Upload
others
View
3
Download
0
Embed Size (px)
Citation preview
54
V. IDENTITY AND SEQUENCE DIVERSITY OF
BEGOMOVIRUS ASSOCIATED WITH YELLOW LEAF CURL DISEASE OF TOMATO IN INDONESIA*
)
Abstrak
Infeksi Begomovirus pada tanaman tomat menyebabkan penyakit yang
serius dan kehilangan hasil yang nyata. Tujuan penelitian ini adalah (i)
mengamplifikasi gen AV1 untuk Begomovirus menggunakan primer spefisik; (ii)
menentukan sekuen nukleotida dari gen AV1 hasil amplifikasi PCR; (iii)
mengidentifikasi virus-virus yang berasosiasi dengan penyakit keriting daun pada
tomat; dan (iv) menganalisis diversitas sekuen asam nukleat dan asam amino
prediksi dari gen AV1 di antara isolat-isolat yang diidentifikasi. Sampel-sampel
yang menunjukkan gejala-gejala umum dari infeksi Begomovirus dikoleksi dari
lokasi-lokasi yang berbeda di Jawa dan Sumatera. Amplifikasi polymerase chain
reaction (PCR) menggunakan asam nukleat total dan primer spesifik Begomovirus
untuk gen AV1, sekuensing secara langsung dari produk PCR, dan analisis sekuen
asam nukleat dan asam amino menggunakan BLAST telah dilakukan. Kesimpulan
dari penelitian ini adalah (i) adanya pita DNA hasil amplifikasi PCR
membuktikan bahwa sampel-sampel tanaman tomat yang sakit terinfeksi oleh
Begomovirus (ii) hasil analisis BLAST menggunakan sekuen nukleotida dan asam
amino menunjukkan bahwa fragmen DNA hasil amplifikasi PCR adalah gen AV1
dari Begomovirus, (iii) identitas sekuen nukleotida dan asam amino dari gen AV1
di antara isolat-isolat Begomovirus mengindikasikan bahwa isolat-isolat tersebut
adalah strain Ageratum yellow vein virus (AYVV) Indonesia, dan (iv) hasil
analisis filogenetik mengindikasikan bahwa delapan isolat Begomovirus tersebut
terbagi menjadi dua kelompok yang berbeda. Hasil dari percobaan ini juga
menggambarkan bahwa adanya keragaman genetik Begomovirus pada berbagai
daerah di Indonesia perlu untuk diteliti lebih lanjut. Selain itu, prevalensi dari
spesies Begomovirus yang berbeda perlu juga untuk diteliti.
Kata kunci: Begomovirus, analisis sekuen, gen AV1, Tomato leaf curl virus
*) Bagian dari disertasi ini telah diterbitkan dalam jurnal ilmiah terakreditasi
Microbiology Indonesia 2 (1): 1-7. April 2008
55
Abstract
Infection of Begomovirus in tomato has caused serious disease and yield
losses. The objectives of this study were to: (i) amplify putative AV1 gene using
AV1 specific primers for Begomovirus; (ii) determine nucleotide sequences of the
PCR amplified AV1 gene; (iii) identify the viruses associated with tomato leaf
curl disease; and (iv) analyze nucleic acid and predicted amino acid sequence
diversities of AV1 gene among the identified isolates. Samples of tomato plants
showing typical symptoms of Begomovirus infection were collected from
different locations in Java and Sumatera. Polymerase-chain reaction (PCR)
amplification using total nucleic acid isolated from sample plants and
Begomovirus specific primers for AV1 gene was performed; direct sequencing of
PCR product was carried out; and nucleotide and amino acid sequence analysis
using BLAST were conducted. The conclusions of this research were (i) positive
results of the PCR amplification proved that diseased tomato samples collected
from eight locations in Java and Sumatra were infected with at least one isolate of
Begomovirus, (ii) the Blast analysis results using nucleotide and amino acid
sequences showed that the PCR amplified DNA fragment was AV1 gene, (iii)
identity of nucleotide and amino acid sequences of AV1 gene among
Begomoviruses indicated that the isolates determined in this research were
Indonesian isolates of AYVV, and (iv) results of phylogenetic analysis of eight
Begomovirus isolates identified in this study indicated they belonged into two
different clades. Results of this research also suggest that the existence of
Begomovirus genetic diversity in various regions in Indonesia need further
investigation. Moreover, the prevalence of distinct Begomovirus species or
isolates should also be investigated.
Keywords: Begomovirus, sequence analysis , AV1 gene, tomato leaf curl virus
56
Introduction
The family Geminiviridae is one of the largest group of plant viruses. The
morphology of geminivirus particles is unique having a geminate shape and a
small size (≈ 30 x 20 nm). They are characterized by a circular, single stranded,
DNA genome which replicates in the host cell nucleus and is encapsidated in
twinned incomplete icosahedral particles. The family Geminiviridae is divided
into four genera, i.e. Mastrevirus, Curtovirus, Topocuvirus and Begomovirus,
based on the viral genome structure, host range and type of insect vector (Van
Regenmortel et al. 1999). Mastreviruses and Curtoviruses have a monopartite
genome and are transmitted by various leafhopper species, but infect
monocotyledonous and dicotyledonous plants, respectively. The genus
Topocuvirus is made up of the tomato pseudo-curly - top virus, which has a
monopartite genome, is transmitted by treehopper species, and which infects
dicotyledonous plants. Members of the genus Begomovirus have monopartite (one
~2.9-kb DNA) or bipartite (two ~2.6-kb DNAs referred to as “DNA-A” and
“DNA-B”) genome, is transmitted by whiteflies (e.g. Bemisia tabaci Gennadius)
and infects dicotyledonous plants (Harrison 1985).
Begomoviruses are considered to be emerging plant viruses, due to their
increasing incidence and the severity of the diseases which they cause in a number
of economically important crops, mostly in tropical and subtropical regions in the
world (Polston & Anderson 1997). In Indonesia, begomoviruses are currently
spreading threat for cultivated tomato in some tomato production areas and
causing substantial yield losses. These viruses have also been reported to infect
some other plants such as chilli pepper (Capsicum annuum L.), ageratum
(Ageratum conyzoides L.) and tobacco (Nicotiana benthamiana L.) (Sudiono et al.
2001).
Partial characterization of the genomic sequence of the Indonesia tomato-
leaf-curl virus (ToLCIDV) was first reported in 1999 (DDBJ, accession number
AF189018). Similar characterization was performed for six begomoviruses
infecting tomato plants from Bandung, West Java (ToBadI-5, ToBadII-20,
ToBadII-23, ToBadIII-1), Purwokerto, Central Java (ToPur-6), and Magelang,
57
Central Java (ToMag-2) (Sukamto et al. 2005). Meanwhile, the complete
nucleotide sequence identification has been reported for the tomato-leaf-curl Java
virus (Kon et al. 2006).
In this paper, we report sequence analysis of the coat protein gene isolated
from eight begomovirus isolates infecting tomato plants collected from different
location in Java and Sumatra. It is important to understand the genetic diversity of
begomoviruses infecting tomato plants as basic information for developing
disease control strategies.
