 5-1/4 diskettes, and includes awmplete Usefs Manual.

At the protected premises, the Control panel must be connected to the existingtelephone line (refer to the PHONE LINE CONNECTIONS section). Noprogramming of the panel is required before downloading to an intial installation.

To download, do the following:

1.

2.

3.

Enter the installer We +~#] + [5]. The panel temporarily enables a ring muntof 5 and sets the Download Callback option to”1 - (callback not required).

Call the panel using the downloader software set to “FIRSTCOMMUNICATION rode.

The downloader will establish a session with no callback. The oanelinformation can then be downloaded.

In order to remotely awess, mntrol, or program the alarm panel, a “lin~ must beestablished between the mmDuter and the control oanel. as follows:

1.

2.

3.

4.

5.

6.

7.

1.

2.

The computer calls up the ‘Control panel. (The’ phorie number for eat’customer is entered into the customers account file on the mmputer). ~.

The Control panel “answers” at the pre-programmed ring count and executesa handshake with the computer.The computer sends a request for call-back to the Control, unless call-back isnot required.

The panel acknowledges the request and hangs up. During the next fewsemnds, the Control will process the request making sure certain encryptedinformation, re~ived from the mmputer, matches its own memory.

UpOn a successful match, the Control panel will seize the phone line and callthe computer back, unless call-back is not required.

The computer answers, usually by the second ring, and executes ahandshake wih the panel.The panel then sends other default information to the mmputer. If thisinformation matches the computer’s information, a successfu I link isestablished. This is known as being “ON-LINS.

Alarm and trouble res~nses ati reports are disabled during on-line time.Should an event occur during this time, the response will take place and thereport will go through as soon as the rem’2 access sequence is camoleted.Alarm and trouble condtions are not ignores, they are simply delayed.The keypads are inactive during downloading communication, and resumenormal functions after hang up. All keypad entries are ignored during on-tinetime.

. .

-54-

WHAT CAN BE DONE . Arm the System in the Away Mode; Disarm the SystemONCE PANEL IS . Bypass a Zone

lION.LINEII? . Force the System to Accept a New Program Download,-, . Shut Down Communication (dialer) Functions (non-payment of monitoring fees

in an owned system). Shut Down all Seedrify System Functions (non-payment for a leased system). InMbit Local Keypad Programming (prevents takeover of your accounts). Leave a message for customer. Command the System to Upload a Copy of ifs Resident Program to the office. Read: Arming Status, AC Power Status, List of Faulted Zones, Lfst of Bypassed

Zones, 224 Event Log, Dst of Zones Currently in Alarm, List of Zones Currentlyin Trouble

. Set the Real-Time clock.

HOW SECURE IS Accessing the Control from a remote location is protected against compromise byDOWNLOADING? the use of 4 levels of protection:

1.

2.

3.

4.

Security Code Ha~dshake: The subscribers account number as well as an 8-digit ID number (known only to the office) must be matched between theControl and computer.Hang-Up and Call-Back: The Control panel will “hang-up” and call thecomputer back at the pre-programmed number only if the security codesmatch.Data Encryption: All data that is exchanged between the computer and Controlis encrypted to reduce the possibility of anyone “tapping” the line andcorrupting data.Operator Access Levels: Up to 15 operators can have accesa to theDOWNLOADER, each having their own log-on code. However, eachoperator can be assigned one of three levels of access in both FILE andCOMMAND functions, as follows:FILE ACCESS:Read Only: able only to look at the database; cannot change any informatkm,and cannot see the customets access codes.Part Read/Write: able to look at and change all information. except thecustomer’s access codes.Full ReadWrite: able to look at and change any and all information in thedatabase.CONTROLICOMM ACCESS:Read Only: able only to Upload and arm the system. Not able to DISARM,BYPASS, or change any information.Parf ReadWrife: able to ARM, BYPASS, UPLOAD, DOWNLOAD but cannotshutdown the system.Full ReaWrite: able to perform all control and status commands, as well asshutdown all or part of the system.

NOTES:1

2.3.

4.

5.

Each time the Control panel is accessed (whether successful orunsuccessful), aPROGRAM TAM PERreport~81) issentto central station, tiprogrammed.When downloading, the console displays “MODEM COMM”.Whenever a download or a save is done, an automatic time stamp is done,indicating the date and time of the last download (or save) and the operator IDnumber.Theaverage time foracomplete download, includng initial call-up, hang-uparid call-back is under 4 minutes.A complete hard copy of each individual account can be obtained byconnecting aprinterto the computer. Refer toyourcomputer owner’s manualor mntact your dealer for printer recommendations.

–55–

IX. TESTING THE SYSTEMBATTERY TEST When AC power is present, the 5140XM will mrr a brief battery test every 60

semnds to determine if there is a battery conneded, and will run an extendedbattery test every 24 hours to check on the battery’s condition. If the 5140XIfitis that the battery vokage is low (less than spprox. 11 .5V) during one of thesetests, it initiates a console ‘System LoBa~ display, a rapid console beepingsound, and it sends a bw battery reprf to the central station of the dialer featureis used). me console ~n be cleared by entering any security @de + OFF, and arestore report will be sent to the central station after a subsequent test indicatesthat the problem (diswnnecfed or low battery) has been wrrecfed.

DIALER TEST The5140XM may be programmed to automatically transmit test re~tisto acentral station at intewals ranging from once par hour to once per 199 hours (field‘27). ULrequires that a test reporfbs transmiffedat least once every 24 hours.The 5140XM can be programmed to send the first re~rf at any time of the day, orat any day of the week after ~wer up (field ’83)

FIRE DRILL TEST This test causes fire bells (or any bell hating a mrr-zero response type in field(-de + [#]+ 69) 3’10) to be activated ~n either steady or pulsing manner as programmed in field

3’15) for the pu~se of mnducfing a fire drill or a bell test. This test can only beactivated by the installer, or a master user by entering the mrrespondng security-e and pressing [#] +69 while the burglav Wrfion of the system is disarmed.Consoles will dsplay “FIRE DRILL ACTIVP while this testis active. The test maybe stopped by entering any security code and pressing OFF. Note that thesystem continues to monitor all 24 hour zones (fire, panic, etc.) while this test isa~lve, and will end the test when an alarm condition is detected. This test shouldbe mnducted at periodic intervals as determined by the local authority havingjurisdiction.