Materials and Methods
Sample collection
Tomato plant showing typical symptoms of begomovirus infection
(yellow mosaic, leaf curling, and stunting) were collected from several tomato
producing areas (8 districts, 5 provinces) in Indonesia (Figure 13 and see
RESULTS Table 4). Samples were placed in plastic bags or bottles and carried to
the laboratory for DNA extraction and to screenhouse for virus isolation and
propagation in host plant.
DNA extraction and Polymerase Chain Reaction (PCR) analysis
Total DNA was extracted from leaf according to Doyle and Doyle (1990)
with slight modification. Leaf tissue was ground in a sterile mortar in 1.0 ml of
extraction buffer. The extraction buffer used for the initial homogenization
contains 100 mM Tris pH 8.0, 1.4 M NaCl, 20 mM EDTA pH 8.0, and 0.2% (v/v)
Β-mercaptoethanol. The extraction buffer was autoclaved and 2%
polyvinylpyrolidone (PVP) and 2% CTAB were added immediately before use.
Immediately after grinding, 500 µl aliquote were transferred to a 1.5 ml microfuge
tube and incubated for 15 min at 65oC with occasional mixing to avoid
aggregation of the homogenate. To the extract was added 500 µl of
chloroform:isoamylalcohol (24/1) and the mixture was vortexed thoroughly. Each
tube was then centrifuged for 15 min at 10.000 x g. The debris-free supernatant
was transferred to a new tube and proteins precipitated by adding 2.5 x volume of
absolute ethanol and washed twice with 70% ethanol (v/v). The pellet was dried
58
and resuspended in 100 µl of sterile distilled water. This DNA extract was stored
at -20oC for further use.
The coat protein gene was amplified by the PCR technique using two
oligonucleotide specific primers for the geminivirus coat protein gene that were
provided by Dr. Sylvia Green from the Asian Vegetable Research Development
Centre (AVRDC-Taiwan), i.e the CPPROTEIN-V1 (5’-
TAATTCTAGATGTCGAAGCGACCCGCCGA-3’) and the CPPROTEIN-C1
(5’-GGCCGAATTCTTAATTTTGAACAGAATCA-3’). PCR reactions were
prepared in 25 µl total volume, containing 10X buffer (100 mM Tris-HCl, 500
mM KCl, pH 8.3), MgCl2 (75 mM), dNTP mix (4 mM), 10 µM of each primer, 1
unit of Taq DNA polymerase and 2 µl of the DNA template. The amplication
profile consisted of 30 cycles of denaturation at 94oC for 1 min, primer annealing
at 55oC for 1 min and primer extension at 72
oC for 2 min and followed by
postextension at 72oC for 5 min. PCR products were analysed in agarose gels
(1%) and stained with ethidium bromide and visualized under UV light using the
Chemidoc gel system (Biorad).
Direct sequencing of PCR products
Products of the PCR were first visualized in agarose gels (1%) to estimate
concentration and to confirm purity. Further purification of PCR products used
ExoISAP digestion [Exonuclease I enzyme and Shrimp Alkaline
Phosphatase/SAP (Biorad)] to remove the excess primers and dNTPs. The
purified PCR products were then diluted, and mixed with a single primer (either
forward or reverse primer). Each sequencing reaction was prepared using a DTCS
kit (Beckman Coulter) in a 20 µl volume containing 1,5 µM of either forward or
reverse primer and 50 ng of template DNA. The reaction profile consisted of 45
cycles of denaturation at 96oC for 20 sec, primer annealing at 50
oC for 20 sec and
primer extension at 60oC for 4 min. Reactions were analyzed in an CEQ 800
analyzer (Beckman Coulter).
Determination of Virus Identity
Database searches for the selected begomoviruses species were carried out
using The National Center of Biotechnology Information basic local alignment
59
search tool or NCBI BLAST(http://www.ncbi.nlm.nih.gov/BLAST) (Altschul et
al. 1990). The identity of the virus was determined based on the highest
percentage value of the AV1 gene nucleic acid and amino acid sequence among
the evaluated isolates and available sequences in the GenBank DNA database.
The sequences were aligned using ClustalW (Thompson et al. 1994) while
phylogenetic analysis was conducted using online tool facilities available at
http://www.genebee.msu.su/clustal/advanced. html. The distance matrices were
calculated using the Kimura two-parameters model (Kimura 1980). Results of the
analysis were used to construct phylogenetic tree and the robustness of the
internal branches of the tree was estimated by bootstrap analysis using 1000
replicates
a b
c d
Figure 13 Tomato plants exhibited various leaf-curl symptoms. Subsequent experiment
indicated they were infected by Begomoviruses. (a) Leaf curling, smaller
leaflet and stunting symptoms on tomato from Bogor, West java, (b) Leaf
curling and mosaic symptoms on tomato from Sragen, Central Java, (c) Severe upward leaf curling and yellowing symptoms on tomato from
Kaliurang, DI Yogyakarta, and d) Leaf curling symptom on tomato from
Blitar, East Java.
60
Results
PCR Amplification of AV1 gene
The detection of begomovirus infection using specific primers for AV1
gene specific primers was resulted in a single DNA fragment of approximately
780 bp (Figure 14) for most of the tomato plants showing typical begomovirus
symptoms collected from the eight locations (Figure 13). Since the
oligonucleotide primers used for PCR were specific for amplifying coat protein
(AV1) gene of Begomovirus, results of this research suggested the presence of
Begomovirus in all collected tomato plants.
Direct sequencing of PCR products
Direct sequencing of PCR products generated sequences of the putative
AV1 gene ranged from 529 – 707 bp (Table 4). The determined nucleotide
sequences would be submitted to GenBank Database. Homology among
begomovirus isolates was shown when alignment was performed for predicted
amino acid sequence of partial AV1 gene of eight Begomovirus isolates identified
in this research and other isolates available in the GenBank DNA database (Figure
15).
1 0 0 0 -b p
8 5 0
6 5 0
A V 1 g e n e
Figure 14 Agarose gel electropherogram of polymerase chain reaction (PCR)
amplified DNA fragments of putative AV1. The DNA fragments were
amplified by PCR using AV1 specific primers and total nucleic acid
of diseased tomato sample from (1) Malang, East Java; (2) Blitar, East
Java; (3) Sragen, Central Java; (4) Magelang, Central Java; (5)
Boyolali, Central Java; (6) Kaliurang, DI Yogyakarta; (7) Bogor,
West Java; and (8) Brastagi, North Sumatera. Marker: 1 Kb plus
(Invitrogen) DNA marker.
1 2 3 4 5 6 7 8 M
61
Table 4 Isolate identity, observed symptoms on collected tomato samples, location
of collected samples, and number of determined nucleic acid and
predicted amino acid sequences based on the polymerase chain reaction
amplified putative AV1 gene.
Size of sequences Isolate
identity
Observed symptoms on
collected tomato sample
Location of
collected sample Nucleotide
(bp)
Amino acid
(residues)*
ToLC-Blt Leaf curling and
stunting
Blitar, E. Java 580 193
ToLC-Mlg Yellowing, severe
upward leaf curling, and
stunting
Malang, E. Java 529 176
ToLC-Srg Leaf curling, stunting and mosaic
Sragen, C. Java 685 227
ToLC-Mgl Leaf curling, stunting
and smaller leaflet
Magelang, C. Java 707 235
ToLC-Byl Leaf curling and
stunting
Boyolali, C. Java 702 233
ToLC-Klu Severe upward leaf
curling, yellowing, and
stunting
Kaliurang, DI.
Yogyakarta
605 201
ToLC-Bgr Severe leaf curling,
cupping, smaller leaf,
and stunting
Bogor, W. Java 666 221
ToLC-Btg Leaf curling and
stunting
Brastagi, N.
Sumatra 706 234
Note: * Predicted based on the determined nucleotide sequences.
Determination of Virus Identity
Comparison of nucleotide and predicted amino sequences of putative AV1
gene of the eight isolates with available AV1 gene sequences in the GenBank
revealed that the eight isolates had homologies above 90% with Ageratum yellow
vein virus isolate from Singapore (AYVV – GenBank acc. no. X74516) (Tan et al.
1995). The homology was less than 90% with Pepper leaf curl virus isolate from
Malaysia (PepLCV-Mal –AF414287) (Shih et al. 1998) or Cassava mosaic virus
isolate from South Africa (CasMV-SA –AJ575560) (Briddon et al. 2003) (Table
5).
62
ToLC-Btg VLVTNKRRTWTNRPMYRKPRLYRMYRTPDVPKGCEGPCKVQSYEQRHDISHVGKVLCVSD
ToLC_Srg VLVTNKRRTWTNRPMYRKPRLYRMYRTPDVPKGCEGPCKVQSYEQRHDISHVGKVLCVSD
ToLC_Bgr VLVTNKRRTWTNRPMYRKPRLYRMYRTPDVPKGCEGPCKVQSYEQRHDISHVGKVLCVSD
ToLC_Mlg VLVTNKRRTWTNRPMYRKPRLYRMYRSPDVPKGCEGPCKVQSYEQRHDISHVGKVLCVSD
ToLC-Blt VLVTNKRRTWTNRPMYRKPRLYRMYRSPDVPKGCEGPCKVQSYEQRHDISHVGKVLCVSD
ToLC-Klu VLVTNKRRTWTNRPMYRKPRLYRMYRSPDVPKGCEGPCKVQSYEQRHDISHVGKVCCVTD
ToLC-Byl VFVTNKRRTWTNRPMYRKPSMYSMYRSPDVPKGCEGPCNVQSYEQRHDISHVGKVLCVSD
ToLC_Mgl VLVTNKRRTWTNRPMYRKPRLYRMYRSPDVPKGCEGPCKVQSYEQRHDISHVGKVLCVSD
AYVV VLVTNRRRTWTNRPMYRKPRLYRMYRTPDVPKGCEGPCKVQSYEQRHDISHVGKVLCVSD
SCLV-Jpn VLVTNKRRTWTNRPMYRKPRMYRMYRSPDVPKGCEGPCKVQSYEQRHDISHVGKVLCVSD
ToLCV_Mal VLVTNKRRAWTQRPMYRKPRMYRMYRSPDVPKGCEGPCKVQSYEQRHDISHVGKVLCVSD
ToLCV_JvA VLVTNKRRTWTNRPMYRKPRLYRMYRSPDVPKGCEGPCKVQSFESRHDVSHVGKVCCITD
ToLCV-Jv VLVTNKRRTWTNRPMYRKPRMYRMYRSPDVPKGCEGPCKVQSFESRHDVSHVGKVCCITD
PepLCV-Mal VLVTNKRRSWANRPMNRKPRIYRMYKSPDVPRGCEGPCKVQSYEQRHDVAHVGKVICVSD
CasMV-SA VQGTNKRRSWTLRPMYRKPRMYRMYRSPDVPRGCEGPCKVQSYEQRDDVKHTGAVRCVSD
* **:**:*: *** *** :* **::****:******:***:*.*.*: *.* * *::*
ToLC-Btg VTRGNGLTHRVGKRFCVKSVYVLGKVWMDENIKTKNHTNTVMFYLVRDRRPYGT-AMDFG
ToLC_Srg VTRGNGLTHRVGKRFCVKSVYVLGKVWMDGDIKTKNHTNTVMFYLVRDRRPYGT-ALDFG
ToLC_Bgr VTRGNGLTHRVGKRFCVKSVYVLGKIWMDENIKTKNHTNTVMFYLVRDRRPYGT-AMDFG
ToLC_Mlg VTRGNGLTHRVGKRFCVKSVYVLGKIWMDENIKTKNHTNTVMFYLVRDRRPYGT-AMDFR
ToLC-Blt VTRGNGLTHRVGKRFCVKSVYMLGKIWMDENIKTKNHTNTVMFHLVRDRRPYGS-AMDFG
ToLC-Klu VTRGNGLTHRMGKRFCVKSVYVLGKIWMDENIKTKNHTNTVMFYLVRDRRPYGS-AMDFG
ToLC-Byl VTRGNGLTHRVGKRFCVRSVYVLGKIWMDENIKTKNHTNTVMFYLVRDRRPYGS-AMDFG
ToLC_Mgl VTRGNGLTHRVGKRFCVKSVYVLGKIWMDENIKTKNHTNTVMFYLVRDRRPYGS-AMDFG
AYVV VTRGNGLTHRVGKRFCVKSVYVLGKIWMDENIKTKNHTNTVMFYLVRDRRPFGT-AMDFG
SCLV-Jpn VTRGNGLTHRVGKRFCVKSVYVLGKIWMDENIKTKNHTNTVMFYLVRDRRPFGT-AMDFG
ToLCV_Mal VTRGNGFTHRVGKRFCVKSIYVLGKIWMDENIKTKNHTNTVMFFLVRDRRPFGT-AMDFG
ToLCV_JvA VTRGLGLTHRTGKRFCVKSVYIMGKVWMDENIKTKNHTNTVMFFLVRDRRPYSS-PQDFG
ToLCV-Jv VTRGLGLTHRTGKRFCVKSVYIMGKVWMDENIKTKNHTNTVMFFLVRDRRPYSS-PQDFG
PepLCV-Mal VTRGNGLTHRVGKRFCIKSVYVLGKIWMDENIKTKNHTNTVMFFLVRDRRPFGT-PQDFG
CasMV-SA VTRGSGITHRVGKRFCVKSIYVLGKIWMDENIKKQNHTNQVMFFLVRDRRPYGTSPMDFG
**** *:*** *****::*:*::**:*** :**.:**** ***.*******:.: . **
ToLC-Btg QVFNMYDNEPSTATIKNDLRDRYQVLRKFTSTVTGGQYACKEQAMV
ToLC_Srg QVFNMYDNEPSTATIKNDLRDRYQVLRKFSSTVTGGQYACKRQAWV
ToLC_Bgr QVFNMYDNEPSTATIKNDLRDRYQVLRKYTSTVTGGQYACKEQALV
ToLC_Mlg QVFNMYDNEPSTATIKNDLRDRYQVLRKFTSTVTGGQYACKEQAWV
ToLC-Blt QVFNMYDNEPSTATIKNDLRDRYQVLRKFTSTVTGGQYAAKEQASV
ToLC-Klu QVFTMYDNEPSTATIKNDLRDRYQGVRKLSSTVTGGQYAGKGQASV
ToLC-Byl QVFNMYDNEPSTATIKNDLRDRYQVLRKFTSTVTGGQYASKEQALV
ToLC_Mgl QVYNMYDNEPSTATIKNDLRDRYQVLRKFTSTVTGGQYASKEQALV
AYVV QVFNMYDNEPSTATIKNDLRDRYQVLRKFTSTVTGGQYASKEQALV
SCLV-Jpn QVFNMYDNEPSTATIKNDLRDRYQVLRKFTSTVTGGQYACKEQALV
ToLCV_Mal QVFNMYDNEPSTATVKNDMRDRYQVLRKFTATVTGGQYASKEQALV
ToLCV_JvA QVFNMYDNEPSTATVKNDMRDRFQVLRKFSSTVTGGQYACKEQALV
ToLCV-Jv QVFNMYDNEPSTATVKNDMRDRFQVLRKFTSTVTGGQYACKEQSLV
PepLCV-Mal QVFNMYDNEPSTATVKNDNRDRFQVLRRFQATVTGGQYASKEQAIV
CasMV-SA QVFNMFDNEPSTATIKNDLRDRFQVLRKFHATVVGGPSGMKEQALI
**:.*:********:*** ***:* :*: :**.** . * *: :
Figure 15 Alignment of partial amino acid sequences predicted from determine
nucleotide sequences of AV1 gene of eight Begomovirus isolates
determined in this research and seven Begomovirus isolates available
from GenBank DNA database. AYVV - Ageratum yellow vein virus
(X74516), SCLV-Jpn– Soybean crinkle leaf virus-Japan (AB050781),
PepLCV-Mal– Pepper leaf curl virus-Malaysia (AF414287), ToLCV-
Jv– Tomato leaf curl virus-Java (NC-005031), ToLCV-JvA – Tomato
leaf curl virus-Java[Ageratum] (AB162141), ToLCV-Mal – Tomato
leaf curl virus-Malaysia (NC-004648), and CasMV-SA – South
African cassava mosaic virus (AJ575560) were obtained from
GenBank database at http://www.ncbi.nlm.nih.gov/blast/Blast.cgi
63
Table 5. Percentages of sequence identities of AV1 gene among suspected
Begomoviruses isolates determined in this research and three
Begomoviruses available in the GenBank database.