ONE MU FIRE WALK This test causea the system to sound console beeps and bell dings in resWnseTeti (code+ [#] + 68) to fire zone fauks (zone type 9, 16 & 17) for the pu~se of allowing proper zone

operationtobe checked without triggering alarms. Note that the System will n.,,be operational as an alarm system ~.e. cannot sense alarms) while this test is’””active. The test can only be activated by the installer by entering the installer’swde and pressing [#] + 66 while the burgla~ portion of the system is dsarmed.This test shouti be anducted at periodic intewals as determined by the localauthority having jurisdiction.

When this test is first activated, the system will sound fire bells (or any bell hatinga non-zero res~nse type in field 3’1 O) for 3 seconds. The system will also send a“Start of walk tesv message to the central station, and will tight all consoleindicators and display window segments to verify that they are wo~ng properly.The consoles will then display “Fire Walk Test in Progress” and will sound a singlebeep every 15 seconds while this testis active.Fauff and reset each fire alarm sensor in turn. Each action should cause consolesto beep and fire bells (or any bell assigned to the sensor’s zone in fields 3’70-3’61) to ding. The consoles will display the zone number and the associatedalpha descriptor while the zone remains fauffed. The system automatically issuesa smoke detector power reset about 10 seconds after it finds a fauh on one ofthese zones, to allow fauhed detectors to be reset.The 4192CP, 4192SD & 4192SDT polhng loop smoke detectors can also betested by entering [#] + the detector’s 2-digit ID (zone) number at the console. if avalid detector number is entered, the consoles will beep and tire bells will ding.The consoles will display the detector number for a few seconds. An invatiddetector number will be ignored.To end the test, enter any security code and press OFF. An end of walk testmessage will be sent to the central station. Note that the test will automatically endif no fauns are detected within a 30 minute lime period.

–56–

.-

BURGLARY WALK This test causes the system to sound console beeps in response to fauftsonTESY (cde + TEST [5~ burglary and non-fire related 24 hour zones for the purpose of allowing proper

zone operation to be checked without triggering alarms. Note that the system will

,.-, nottrigger alarms for burgla~and non-fire related 24hourzones but will triggerfire alarms while this test is active. TMs test ~n only& activated by the installer, amaster user ormanager user byentering thewrresponding security code andpressing TEST vitile the burglary portion of the system is disarmed. UL requiresthat this test be conducted on a weekly basis.

When this test is first activated, the system will eouti burglary bells (or any &llhaving 00 resWnse t~e in field *1 O),for 3 seconds. The system will send a startof walk test message to the central station. The consoles will display “Burg WalkTest in Progress” and will sound a single beep every 15 seconds while the testremains active.

Open and close each protected door and window in turn. Each action shouldproduce 3 beeps from the mnsole. Walk in front of any motion detectors. Listenfor three beeps when the defector senses movement. The console will displaythe zone number and alpha descriptor while a door or window remains open orwhile a detector remains activated. The system automatically issues a zone 8glass break detector Wwer reset about 10 seconds after it finds a fauti on thiszone, to allow fauhsd detectors to be reset.

To end this test, enter any security code and press OFF. An end of walk testmessage wfil be sent to the central station.

lkRMED BURGLARY IMPORTANT! A message will be sent to the central station during the followingSYSTEM TEST tests. Notify the central station that a test will be in progress.

NOTE: A display of “COMM. FAILURP indicates a failure to mmmunicate (noKissoff by the receiver at the central station after the maximum number oftransmission attempts is tried). If this occurs, verify that the phone line isconnected, the correct report format is programmed, etc.

1. Arm the system and fault one or more zones. Silence alarm sounder(s) eachtime by enteriW the code and pressing OFF. Check that Entry/Exit delayzones provide the assigned delay times.

2. Check the keypad< nitiated alarms, if programmed in field ’05, by pres~ng thePanic keys (. and #, 1 and ‘, andor 3 and #). If the system has beenprogrammed for audible emergency, the console will emit a loud, steady slam]sound. The word ALARM and a descriptor “99 will be displayed for. and #. ~t1 and’ are pressed, a “9Y will k dsplayed; if 3 and # are pressed, a “96” willbe displayed). Silence the alarm by entering the security code and pressingOFF. If the system has been programmed for silent panic, there will be noaudible alarms or displays. A report will be serif to the central stafior:however.

3. Notify the central station that all tests are finished and verify results with them

TUHINING THE SYSTEM 1. Fully explain the operation of the system to the user by going over each of its(3VER TO THE USER functions as well as the Usets Manual supptied.

2. In particular, explain the operation of each zone (entry/exit, perimeter.interior, fire, etc.). Be sure the user understands how to operate am~emergency feature(s) programmed into the system.

IMPORTANT!: In the spaces prwided in the Users Manual, record theEntry and Exit Delay times, and those functions that have been programmedinfo the av~lable pairs of PANIC keys ~ &#, 1 &‘, 3 & #).

3. Make sure the user understands the importance of testing the burglawsystem at least weekly, following the procedure provided in the UsetsManual.

I

8 TO THE INSTALLERRegL!lar maintenance and inspection (at least annually) by the installer and frequent testing by the user are vital tocontinuous satisfactory operation of any alarm system.

n The installer should assume the responsibihfy of developing and offering a regular maintenance program to theuser as well as aquairrfing the user with the proper operation and imitations of the alarm system and itscom~mnenf parts. Recommendations must be included for a specific program of frequent testing (at least weekly)to insure the system’s proper operation at all times.

—57—

X. REGULATORY AGENCY REQUIREMENTSNOTE 1: Set field 3’82 to “O” to disable burglary faatures H

burglary protetiion will not be installed (disablesAWAY, STAY, MAXIMUM, INSTANT, TEST andCHIME key fundions).

NOE2 Thasdb”ns in brackets []pmvide more detailedwiring and pr~ramming instrutiions.

NOK& For fire only or wmtination fire and burglaryinstallations, AC loss reports must retransmittedto the central station batween 6 & 12 hours afterbss of AC pwer (field “19=2), and neither bell 1 orbll 2 should ring an alarm 4 hours after bss of ACpower (fields ’18, 3.58=0). For burglary onlyinstallations, AC loss must be transmitted lessthan 6 hours after loss of power (field “19=0 or 1),and etiher bll 1 or bell 2 should ring an alarm 4hours after bs of pwer (fieti “18 or 3’58=1 ).