AYVV PepLCV-Mal CasMV-SA Isolate
identity NT (%) AA (%) NT (%) AA (%) NT (%) AA (%)
ToLC-Bgr 95 97 81 85 78 77
ToLC-Blt 93 95 81 85 89 77
ToLC-Btg 95 96 81 85 87 79
ToLC-Byl 92 93 80 83 86 78
ToLC-Klu 93 90 82 81 84 75
ToLC-Mgl 95 96 81 86 86 80
ToLC-Mlg 94 96 81 86 79 75
ToLC-Srg 94 93 82 81 82 76
Note: AYVV - Ageratum yellow vein virus ( X74516), PepLCV-Mal – Pepper
leaf curl virus - Malaysia (AF414287), and CasMV-SA - South African
cassava mosaic virus (AJ575560) were obtained from GenBank database at
http://www.ncbi.nlm.nih.gov/blast/Blast.cgi
Distance matrices based on AV1 gene amino acid sequences of suspected
Begomovirus isolates determined in this research, AYVV, SCLV-Jpn, PepLCV-
Mal, ToLCV-Jv, ToLCV-JvA, ToLCV-Mal, and SA-CasMV supported previous
finding that the suspected Begomoviruses were indeed isolates of AYVV since
their distances (Table 6) were generally less than 10%. On the other hand, the
distances were generally more than 10% if AV1 gene of the suspected
Begomovirus isolates from Indonesia were compared to that of either PepLCV,
ToLCV-Jv, or ToLCV-JvA, and more than 20% when compared to that of
CasMV-SA. These results indicated that the suspected Begomovirus isolates from
Indonesia were not isolates of PepLCV, ToLCV-Jv, ToLCV-JvA, or CasMV. The
ToLCV-Jv and ToLCV-JvA were the other two Begomovirus isolates from
Indonesia that had previously been reported (Kon et al. 2006).
The AV1 Gene Sequence Diversity
Phylogenetic analysis was carried out based on predicted amino acid
sequences of putative AV1 gene determined in this research and those of other
Begomoviruses available in the GeneBank (Figure 16). The eight Begomovirus
isolates determined in this research were all clustered in similar clade with AYVV
64
from Singapore (AYVV) and Taiwan (AYVV-Tw). However, their sequences
were quite diverse based on the arm length of the phylogenetic tree. Results of this
analysis also indicated that three Begomovirus isolates from Indonesia identified
in previous study (ToLCV-Jv, ToLCV-JvA, and TYLCV-Lbg) did not belong to
the same clade as the isolates identified in this research. The three isolates were
more closely related to PepLCV-Mal than to the eight isolates identified in this
research.
Table 6 Distance matrices (%) based on predicted AV1 gene amino acid
sequences of suspected Begomoviruses isolates determined in this
research, Ageratum yellow vein virus (AYVV), Soybean crinkle leaf
virus (SCLV), Pepper leaf curl virus (PepLCV), Tomato leaf curl virus
(ToLCV), and Cassava mosaic virus (CasMV).
Isolate ToLC-
Blt
ToLC-
Mlg
ToLC-
Srg
ToLC-
Mgl
ToLC-
Byl
ToLC-
Klu
ToLC-
Bgr
ToLC-
Btg
ToLC-Blt
ToLC-Mlg 3,7
ToLC-Srg 7,7 5,0
ToLC-Mgl 3,1 3,1 7,0
ToLC-Byl 6,3 6,3 10,4 4,4
ToLC-Klu 7,7 8,3 10,4 7,7 11,1
ToLC-Bgr 4,4 2,5 5,0 3,1 6,3 8,3
ToLC-Btg 4,4 2,5 3,7 3,7 7,0 9,0 1,8
AYVV 5,0 3,7 6,3 3,1 6,3 9,7 2,5 3,1
SCLV-Jpn 4,4 2,5 6,3 3,1 5,0 9,0 2,5 3,1
PepLCV-Mal 16,2 15,5 18,5 15,5 18,5 20,9 16,2 16,2
ToLCV-Jv 14,0 14,7 15,5 14,0 17,7 15,5 14,7 14,0
ToLCV-JvA 14,7 15,5 17,7 14,7 17,0 17,7 15,5 14,7
ToLCV-Mal 9,0 8,3 12,5 7,7 9,7 14,7 8,3 9,0
CasMV-SA 22,5 23,3 27,6 21,7 23,3 27,6 23,3 24,2
Note: AYVV - Ageratum yellow vein virus (X74516), SCLV-Jpn – Soybean
crinkle leaf virus-Japan (AB050781), PepLCV-Mal– Pepper leaf curl
virus-Malaysia (AF414287), ToLCV-Jv– Tomato leaf curl virus-Java (NC-
005031), ToLCV-JvA–Tomato leaf curl virus-Java[Ageratum]
(AB162141), ToLCV-Mal– Tomato leaf curl virus-Malaysia (NC-004648),
and CasMV-SA– South African cassava mosaic virus (AJ575560) were
obtained from GenBank database at
http://www.ncbi.nlm.nih.gov/blast/Blast.cgi
65
0 0.02 0.04 0.06 0.08 0.10 0.12 0.14 0.16 0.18 0.20
Figure 16 Phylogenetic relationship based on predicted AV1 gene amino acid sequences
of suspected Begomoviruses isolates determined in this research (indicated
with *), and other Begomoviruses available in the GenBank DNA database.
The AV1 gene for AYVV - Ageratum yellow vein virus (X74516), AYVV-Tw
- Ageratum yellow vein Taiwan virus (NC_004627), AYVV-Ch - Ageratum
yellow vein China virus - [G68] (AJ849916), SCLV - Soybean crinkle leaf
virus (AB050781), SLCV-Jpn - Soybean crinkle leaf virus-[Japan]
(AB050781), SLCV-Thai - Soybean crinkle leaf virus-[Thailand]
(EF064788), ToLCV-JvA - Tomato leaf curl Java virus-[Ageratum]
(AB162141), TYLCV-Lbg - Tomato yellow leaf curl Indonesia virus-
[Lembang] (AF189018), ToLCV-Jv - Tomato leaf curl Java virus
(NC_005031), ToLCV-Bang - Tomato leaf curl Bangladesh virus
(AF188481), ToLCV-Lao - Tomato leaf curl Laos virus (AF195782),
ToLCV-Mal - Tomato leaf curl Malaysia virus (NC_004648), ToLCV-Vt
Tomato leaf curl Vietnam virus (NC_004153), ToLCV-Ch - Tomato leaf curl
China virus (ToLCV-Ch), PepLCV-Mal - Pepper leaf curl virus-[Malaysia]
(AF414287), StLCV - Stachytarpheta leaf curl virus (AJ810157), CasMV-SA
- South African cassava mosaic virus (AJ575560), BLCV-Mdgr - Bean leaf
curl Madagascar virus (AM701757), and WmChStV - Watermelon chlorotic
stunt virus (NC_003708) isolates, respectively, were obtained from GenBank
DNA database, available at http://www.ncbi.nlm.nih.gov/blast/Blast.cgi .
* *
* *
* *
* *
66
Discussions
A high incidence of leaf curl disease in tomato plants in Indonesia has
been observed in the last 5 years and it has become a major problem in tomato
growing areas across the country (Hidayat, unpublished data). Association of
begomiviruses with tomato leaf curl disease has been reported mainly from West
Java and Central Java (Sudiono et al. 2001; Aidawati et al. 2005). Detailed
analyses of the molecular properties and biological activities of begomoviruses
from tomato plants with leaf curl in Java has been described recently (Sukamto et
al. 2005; Kon et al. 2006). In this paper, we reported the detection, sequencing,
and phylogenetic analysis of several isolates of tomato begomoviruses collected
from different locations in Java and Sumatra, Indonesia. We conducted analysis
of the genetic diversity based on coat-protein gene sequence after direct
sequencing of PCR products. Direct sequencing of PCR products, after the PCR
parameters were optimimized, has an advantage compared with other strategies,
i.e. it is extremely efficient for the analysis of a large number of sequences in a
short period of time.
Previously it has been known that several begomoviruses are associated
with tomato leaf curl disease in Java, Indonesia. Based on sequence comparisons
and phylogenetic analysis, the viruses were divided into several groups. It is an
interesting facts that all begomoviruses asociated with tomato leaf curl disease in
Java formed separate groups from those of other tomato infecting begomoviruses.
According to Sukamto et al. (2005) and Kon et al. (2006), tomato begomoviruses
from Java had a closest relationship with AYVV. Similarly, Begomovirus isolates
identified in this research showed high sequence identities with that of AYVV,
and also SCLV, and ToLCV-Mal. The AV1 gene predicted amino acid sequences
of the identified isolates exhibited distances of less than 10% against that of the
three Begomoviruses, indicating they were isolates of the same virus species.
Therefore, it was suggested that the identified Begomovirus isolates in this study
might be Indonesian isolates of AYVV or SCLV. Based on AV1 gene sequences
analysis in this study, previous identified tomato begomoviruses from Indonesia,
ToLCV-Jv, ToLCV-JvA, and TYLCV-Lbg, has closed relationship with PepLCV
67
and CasMV. It was not the case for the eight identified Begomovirus isolates in
this study since their predicted amino acid sequence identities and their distances
were either more than 90% and less than 10% (against PepLCV) or more than
80% and less than 20% (against CasMV), respectively.
Although the eight Begomovirus isolates identified in this study exhibited
more than 90 % of the AV1 gene amino acid sequence identities and less than
10% of the distances, results of phylogenetic analysis indicated they belonged into
two different clades. Such results indicated the their AV1 gene might have
originated from the same progenitor sequences but separated different way
because of accumulated mutations. Another possible explanation for such cases
might be because of the occurence of recombination. Differences in accumulated
mutations might not be the answer since the occurence of Begomovirus associated
tomato diseases in Indonesia was only recently. Therefore, recombination might
be the possible cause of such differentiation. More studies would be required
before such possibility be decided. Kitamura et al. (2004) has proposed that
recombination is a very frequent event and widespread phenomenon among
Geminiviruses. Such recombination might occur either at species and genera
levels, respectively. It was also suggested that the genome recombination within
Geminiviruses contributed significantly to the evolution processes of
Geminiviruses.
Based on the analysis above, it is suggested that the existence of
Begomovirus genetic diversity in various regions in Indonesia need further
investigation. Moreover, the prevalence of distinct Begomovirus species or
isolates should also be investigated. Such data will aid the development of control
strategies for viruses and support development of Begomovirus resistance tomato
cultivars through plant breeding.
Conclusion
1. Positive results of the PCR amplification proved that diseased tomato samples
collected from eight locations in Java and Sumatera were infected with at least
one isolate of Begomovirus
68
2. The Blast analysis results using nucleotide and amino acid sequences showed
that the PCR amplified DNA fragment was AV1 gene
3. Identity of nucleic acid and amino acid among AV1 gene among
Begomoviruses indicated that the isolates determined in this research were
Indonesian isolates of AYVV
4. Results of phylogenetic analysis of eight Begomovirus isolates identified in
this study indicated they belonged into two different clades.
Reference
Aidawati N, Hidayat SH, Suseno R, Hidayat P, Sujiprihati S. 2005. Identifikasi
geminivirus yang menginfeksi tomat berdasarkan pada teknik Polymerase
Chain Raction-Restriction Fragment Length Polymorphism. J Mikrobiol
Indones 10:29-32
Altschul SF, Gish W, Miller W, Myers EW, Lipinan DJ. 1990. Basic local
alignment search tool. J of Mol Biol 215: 403-410
AVRDC Centerpoint newsletter-spring 2003 issue
Briddon RW, Robertson I, Markham PG, and Stanley J. 2004. Occurrence of
South African cassava mosaic virus (SACMV) in Zimbabwe. Plant
Pathol. 53(2):233-233
Doyle JJ, Doyle JL. 1990. Isolation of plant DNA from fresh tissue. Focus 12: 13-
15.
Harrison BD. 1985. Advances in geminivirus research. Ann Rev Phytopathol 23:
55-82.
Hidayat SH, Chatchawankanpanich O, Rusli E, Aidawati N. 2006. Begomovirus
associated with pepper yellow leaf curl disease in west Java, Indonesia. J
Indon Microbiol 11 (2): 87-90
Kimura M. 1980. A simple method for estimating evolutionary rate of base
substitution through comparative studies of nucleotide sequences. J Mol
Evol 16: 111-120
Kitamura K, Murayama A, Ikegami M. 2004. Evidence for recombination among
isolates of tobacco leaf curl Japan virus and honeysuckle yellow vein
mosaic virus. Arch Virol 149:1221-1229.