UL864/NFPA72A Local Fire. CO flfigUrE at least one ball output for supewisbn and

wire polatized fire alarm indiato~ to it. Program this bellfor pulsed operation when burglary protection will beinstallad [BELL OUTPUTS].

UL864/NFPA71 Central Station. You may use a 7620ULF or 7920SE LORRAS abne, tha

main dialer wkh the LORRA, or the main dialer with tha5140DLM Ba&up Dialer Mdule. Refer to the LORRAInstallation Instrutiions for more detaiiad informatbn.

. When using the LORRA, mnneti its channel inputs tothe 5140XMS Fire Alarm, Fire Supewisory (if installad)and Trouble Triggers. Also connad its XMIT OKAYoutput to the 5140XWS J2/hr put 1 input. ProgramJ31nput 1 zona 73 for a 24 hour trouble response (type19) to radb fauhs (ace TRIGGER OUTPUTS s~ion),

. When the main dialer is usad, enable it (field 3“30) andrnnnea it to a telephone hne. Assign a 24 hour troubleras~rrse (type 19) to zone 74 to enable main dialersupervision (field 3“1 O) (see DIALER OUTPUTSsed”on). The 5140XM will advate the trouble trgger totrip the LORRA If uaad) when tha main dialer is fauhad.

. When the 5140DLM Badup Dialer Modula is used, in~aflh on tha 5140XMS PC board shield. Enable it (fieti 3“30)and rnnned it to a separate telephone fine. Assign a 24hour trouble response (type 19) to zone 75 to anablebackup dialer supervision (field 3.10) (see DIALEROUTPUTS sedtin).

. When a dialer is used, program k to send fire alarm, firssupewisory, trouble, AC loss and mmmunicator testre~rts. Field .27 must be set to “024” (or less) so thattest reports are sent at least once eve~ 24 hours.

. if a sewndary phone number is programmed (field ’34)then tha maximum number of dialer retries (field 3.21)must ba restrided to 3, 4 or 5.

UL609 Grade A Local Mercantile Premises/LocalMercantile Safe and Vault

. Confiiure one bell output for no supawision and wire a“AB12 grade A beilhx to ti. Bell wires must be run inmrrduit. Program ttis bell for steady alarm sounding, 16or more minute timeout, and for tin formation of ar-mingding [BELL OUTPUTS].

. Attach a door tamper- switch (supphed) to the 5140XMback-box. For safe and vault installations. a shocksensor (not’supplied) must also be attachad tO the baA-hx [MOUNTING THE CABINEm.

. Wir~ tha bell bx and 5140XM ~abinet tamper swkchas(and shock sensor, if used) to zone 6. Select the zone 6aiternate tamper furrtiion (field T 17=1) and assign zone6 a day/night response.

. Entry dalays must not exceed 45 sewnds and exitdelays must not ex-ed 60 semnds.

. If 4190WH RPMs are used, set field .24 to “0” to enabl,-tampar detedion. Saa the POLLING LOOP sedion fornotes regarding the usa of RPMs for montioting fire andburglary sensors.

UL 365 Pollee Station Connected Burglar Alarm. Follow the inafruaions for UL 609 local installations

For Grade A Service:. You may use the main dialer alone, the main dialer with

the 5140DLM Back-up dialer module, the 7620ULF (or772o) LORM alone or tha 346 plar~ reversal relay.

. When using the main dialer a[ona, program it to sendburglay alarm, low battery and communicator testrapfis. Held ’27 must be set to ‘024” (or less) so thattest reports are sant at least onca every 24 hours.

. Whan using tha main dialer with the 5140DLM back-updialer mdule, assign a 24 hour trouble response (type19) to zones 74 and 75 (field V1 O) to enable su~wisionfor kth dialers. Proaram tha dialer to send burolawalarm, troubla and I;w battery reports (see DIA”LEROUTPUTS =tion).

. When the 7620ULF (or 772o) LORRA or 346 polarityreversal relay is used, connect it to the 5140XMSburglary/audible panic atarm trigger (see TRIGGEROUTPUTS setion).

For Grade AA Service:. You may use a 7920SE LORRA alone or a 445 high line

security transmittal.

. Conned the 7920SE LORRA or the 445 transmitter toIhe 5140XMS burglary/audible panic alarm trigger (seTRIGGER OUTPUTS sdion).

UL611/UL 1610 Cantral Station Burglar Alarm. Follow the instructions for UL 609 local installations

For Grade A Sawice:

. ~yR~~ use the main dialer with the 7620ULF (or 772o)

. tinned the 7620ULPS inout channels to the 5140xMsburgIary/audible panic alarm and trouble ttiggers. Alsoconnect the 7620ULPS ‘XMIT OK” outgut to the5140XMS J21nput 1 input. Program J2/lnpui 1 zone 73for a 24 hour trouble raspnse (type 19) to radio faults(sac TRI=ER OUWUTS s~tion).

. Enable the main dialer (field 3.30) and conned it to astelaphone line. Assign a 24 hour trouble res~nse (type19) to zone 74 to enable main dialer supewision (field3.1 0). Tha 5140XM will activate the trouble triaaer to ttiothe 7620ULF when the main dialer is fauked (s;; DIALEROUTPUTS section).

. Program the dialer to send burglary alarm, trouble,opening/cbsing and low battery re~tis.

For Grade AA Sawi~:

. Follow the instructions for Grade A installation excaptuse tha 7920SE in place of the 7620ULF.

New York City RequirementsNew York City Fire Department Drohibits commercial

combination {ire/burglary panel;. When using the5140XM for fire prote~ion, burglary prot~tion cannot&implemented. -.

-58-

4190WH OPERATION

Tne4190WH is a2-zone (known as Ieft and tight zones)RPM. The Ieff zone can be used forclosed-circuk davices,and for open-circuti devims, with EOLR supewision. The left

- zone can also be used with fast-response (10 milhs~nd)devices, f necessa~. Follow the chafi at tight for cutting thecomect jumpers and choosing the mrrect resistor when usingthe Iefl zone.

Theti$lht zone is unsupewised andcannotbe usad.

IMPORTANT: The tamper/supervision response of the4190MIH is determined by the zone res~nse ty~ assignadto the! left loop, While the system is disarmed,tamper/supewisory faults will always repofl as troublemessages. While the system is armed, tamper/supewiao~faults !#ill repon as troubles I the left bop is axignad a non-burgla~ response typs fi.e, fire, panic, aux), and will re~das alarms if assigned a burgla~ respnse type.

& WIRING DIAGRAM

wp~~s USAGE (LEFT ZONF ONLYI

RED: Cut for fast-res~nse (1O millisemnd),

WH~: Cut for low current mode. Suitable for sealadred type swtches. May be used for N.O. orN.C. burglay contacts only. Use the 30k EOLRprovided, The 4190WH draws 1 mA from thepolhng Imp in this mode.

BLUE: Leave intati.

NONE CUT High current mode. Suitable for mechanicalswitches. May be used for N,O. the contadswhen model 610-11, 4.7k fire EOLR is usad(purchase 4100E0LR tit), May also b usd forN.O. or N.C. burgla~ wntacts. Use the 4.7kEOLR providd. The 4190WH draws 2 mA fromthe pelting loop in ttis mode.

.-

FOR

0)

Jumper Options).

Egure 20.

-59–

DIP SWITCH TABLES FOR ADDRESSABLE CONSOLES AND POLLING LOOP DNICES

,.-

-.

60-

-..

–61-

(

–62-

“45

.48

.47

.&

.49

.3

COMMUNICATION DEFAULTS for ADEMCO EXPRESS FORMAT (’94’81)PRIMRY FORMAT ❑ timm Express “51 DUALREPORTING ❑ m

LOW SPEED FORMAT (Primav) ❑ .52 STANDARD/EXPANDED REPORT FOR PRIMARY

SE~NDARY FORMAT ❑ timm Ewmss •ammmm-~

LOW SPEED FORWT (*.) mAlarm Rstr Bypass Trbl OPwC!s LW BalHr. s“.” Walk Test

44

—AC LOS ~ m 3.51 Z52

AC %stom ~ mFirst Dgit Xnd Dgit

Commun. Test ~ gWa’kTe’t ‘B” ~ B

POwr UD ~ w~k Te$[ End ~ m

-u u7M9

NOTES: DU= DURES 97= Poll Lmp SM

ZONE TYPE RESTORE ENABLES.D ZONE WPES i~ All em~

p q q ❑4m5m6m m78

3.m ZONE TYPES 1G19 Al mWW

p p7q3m19

–63–

.45

“46

.47

’46

.49

‘s

COMMUNICATION DEFAULTS for ADEMCO HIGH SPEED FORMAT ~94*82)PRIMARY FORWT ❑ AtimHgh ~ .51 DUAL REPORTING ❑ .

LOW SPEED FORMAT (Pnmay) ❑ .- STANDARD/WPANDED REPORT FOR PRIMARY

SECONDARY FORWT ❑ AbmHgh ~ •mmmmms~~-..LoW SPEED FORMAT (~.) ❑ g~~yu~~ BYP.SS Trbl OPWClS ~ykB;&,t

COMMUNICATION DEFAULTS for ADEMCOS CONTACT ID FORMAT ~94*83)PR,IWRY FORWT ❑ ~ titilD .51 DUALRE~mNG ❑ .LCIWSPEEDFORMT (Pnmaw) ❑ .52 STANDARD~PANDED RE~RT FORPRIWRYSECONDARYFOR~T ❑ _WWID •mmmmm~LCIWSPEEDFORWT (*.) w

Alarm mu Bypass Tm ~wCIS LW Batn,. 9.” W.lk T.st

-65–

XI. SPECIFICATIONS5140XM CONTROL

Physlcsl: 18H X 14.5W X 4.3”D

Electrical:

Primary Powec From Adem No. 1451 Transformer with enclosure; rated 18VAC, 72VA

Backup Batte~: 12VDC, 12AH min to M.4AH mex lead acid battery (9el tYPe)

Alarm Powec 12VDC, 2.3 a~s mex

Aux. Standby Power 12VDC, 1 amp mex

Total Powec Cotined auxihary standby and alarm currents must not exceed 2.3 amps

Standby ~me: 24 hours with 1 amp standby load using 34.4AH battery

Fusing: Battery input, auxitiay and bell Wwer outputs are proteded using PTC Grcuit protedors.All outputs are power timited

Main Dialer:

Mne Seize: Double Pole

Ringer Equivalence: 0.76

FCC Registration: AC398U-~192-AL-E

TLM Threshold: Good fine when tip to ring vo~age greater than approx. 25V (13V when blue jumper cut)or when handset current greater than approx. 10mA. Bad line when both vokage andcurrent below these levels.

Formats: Ademco Low Speed, Ademco 4+2 Express, Ademco High Speed, Ademco Contact ID,Sema and Radionics

Agency Listings:Burglary: UL609 Grade A Local Mercantile Pretises am Mer~ntile Safe and Vau~

UL61 l/ULl 610 Grades A, AA Central Station

UL3ti Grades A, AA Pohce Connect

Fire: UL8&-NFPA 72 Local, NFPA71 Central Station

5137AD (Gray Bezel)/5137ADR (Red Bezel) REMOTE CONSOLESPhysical: 4.75H X 6.4W X 1.1“D

Wiring: Red: 12VDC, 90mA input powerBlack: Ground

Green: DataIn

Yellow Data Out

51400LM BACKUP DIALER MODULEPhysical: 2.7YH X 4W X I“D

Mounts on 5140XM main PC bard stield using standoffs supphedMisc.: Connects to 5140XM main PC board J3 header using ribhn cable supphed.