Kon T, Hidayat SH, Hase S, Takahashi H, Ikegami M. 2006. The Natural
occurrence of two distinct begomovirus associated with DNAβ and a
recombinant DNA in a tomato plant. Phytopathol 96: 517-525.
Moriones E, NavasCatillo J. 2000. Tomato yellow leaf curl virus, an emerging
virus complex causing epidemics worldwide. Virus Research 71: 123-134
69
Polkela MA, Svensson E, Rojas A, Horko T, Paulin L, Valkonen JPT,
Kvarnheden A. 2005. Genetic diversity and mixed infections of
begomoviruses infecting tomato, pepper and cucurbit crops in Nicaragua.
Plant Pathol 54: 448-459
Polston JE, Anderson PK. 1997. The emergence of whitefly-transmitted
geminiviruses in tomato in the Western hemisphere. Plant Dis 81:1358-
1369.
Rodriguez PE, Zerbini FM, Ducasse DA. 2006. Genetic diversity of Begomovirus
infecting soybean, bean and associated weeds in Mortwestern Argentina.
Fitopatol Bras 31:342-348
Santoso TJ, Hidayat SH, Herman M, Aswidinnoor H, Sudarsono. 2008. Identitas
dan keragaman genetik Begomovirus yang berasosiasi dengan penyakit
keriting pada tomat berdasarkan teknik Polymerase Chain Reaction
(PCR)-Restriction Fragment Length Polymorphism (RFLP). J Agrobiogen
4(1):- (in press)
Shih SL, Roff MMN, Nakhla MK, Maxwell DP, Green SK. 1998. A new
geminivirus associated with a leaf curl disease of tomato in Malaysia. J of
Zhiwu Baohuxue Hui Huikan 40: 435-435
Sudiono, Hidayat SH, Suseno R, Sosromarsono S. 2001. Molecular detection and
host range study of tomato-infecting begomovirus. In : Proceeding of
Indonesian Phytopathology Soc. Seminar. Bogor. Aug 22-24, 2001. p.
208-217.
Sukamto, Kon T, Hidayat SH, Ito K, Hase S, Takahashi H, Ikegami M. 2005.
Begomovirus associated with leaf curl disease of tomato in Java,
Indonesia. J Phytopathol 153: 562-566.
Tan PH. Wong SM, Wu M, Bedford ID, Saunders K. Stanley J. 1995. Genome
organization of Ageratum yellow vein virus, a monopartite whitefly-
transmitted geminivirus isolated from a common weed. J Gen Virol
76:2915-2922
Thompson JD, Higgins DG, Gibson TJ. 1994. Clustal W: improving the
sensitivity of progressive multiple sequence alignment through sequence
weighting, position-specific gap penalties and weight matrix choice. Nuc
Ac Res 22: 4673-4680
Van Rogenmortel MHV, Fauquet CM, Bishop DHL, Carstens E, Estes MK,
Lemon SM, Maniloff J. Mayo MA, McGeoch DJ, Pringle CR, Wickner
RB. 1999. Virus Taxonomy. Seventh Report of the International
Committee on Taxonomy of Viruses. Academic Press, San Diego.
70
VI. KONSTRUKSI GEN AV1- BEGOMOVIRUS PADA
VEKTOR EKSPRESI DAN INTRODUKSINYA KE TEMBAKAU MENGGUNAKAN VEKTOR A. tumefaciens
Abstrak
Infeksi Begomovirus dilaporkan menyebabkan penyakit keriting tanaman
tomat di beberapa negara, termasuk Indonesia. Penyakit ini telah mengakibatkan
penurunan hasil yang nyata pada produksi tomat. Pada saat ini belum ada cara
yang efektif untuk mengendalikan penyakit yang disebabkan oleh infeksi
Begomovirus tersebut. Penggunaan varietas tomat yang tahan merupakan cara
pengendalian yang terbaik untuk mengkontrol virus tersebut. Teknologi rekayasa
genetik memberikan peluang untuk merakit tanaman transgenik yang tahan
terhadap Begomovirus melalui pendekatan pathogen-derived resistance (PDR).
Gen AV1 dari Begomovirus merupakan gen yang menyandikan protein selubung
yaitu suatu protein yang bertanggung jawab dalam enkapsidasi partikel virus dan
berperan di dalam penentuan spesifisitas penularan virus dan perkembangan
gejala. Tujuan dari penelitian ini adalah untuk mendapatkan konstruksi gen AV1
pada vektor ekspresi dan mengintroduksikan transgen tersebut ke tanaman
tembakau menggunakan vektor bakteri Agrobacterium tumefaciens. Serangkaian
kegiatan untuk konstruksi gen telah dilakukan diantaranya adalah amplifikasi gen
AV1 Begomovirus menggunakan primer spesifik, transformasi ke bakteri E. coli
DH5α dan kloning gen tersebut ke vektor ekspresi pBI121. Eksplan potongan
daun dari tanaman tembakau yang ditumbuhkan secara in vitro ditransformasi
melalui ko-kultivasi dengan A. tumefaciens yang mengandung konstruksi gen
AV1. Hasil penelitian menunjukkan bahwa gen AV1-Begomovirus berhasil
diamplifikasi dan disisipkan ke dalam vektor ekspresi pBI121. Transformasi
genetik telah menghasilkan tanaman-tanaman transforman tembakau yang
membawa gen ketahanan terhadap kanamisin (gen nptII) dan tanaman-tanaman
tersebut telah diaklimatisasi di rumah kaca. Tanaman-tanaman putatif transgenik
tersebut diduga juga telah mengandung gen AV1-Begomovirus. Penelitian lebih
lanjut perlu dilakukan untuk melihat integrasi dan jumlah kopi dari transgen AV1
serta ekspresinya untuk memperoleh ketahanan terhadap infeksi Begomovirus.
Kata kunci: Gen AV1, Begomovirus, Nicotiana tabaccum, Agrobacterium
tumefaciens, protein selubung
71
Abstract
Infection of Begomovirus has caused leaf curl disease in tomato. This
infection has significantly impact on yield losses of tomato production. Recently,
there is no effectively way to control this disease. The use of resistant tomato
variety is the best way to control the virus. Genetic engineering technology gives
the opportunity to develop the transgenic plant resistant to Begomovirus through
pathogen derived resistance (PDR) approach. Begomovirus AV1 gene is a gene
expressing coat protein which responsible for particle encapsidation and have a
role in specivicity determinant of virus transmission and symptom developmment.
The objectives of this study were to construct the Begomovirus AV1 gene in
expression vector plasmid and to introduce the gene into tobacco plant genome
through A. tumefaciens vector. A series activites in gene cloning have conducted
include PCR amplification of AV1 gene using a pair of specific primer, bacterial
transformation of the gene into E. coli DH5α competent cell and cloning the gene
into expression vector plasmid pBI121. Leaf segments of in-vitro tobacco plant
were transformed by co-cultivation with A. tumefaciens containing ToLCV-AV1
construct. In this research, Indonesian Begomovirus AV1 gene was successfully
amplified and inserted in expression vector plasmid. Tobacco transformants
carrying kanamycin-resistant gene (nptII gene) were regenerated and established
in glasshouse. Those transformant plants are expected containing the AV1 gene.