FCC Registration: AC398U-62668-MO-N

See 5140XM Main Dialer hating for remaining specifications

5140 LED ANNUNCIATOR MODULEPhysical: 4.5”H X 2.75”W X 1.YD

Mounts to single gang electrical box

Indicators: AC Power, Comm Failure, Dialer 1 Fauk and Dialer 2 FauM.Connect indicator inputs to 5140XM trigger outputs (J2 header)

-66–

) )

I

wARNING: OWNER’S INSTRUCTION NOTICE NOT TO BE REMOVEOREFER10 INSTRUCTIONSN60!9 FOR ADDITIONALINFORMATION TEST BURGLARY SYSTEM WEEKLY

, T“PESOFFIRE S, GNALLINO $E8VICE:

L

WA HNINU:THIS UNIT MAY BE PROGRAMMED TO

. ..”., 6,, a)$rm,8.!.!”8!. (r, ,)arm,m!l”kle~ s“mfvisory .M ..10! 110. *la!” UL L’s,ti .,.( co”,rol (“o” cticd,.

his oq.ipmenl shouldbe“, .sltica”8c81slalm”vo!ec,tiwe.!ss~““”when“%adw:lk 51400LM back.”, d’aler mtiule ., 7620ULF LORRA.

INCLUOE AN ALARM VERIFICATION !..,.,,,,,.. ,!.,!, “M., IU!rx,cuo.., Iw,l ..,1.! 1!,.

>stalledi,, accordance FEATUflE THAT WILL RESULT IN A DELAYvilhlhe National,flre‘,otecllon Assoclalion’s

OF THE SYSTEM ALARM SIGNAL FROMTHE INOICATED FIRE CIRCUITS. THE

;Iandard 71 and 72ANational F,e Protection

TOTAL OELAY (CONTROL UNIT PLUS

!SSOC.,Batlerymarch Park,SMOKE DETECTORS) SHALL NOT EXCEEO60 SECONDS. tJO OTHER INITIATING

>.incy, MA. 02299). Printed OEVICES SHALL BE CONNEcTEO To?Iormafiondescrlbln9Pr0Pe7 THESE CIRCUITS UNLESS A?PROVFD WY7s!allaU0n,operal! on, THE LOCAL AUTHORITV HAVINGesting,maintenance andepa~rservice is to be,

JURISDICTION.CIRCUIT CONTROLUNIT SMOKEDETECTOR)rov!dedwl!h Itis equtpmont. (ZONE, DE~V-SEC MoDEL DELAY-SEC

@ OPTIONAL 5140DLMHACK-UPDIALER MODULE u

3 MAINPCB SHIELD e

5140XM SUMMARY OF CONNECTIONS

r “FEDERAL, COMMUNICATIONS COMMISSION (FCC) STATEMEN~TMsequipment haskentested to FCCrquiremetis andh~ben foutia~@~leforuse. The FCCrsquires the folbwingstatement for your information:

,-.

IThis equipmentgener:ttesand uses radiofraquen~ energy and f mt installed snd usad proper&, that is, in strict amrdantwith the manufacturer’!s instrutikms, may cause intederem to radio and television reception. ft has &en type tested andfour!d to mmply with the hmits for a ClaS B rnmputing devke in amrdan~ wth the spscficsfions in Pan 15 of FCC Rules,whi(>haredesigned to provide reason~le pmtmtbn against such intetierence ina residential installation. However, there isno<~uarantee that interference will not~urin apafikular installatbn. lfthisaquipment does ~useintetierence tortioortelevision remptbn, which can be determined by turning the aquipment off and on, tha user is emuraged to t~ to mnd theintetierence by one or more of the folbwing measures

. Husingan indoor antenna, haveaqua~ty outdoor antenna i"skll&.

. Reotient therecei!ting antenna until intefierenca isr&ucd orekminated.

. Movethe remiver away fromthe rnntroVrnmmunkator.

. Movethea ntennal eadsawayf mmanywirem nstother nntrol/~mmunb~or.

. Plug thecontrol/a!mmunkator into adtierent outlet sothatti andther~eivar araondtierent branch circuks.If nf!cessa~, the user should mnsult the dealer or an exparienmd radbflelevisbn technician for additional suggestrnns.The user or installer m:iy find the folbwiW tikiet ~~rad by the Fderd @mmunkatbns timmission helpfut

“Intederena HzmdbmKThis hoklet is avail~le from the U.S. &vernment Printing Offia, Washington, DC 2w02.The user shall not make any changes or modifications to the squipment unless authotizd by the Installation InSrudons orUser’s Manual. Unautllorizad changes ormdications muldwidthe uaefsautkfty tooperatethe equipment.

IN THE EVENT OF TELEPHONE OPERATIONAL PROBLEMSIn ttle event of telephone operatbnal problems, disrnnnm the wntrol panel by removing the plug from the W31X (CA38A inCanada) wall jack. Weremmmend that youdemonstrate dmnnding thephones oninstallation of the system. Do notdisconned thephone mnnedion inside the@ntrol Panel. Doing sowillrasutt inthebss ofyourphone lines. fftheragularphone works mrredly after the tintrol Panel has bsen dismnndsd from the phone fines, the bntml Panel has a problemandshould bereturnad for repair. Hu~ndimnntibn of the&ntrol Panel, there isstill aproblemon the line, notify thetelel>hone company th;~tthey have apmblam andrquest ~omptrepairsewim. Theuser maynotunder any circumstances

OnClrOutOfwarrantY):~~emptanyse~~eorr e@imtothesystem. ffmustbs return~tothe factoyoran authorizedsewkeagen~ for all repairs.—

FCC PART S6 NOTICE IThis equipmant mmplies with Pan 66 of the FCC-rules. On the-~mnt rover of ttis equipment is a labl that mntains, amo,’-othelrinformation, the FCCregislration numhrand ringer equtialence numbr(REN) forthis equipment. Krequestad, th.information must be pr{]vidd to the telepbne mmpsny.This equipment usas ttla following jds:

An Wt X is used to mnnti this equipment to the telephone netwo~The REN is usad to determine the quant~ of devbs which may bs mnnsctsd to the talephone tine. Excessive RENs on thetelef)hone line may result in the devims ~t tinging in respn% to an inmming M1l. In most, but not all areas, the sum of thaREhls should not exce[>d five (5.0). To ba mtiain d the numbr of devicss thsf msy ba mnnedsd to the line, as determind bythe total RENs,mntad the tele~ne mmpany m determinethe m~imum RENfor the rolling area.If this equipment causes harm to the telephone netwo~, the telepkne com~ny will not~ you in advance that tempra~diswntinuance of sswice may b rsquirsd. h advanm mtk is not pratiical, the telephone mmpany will notify the cuaomeras s~n as Pssible. Also, you will bs advised of your right to file a mmplaint wfih the FCC i you bsheve n~esay.Thetelephonemmpany may m~e changes in ifs faci~iies, equipmant, operations, orprmdures that muti affd theoperation of theequiprnent. NtMsh~ns, thetelephone mm~nywill provtie advance notkein order foryoutom&e thenecf>see~ modifications in order ti maintain unintemupfad sawti.