Further experiment need to be conducted to study the integration and copy
number of AV1 transgene as well the expression to obtain the resistance against
virus infection.
Keywords: AV1 gene, Begomovirus, Nicotiana tabaccum, Agrobacterium
tumefaciens, coat protein
72
Pendahuluan
Serangan penyakit keriting daun pada tanaman tomat dan cabai yang
disebabkan oleh infeksi Tomato yellow leaf curl virus (TYLCV), salah satu
anggota Begomovirus telah laporkan di berbagai daerah di Indonesia (Aidawati et
al. 2005, Hidayat et al. 2006). Penurunan hasil akibat serangan penyakit keriting
daun pada tanaman tomat di daerah Bogor, Jawa Barat dan sekitarnya dilaporkan
dapat mencapai 50-70% (Sudiono et al. 2001). Selain itu, serangan penyakit
keriting daun ini dilaporkan dapat menyebabkan penurunan hasil hingga 50-100%
(AVRDC Centerpoint Newsletter – spring 2003 issue) dibandingkan dengan
tanaman tomat yang sehat.
Beberapa pendekatan telah dilakukan untuk mengendalikan Begomovirus
yang menginfeksi tanaman tomat, tetapi hanya sedikit yang terbukti efektif. Usaha
untuk mengendalikan kutu kebul secara biologi juga telah dilakukan, akan tetapi
hasilnya tidak memuaskan (Mason et al. 2000) Sampai saat ini belum ada bahan
kimia yang dapat diaplikasikan secara langsung untuk mengendalikan penyakit
yang disebabkan oleh virus tersebut. Penggunaan varietas tahan merupakan cara
yang tepat untuk mengendalikan virus karena metode ini relatif lebih aman dan
murah apabila dibandingkan dengan metode pengendalian yang lain (Polston &
Anderson 1997; Hanson et al. 2000; Mason et al. 2000).
Usaha untuk memperoleh ketahanan genetik terhadap Begomovirus
terutama untuk TYLCV telah dilakukan. Beberapa peneliti telah mencari gen-gen
ketahanan dan toleransi terhadap TYLCV di antara spesies Lycopersicon liar dan
telah menemukan beberapa gen yang menjanjikan, diantaranya pada spesies L.
chilense Dun, L. pimpinellifolium (Jusl.) Mill, L. hirsutum Dun dan L. peruvianum
(L.) Mill (Zakay et al. 1991; Kasrawi et al. 1998; Pico et al. 1998; Vidavsky &
Czosnek 1998). Akan tetapi, melalui pemuliaan konvensional hanya beberapa
galur dan varietas saja yang telah dihasilkan. Padahal, di daerah sentra produksi
tomat di beberapa negara di dunia, tanaman tomat yang dikembangkan masih
sangat rentan terhadap berbagai Begomovirus (Mason et al. 2000). Selain itu,
kultivar-kultivar yang toleran justru mendukung replikasi virus dan dapat menjadi
sumber inokulum untuk tanaman-tanaman yang rentan (Lapidot et al. 2001).
73
Untuk kasus Indonesia, sumber gen ketahanan untuk mengendalikan Begomovirus
belum ditemukan pada koleksi plasma nutfah tomat. Oleh karena itu, diperlukan
pendekatan lain untuk pengembangan kultivar tomat tahan penyakit keriting yang
disebabkan oleh Begomovirus.
Sebuah konsep ketahanan yang berasal dari patogen (pathogen-derived
resistance, PDR) yang dapat digunakan untuk pengembangan varietas tomat tahan
penyakit keriting (Sanford & Johnson 1985; Dasgupta et al. 2003). Pendekatan
PDR ini memanfaatkan elemen genetik yang dapat berupa gen utuh atau bagian
gen dari genom virus kemudian diklon dan digabungkan dengan sekuen
pengendali (promoter dan terminator) dan diintroduksikan ke tanaman melalui
transformasi genetik tanaman, sehingga akan mempengaruhi satu atau beberapa
tahap penting dalam siklus hidup virus. Pemanfaatan gen selubung protein (coat
protein gene) merupakan salah satu contoh dari pendekatan PDR ini
(Bendahmane et al. 1997; Sinisterra et al. 1999; Vidya et al. 2000; Raj et al.
2005).
Gen AV1 menyandikan protein selubung (coat protein) dan merupakan
gen-gen yang terletak pada utas viral-sense dari Begomovirus monopartite
termasuk Tomato (yellow) leaf curl virus (Horrison BD 1985). Produksi protein
selubung diregulasi oleh gen AC2. Protein selubung mempunyai beberapa fungsi
dan merupakan dasar dari metode serologi untuk deteksi dan identifikasi
Begomovirus. Gen penyandi protein selubung virus (AV1) diisolasi dari virus
untuk memperoleh resistensi non-konvensional terhadap virus dan telah terbukti
efektif untuk mengendalikan geminivirus pada tanaman (Sinisterra et al. 1999;
Raj et al. 2005).
Analisis fungsional ekspresi gen AV1 Begomovirus untuk memperoleh
tanaman tomat tahan terhadap virus dapat dilakukan dengan mengintegrasikan gen
AV1 ke dalam genom dan meregenerasikan tanaman transgenik. Tanaman
tembakau merupakan tanaman model yang dapat digunakan untuk mempelajari
tujuan tersebut karena regenerasi tanaman tembakau sangat mudah dilakukan.
Selain itu, tanaman tembakau juga merupakan salah satu inang dari Begomovirus
sehingga mempermudah untuk pengujian ekspresi gen melalui infeksi virus
(Lazarowitz & Lazdins 1991). Beberapa penelitian untuk mempelajari gen-gen
74
dari virus untuk memperoleh sifat ketahanan telah dilakukan (Pascal et al. 1993;
Sinisterra et al. 1999; Mubin et al. 2007).
Tujuan penelitian ini adalah mendapatkan konstruksi gen AV1
Begomovirus pada plasmid vektor ekspresi dan mengintroduksikan transgen
tersebut ke tanaman tembakau menggunakan vektor bakteri Agrobacterium
tumefaciens.
Bahan dan Metode
A. Konstruksi gen AV1 ke dalam plasmid vektor ekspresi
Amplifikasi gen AV1 dengan primer spesifik
Gen AV1 Begomovirus dari isolat Brastagi dan Kaliurang diamplifikasi
menggunakan teknik PCR mengikuti prosedur yang dikembangkan oleh
Laboratorium Virologi, AVRDC, Taiwan. Amplifikasi gen AV1 dilakukan
menggunakan sepasang primer spesifik gen AV1 (CPPROTEIN-V1 dan
CPPROTEIN-C1). Urutan basa dari primer CPPROTEIN-V1 adalah 5’-
TAATTCTAGATGTCGAAGCGACCCGCCGA-3’ (mengandung situs enzim
XbaI, ditandai dengan garis bawah) dan primer CPPROTEIN-C1 adalah 5’-
GGCCGAATTCTTAATTTTGAACAGAATCA-3’ (mengandung situs enzim
EcoRI). Ukuran produk amplifikasi PCR dari gen AV1 adalah 780 bp. Reaksi
amplifikasi dilakukan dengan total volume 25 ul mengandung 2-5 ul DNA
cetakan, dNTPs dengan konsentrasi 25 µM, primer F dan R masing-masing
dengan konsentrasi 0,2 uM, MgCl2 dengan konsentrasi 1,5 mM, enzim Taq DNA
polymerase 0,15 unit dalam larutan buffer 1X (20mM Tris-HCl pH 8.0, 100mM
KCl, 0,1mM EDTA, 1mM DTT, 50% glycerol, 0,5%, Tween 20, dan 0,5%
nonidet P40). Reaksi amplifikasi dilakukan dengan mesin PCR (MJ Research)
dengan program sebagai berikut: denaturasi pada suhu 940C selama 1 menit,
penempelan primer pada suhu 550C selama 2 menit, dan pemanjangan/sintesis
DNA pada suhu 720C selama 2 menit. Tahapan program PCR tersebut diulang
sebanyak 30 siklus. Pada tahap terakhir proses PCR dilakukan pemanjangan akhir
pada suhu 720C selama 10 menit. Setelah proses PCR selesai, sampel disimpan di
kulkas dengan suhu 40C atau langsung dianalisis dengan gel elektroforesis.