Iftroublei sexperiencad wtihtNs ~uipment, please mti@the manufadurer for repair and warranty informatbn. Ifthatroul>le is causing harnl to the telephone nefwoti, the telephone mmpany may request you remove the equipment from thenem!ork until theproblelm isresolvad.There are no user serviceable compnents in this prdua, and all nacessay repairs must be made by the manufatiurer.Othm repair methods may inva~date the FCC rsgistrtikm on this ptiu~.This equipment cannot be US4 on telephone mmpany-provtisd win sewim. Gnnedion to Paw Line Sewke is subjd tostato tariffs.This equipment is heatin~aid mm~tible.Whe!n programming or making test =11s to an amergenv number, briefly explain to the dispatcher the reason for the call.Petiorm such adivities in the off-peak hou% swh as early morni~ or late evening.—

–68-

CANADIAN DEPAR ENT OF COMMUNICATIONS(DO~~ STATEMENT

-.NOTICE

The Canadian Depafiment of Communications label identifies certified equipment. This certification means thatthe equipment meets certain telecommunications network protective, operational and safety requirements. TheDepartment does not guarantee the equipment will operate to the usets satisfaction.

Before installing ttis equipment, users should ensure that it is permissible to be mnnecfed to the facilities of thelocal telecommunications mmpany. The equipment must also be installed using an acceptable method ofmnnetiion. In some cases, the company’s inside wiring associated with a single tine individual sewice may beextended by means of certified connector assembly (telephone extension cord). The customer should be awarethat comptianca with the abve condtions may not prevent degradation of service in some situations.

Repairs to cefiified equipment should be made by an authorized Canadian maintenance facihty designated by thesuppher. Any repairs or alterations made by the user to this equipment, or equipment malfunctions, may give thetelecommunications company cause to request the user to disconnect the equipment.

Users should ensure for their own protection that the electrical ground mnnections of Ihe power ufitity, telephonefines and internal metallic water pipe system, if present, are connected together. This precaution may beparticularly im~rtant in wral areas.

Caution: User should not attempt to make such mnnecfions themselves, but should contact the appropriateelectric inspection authority, or electrician, as appropriate.

The I oad ~ (LN) assigned to each terminal device denotes the percentage of the total load to beconnected to a telephone loop which is used by the device, to prevent overloading. The termination on a loopmay consist of any combination of detices su~ect only to the requirement that the total of the Load Numbers of alIthe devices does not exceed 100.

AVISL6tiquefte du minist~re des Communications du Canada idenfifie Ie mat~nel homologu~. Gene 6tiqueffe cerfifieque Ie mat6rieI est conforme A ceflaines normes de protection, dexploitation et de s6curit6 des r~seaux de

. ~teldcommunications. Le minist$re n’assure toutefois pas que Ie mat~riel fonctionnera ~ la satisfaction de~ufihsateur.

Avant tinstaller ce mat6rfel, ~utiisateur doit s’assurer qu’il est permis de Ie raccorder aux installations de~entreprise locale de t616communicafions. Le mat6riel doit 6galement Stre instal16 en suivant une m6thod eaccept6e de raccordement. Dans cerfains cas, Ies fils int~neurs de ~entreprise utihsbs ~ur un service individual Ala hgne unique peuvent ~tre prolongbs au moyen dun dispositif homologu6 de raccordement (cordo nprolongateur t616phonique interne). Uabonn6 ne doit pas oubher qu’il est possible que la con formit6 auxconditions 6nonc6es ci-dessus nsemp&chet pas la degradation du service clans cerfaines situationsActuellement, Ies entreprises de t616communications ne permettent pas que ~on racmrde Ieur mat6riel auxprises ffabnn6s, sauf clans Ies cas precis pr6vus par Ies tarifs particukers de ces entreprfses.

Les reparations du mat6rfel homologu+ doivent 6tre effectu6es pas un centre dentrefien canaden autoris6d6sign6 par Ie fournisseur. La compagnie de t~l~communications peut demander h ~utitisateur de d~brancher unappareil ~ la suite de reparations ou de rnodficafions effectu~es par ~ufitisateur ou ~ cause de mauvaisfonctionnement.

Pour sa propre protection”, I’ufihsateur doit s’assurer que tous Ies fils de miss en terre de la source d6nergie41ectrique, des ignes t+lephoniques de r6sew~ de conduites deau s’il y en a, soient raccord6s ensemble. Ceffeprecaution est paticufi~rement impoflante clansIes r6gions rurales.

Averfissement: Uutifisateur ne doit pas tenter de faire ces rac~rdements lui-m6me; il doit avoir recours ~ unservice ~nspecfion des installations +Iecfnques, ou A un 61ecfriden, sebn Ie cas.

mce de - (IC) assign6 A chaque disposifif terminal pour ~viter toute surcharge indique Ie pourcentage dela charge totale qui peut 6tre raccord4 ~ un circuit t616phonique bouc16ufi~s~ par ce disposifif. La terminaison ducircuit bouc16 peut 6tre constitute de n’importe quelle combinaison de dispositifs, pourvu que la somme desindices de charge de ~ensemble des disposififs ne d6passe pas 100.

,-

-69–

WARNING!THE LIMITATIONS OF THIS ALARM SYSTEM

VMle this System is an advanced design security system, if does not offer guaranteed protection against burglary,re or other emergency, Any alarm system, whether commercial or residential, is subject to comprotiss or failu-) warn for a variety of reasom. For example:

1

intruders may gain access through unprotected openings or have the technical sophistication to bypass anslam sensor or dsmnnacf an slam warning @vice.

Intrusion detectors (e.g., pas~ve infrared detectors), smoke detectors, and mny other sensing devices will notwork without power. Battery-operated devices will not wok without batteries, with dead batteries, or if thebatteries are not put in pro~dy. Devices ~wered solely by AC will not wok if their AC power supply is cut offfor any reason, however briefly.

Signals serif by tireless transmitters maybe b~ad or reflected by metal before they reach the alarm receiver.Even if the signal path has been recently checked during a weekly test, blockage can occur if a metal object ismoved info the path.

A user may not be able to reach a panic or emergewy button quick~ enough.

While smoke detectors have played a key role in rsduting residential fire deaths in the United States, they maynot activate or provide eafly warning for a variety of reasons in as many as 35Y. of all fires, amrding to datapubhshed by the Federal Emergency Management Agency. Some of the reasons smoke detectors used inmnjuncfion Wth this System may mt work are as folbws. Smoke detectors may have been improperly installedand positioned. Smoke detectors may not sense fhes that stad where smoke canmt reach the detectors, suchas in chimneys, in walls, or roofs, or on the other side of closed doors. Smoke detedors also may not sense afire on another level of a residence or building. A second floor detector, for example, may not sense a first flooror basement fire. Finally, smke detectors have sensing imitations. No smoke detector can sense every fdndof fire every time. In general, detectors may not always warn about fires caused by carelessness and safetyhazards hke smoking in bed, Wolent explosions, escaping gas, improper storage of flammable materials,overloaded electrical circuits, children playing with matches, or arson. Depending on the nature of the fireandor location of the smoke detectors, the detector, even if it operates as anticipated, may not providesuffiaent warning to allow all apants to escape in time to prevent injury or death.Passive Infrared Motion Detectors can only detect intrusion within the designed ranges as @agrammed in th=:installation manual. Passive Infrared Detectors do not provide volumetric area protection. They do creai<muffiple beame of protection, and intmsion can only be detected in unobstructed areas covered by thebeams. They cannot detect motion or intrusion that takes place behind walls, ceifings, floors, closed doo~glass partitions, glass doors, or windows. Mechanical tampering, masking, painting or spraying of any materialon the mirrors, windows or any part of the optical system can reduce their detection abihty. Passive InfraredDetectors sense changes in temperature; however, as the ambient temperature of the protected areaapproaches the temperature ran9e of gOOto 105°F (32° to 40°C), the detection psrfomance can decrease.Alarm warning devices such as sirens, bells or horns may not alert people or wake up sleepers if they arelocated on the other side of closed or partly open doors. If wami~ devices are hated on a tifferent level ofthe residence fmm the bedrooms, then they are less hkely to waken or alert people inside the bedrooms. Evenpersons who are awake may not hear the warning if the alarm is muffled by noise from a stereo, radio, airconditioner or other apphame, or by passing trafic. finally, alarm warning devices, however loud, may not warnhearing-impaired paoDle.Telephone-fines needed to transmit alarm signals from a premises to a central monitoring station maybe out ofservice or temporarily out of service. Telephone tines are also subject to mmpromise by sophisticatedintruders.Even if the system responds to the emergency as intetied, however, occupants may have insuffiaent time toprotect themselves from the emergency situation. In the case of a monitored alarm system, authorities may notrespond appropriately.This equipment, kke other electrical devices, is subject to component failure. Even though this equipment isdesigned to last as bng as 20 years, the electronic components could fail at any time.

he most common cause of an alarm system not functioning when an intwsion or fire occurs is inadequatemaintenance. This alarm system should be tested weekly to make sure all sensors are working properly. Theecurity console (and remote keypad) should be tested as well.lstalhng an alarm system may make the owner ehgible for a lower insurance rate, but an alarm system is not aubsfitute for insurance. Homeowners, property owners and renters should continue to act prudently inrotecting themselves and continue to insure their Kves and property.

/e continue to develop new and improved protection devices. Users of alarm systems owe it to themselves : ~Ieir loved ones to learn about these developments. ....,

70-

_lAlarmIleviceManufact.ri”gCompa”y,aDvisio” of HWayCo~ratio”,and itstivisio”s,subsidaries andaffih-ates ~Selle~), 1W Hleen Way, Syosset, New York 11791, warrants its products to be in mnformance with its own

‘plans and specifications and to be free from defects in materials and workmanship under normal use and servicefor 18 rwnths from the date stamp mntrol on the product or, for products not having an Ademco date stamp, for12 months from date of original purchase unless the installation instmcfions or catalog sets forth a shorter period,in which case the shorter period shall apply. Sellers obhgation shall be hmited to repairing or replacing, at its owtion, free of charge for materials or labor, any product which is proved mt in mmpkance with Sellets specificationsor proves defective in materials or workmanship under normal use and sewice. Seller shall have no obtigafion under this Limited Warranty or otherwise if the product is altered or improperly repaired or sewiced by anyone othelthan Ademcofactory sewice. Forwarranty sewice, return produdtranspotiation prepaid, to Ademco FacfoOService, 185 Eileen Way, Syosset, New York 11791.

THERE ARE NO WARRANTIES, EXPRESS OR IMPLIED, OF MERCHANTABILITY, OR FITNESS FOR#PARTICULAR PURPOSE OR OTHERWISE, WHICH EXTEND BEYOND THE DESCRIPTION ON THE FACEHEREOF. IN NO CASE SHALL SELLER BE LIABLE TO ANYONE FOR ANY CONSEQUENTIAL OR INCIOENTA1DAMAGES FOR BREACH OF THIS OR ANY OTHER WARRANTY, EXPRESS OR IMPLIED, OR UPON ANYOTHER BASIS OF LIABILITY WHATSOEVER, EVEN IF THE LOSS OR DAMAGE IS CAUSED BY THE SELLERSOWN NEGLIGENCE OR FAULT.

Seller does not represent that the products it sells may not be compromised or circumvented; that the product:will prevent any perwrral injury or property loss by burglary, robbe~, fire or otherwise; or that the products will in alcases lprovide adequate warning orprotecfion. Customer understands that a properly installed andmaintainecalarm may only reduce the risk of a burglary, robbery, fire or other events occurring without providing an alamr, buit is not insurance or a guarantee that such will not omr or that there will be ~ personal injury or propedy loss as tresult. CONSEQUENTLY, SELLER SHALL HAVE NO LIABILITY FOR ANY PERSONAL INJURY, PROPER~DAMAGE OR OTHER LOSS BASED ON A CUIM THE PRODUCT FAILED TO GIVE WARNING. HOWEVER, ilSELLER IS HELD LIABLE, WHETHER DIRECTLY OR INDIRECTLY, FOR ANY LOSS OR DAMAGE ARISING UNDER THIS LIMITED WARRANTY OR OTHERWISE, REGARDLESS OF CAUSE OR ORIGIN, SELLERS MAXIMUNLIABILITY SHALL NOT IN ANY CASE EXCEED THE PURCHASE PRICE OF THE PRODUCT, WHICH SHALL BETHE COMPLETE AND EXCLUSIVE REMEDY AGAINST SELLER. This warranty replaces any previous warrantie!

‘land istheonly warranty made by Seller onthisproduCf. Noincrease orakerafion, written or verbal, of theobfiga-f this Limited Warranty is authorized.

-71-

[ADEMCOJ AURM D~CE MANUFACWRING CO.~ DMStON OF M~AY CORP.

1 ffi EILEEN WAY, SYOSS=, NY 11791

NW19VI W93 COPYRIG~ @ 1W2 P~AY CORPORATION

ADDENDUM TO: INSTALLATION INSTRUCTIONS FOR 5140XM CONTROLUSE WITH ISSUE: N6019V1

RE: Feature Changes and New Program Fields

This addendum applies to 5140XM Controls which are shipped with firmware EPROMmarked:

WA5140XM-XX (where XX = 18 or higher)The EPROM is located beneath the main PC board shield cover.

The following features are new for the 5140XM Control.

1. In accordance with revisions to UL864, Standard for Commercial Fire Alarms, the followingsystem changes have been made.

Silencing Console Sounds for Fire Supervisory Zone Type now requires security code + OFFTo silence console sounds triggered by supervisory conditions on zones programmed for fire zonesupervisory response (zone response type 18), you must enter the security code + OFF. Prior to thischange, these console sounds could be silenced by pressing any key (no security code was needed).

Keyswitch Mode 2 Operation (field *15)New fire or burglary alarm conditions occurring after a previous alarm was silenced using thekeyswitch will now automatically re-activate the corresponding fire or burglary alarm bell circuits whenkeyswitch mode 2 operation is selected (field *15 set to 2). Prior to this change, alarm bell circuitsremained silenced until the security code + OFF was entered at a console.

Note that when keyswitch mode 2 operation is selected, operating the keyswitch will silence fire andburglary alarms only when a fire alarm condition is present (in accordance with the existingInstallation Instructions).

OFF-NORMAL Communicator Test Report (new program fields 3*53, 3*54)Off-normal conditions are fire alarm system related conditions existing at the time a normal test reportis sent. These conditions include fire alarms, fire troubles or supervisories, and certain systemtroubles such as earth ground faults, AC failure, low system battery, or bell circuit faults. The 5140XMnow transmits an "off-normal" communicator test report (programmed in field 3*53, 3*54) instead ofthe normal communicator test report (programmed in fields *81, *82) when fire alarm system off-normal conditions are present at the time of test report transmission.

As shipped, both reports are disabled and must be enabled for installations that provide fire alarmcentral station service. The normal communicator test report is enabled as described in theInstallation Instructions. The off-normal communicator test report is enabled as follows:

Field 3*53 Field 3*54First Digit Second Digit

  |     |  

For Ademco High Speed and Ademco Contact ID report formats: Enter "01" in field 3*53.

Ademco High Speed off-normal test reports use channel 3 =1 and status channel = 9

Contact ID sends code 608.

For Low Speed Formats: Enter the first (event code) digit of the report in field 3*53 and the second(zone number) digit of the report in field 3*54. These fields require that two numbers be entered foreach digit of the report (i.e. enter 00 if no digit is to be sent, enter 01 for "1", enter 10 for "A"..., enter15 for "F").

Note: fields 3*53 and 3*54 can also be programmed by loading one of the four built-in communicationdefaults as follows:Communicator Default 3*53 Value 3*54 ValueLow Speed (*94*80) 05 00Ademco Express (*94*81) 15 00Ademco High Speed (*94*82) 01 00Ademco Contact ID (*94*83) 01 00

2. Fire Supervisory Response On Short Circuit Or Open Circuit Selection(new program field 3*13)Field 3*13 allows the installer to select whether a short circuit or open circuit fault will initiate asupervisory response on zones programmed for fire supervisory response (response type 18).

3*13    0 = trouble on open / supervisory on short;

1 = supervisory on open / supervisory on short

When field 3*13 is set to "0" (default), zones programmed for fire supervisory response providetrouble on open / supervisory on short. When field 3*13 is set to "1", zones programmed for firesupervisory response provide supervisory on open / supervisory on short response.

3. Extended waterflow and fire supervisory delay (new program field 3*18)Field 3*18 allows the fire waterflow (response type 17) and fire supervisory (response type 18) zonedelay programmed in field 3*16 to be extended.

3*18    0 = no extended delay; 1 = delay in 3*16 times 4

When field 3*18 is set to "0" (default), the delay programmed in field 3*16 applies. When field 3*18 isset to "1" the delay programmed in field 3*16 is multiplied by 4 (allowing delays up to 120 seconds).

4. Manual/Automatic fire Waterflow alarm silencing (new program field 3*14)Field 3*14 allows the installer to select whether zones programmed for fire waterflow response(response type 17) can be silenced manually (security code + OFF) or can be silenced automaticallywhen waterflow ceases.

3*14    0 = manual silencing only; 1 = automatic silence when waterflow ceases

When field 3*14 is set to "0" (default), waterflow zones can be silenced manually only, by entering thesecurity code + OFF. When field 3*14 is set to "1", waterflow zones will silence automatically whenwaterflow ceases (provided that no other fire alarms are present).

Note that if field 3*14 is set for "1", entering security + OFF will not silence waterflow alarms whilewater continues to flow.

5. Clarification of Duress Trigger OperationThe Installation Instructions currently state that the silent panic/duress trigger goes HIGH when asilent panic or duress alarm occurs, and remains high until the security code + OFF is entered. This istrue when a silent panic alarm is initiated via a hardwired or polling loop zone. However, if the duressalarm is initiated via console key depression, the silent panic/duress trigger remains high for about 2seconds only, then returns to the low state.

ALARM DEVICE MANUFACTURING CORPORATIONA DIVISION OF PITTWAY CORPORATION

165 Eileen Way, Syosset, New York 11791Copyright © 1994 PITTWAY CORPORATION

N6019V1XX 12/94