75
Purifikasi dan elusi fragmen DNA hasil PCR
Hasil amplifikasi PCR sebanyak 25 ul di elektroforesis dalam 1% gel
agarosa dengan bufer TBE 0,5X. Dengan pewarnaan pada etidium bromida, pita
DNA diambil dari gel dibawah sinar ultraviolet. Kemudian potongan gel
dipurifikasi menggunakan “S.N.A.P DNA purification kit” (Invitrogen) dan dielusi
menggunakan 40 ul air steril.
Ligasi fragmen DNA pada vektor pGEM-T easy
Sebanyak 3 ul DNA produk PCR yang telah dipurifikasi diligasikan
dengan 1 ul vektor pGEM-T easy (50 ng/ul) dengan bantuan 1 ul enzim T4 DNA
ligase (3 u/ul) dan 5 ul 2x ligation buffer. Selanjutnya campuran diinkubasi pada
suhu 40C selama satu malam.
Transformasi plasmid rekombinan pada bakteri E. coli DH5αααα
Plasmid rekombinan hasil ligasi kemudian ditransformasi ke dalam bakteri
E. coli DH5α dengan metode CaCl2 (heat shock) dari Sambrook et al. (1989).
Sebanyak 200 ul sel kompeten segar (E. Coli DH5α) ditambahkan dengan 10 ul
plasmid hasil ligasi dan diinkubasi di dalam es selama 30 menit, kemudian diberi
kejutan panas pada suhu 420C selama 90 detik dan diinkubasi kembali dalam es
selama 2 menit. Campuran tersebut dijadikan volume akhir 1 ml dengan ditambah
media LB cair (Luria Bertani) sebanyak 800 ul dan digoyang pada suhu 370C
selama 1 jam. Setelah itu, campuran disentrifugasi dan diambil supernatannya
sebanyak 800 ul. Pelet bakteri kemudian dilarutkan kembali pada media cair yang
tersisa (200 ul) dan disebar merata di atas media agar padat yang mengandung
antibiotik ampisilin 50 mg/ml dan diinkubasi pada suhu 370C selama 16 jam.
Koloni bakteri yang terbentuk ditumbuhkan pada 3 ml media LB cair yang
mengandung 50 mg/ml ampisilin dan digoyang pada suhu 370C selama satu
malam.
Isolasi dan verifikasi plasmid dengan enzim restriksi
Isolasi DNA plasmid dari kultur cair bakteri dilakukan dengan metode lisis
alkali (Sambrook et al. 1989). DNA palsmid yang diperoleh kemudian diuji
dengan enzim restriksi untuk konfirmasi keberhasilan penyisipan gen AV1. Untuk
mengidentifikasi fragmen sudah tersisip ke dalam plasmid maka dilakukan
76
verifikasi plasmid dengan memotong plasmid menggunakan enzim restriksi.
Enzim yang digunakan adalah EcoRI. Komposisi reaksi digesti adalah 10x buffer
(2 ul), DNA plasmid (10 ul), enzim EcoRI 1 unit/ul (1 ul) dan air steril (7 ul)
dengan total volume 20 ul. Campuran kemudian diinkubasi pada suhu 370C
selama 2 jam dan hasil pemotongan dielektroforesis pada 1% gel agarosa.
Fragmen sisipan dimurnikan dari gel dan dielusi kembali dengan air steril.
Kloning gen AV1 pada vektor ekspresi
Fragmen gen AV1 diperoleh dari pemotongan klon pGEM-T easy/AV1
dengan enzim XbaI-SacI dan disisipkan ke vektor ekspresi pBI121 yang dipotong
dengan enzim yang sama. Hasil ligasi ditransformasikan ke bakteri E. coli DH5α
dan diseleksi dengan antibiotik kanamisin (100 mg/l). Koloni yang terbentuk
ditumbuhkan kembali pada media LB cair dan diisolasi DNA plasmidnya serta
diverifikasi kembali dengan enzim restriksi yang sesuai. Proses pemotongan dan
ligasi dilakukan sesuai dengan prosedur sebelumnya.
Transformasi DNA rekombinan ke Agrobacterium tumefaciens
DNA rekombinan ditransfromasikan ke bakteri Agrobacterium
tumefaciens strain LBA4404 menggunakan elektroforator (Biorad) dengan
prosedur sesuai dengan petunjuk dari manufaktur. Koloni bakteri yang tumbuh
pada media YEP diisolasi DNA plasmidnya, diverifikasi dengan enzim restriksi
untuk meyakinkan bahwa A. tumefaciens telah membawa plasmid rekombinan
yang benar. Konstruksi plasmid yang benar siap diintroduksikan ke genom
tanaman.
B. Introduksi gen AV1 ke tembakau dengan vektor A. tumefaciens
Persiapan suspensi bakteri A. tumefaciens strain LBA4404
Bakteri Agrobacterium yang membawa konstruksi gen AV1 ditumbuhkan
pada media YEP padat yang mengandung 100 mg/l kanamisin selama 2 hari
sebelum digunakan. Koloni tunggal bakteri diambil dari cawan petri dan
ditumbuhkan pada 5 ml media YEP cair + 100 mg/l kanamisin. Bakteri diinkubasi
pada 280C selama satu malam dengan penggoyangan 200 rpm. Kultur bakteri
diencerkan dengan media MSO cair hingga konsentrasi 0,5 pada OD 600.
77
Persiapan eksplan potongan daun tembakau secara in vitro dan ko-kultivasi
Daun tembakau yang berukuran 2,5–3,5 cm diambil dari perkecambahan
in vitro dan dipotong-potong melintang menjadi 2-3 potongan persegi untuk
digunakan sebagai eksplan. Sebanyak 15-20 eksplan direndam dalam suspensi
bakteri Agrobacterium pada cawan petri yang mengandung 30 mM asetosiringon
selama 30 menit. Eksplan ditanam pada media ko-kultivasi (MS0 dengan vitamin
B5 + 100 mM asetosiringon + 30 g/l sukrosa + 3 g/l phytagel dan pH 5.7) dan
dikulturkan selama 3 hari pada suhu 270C di ruang gelap.
Seleksi dan regenerasi eksplan setelah transformasi
Eksplan dipindahkan ke media seleksi (MS dengan vitamin B5 + 0,1 mg/l
NAA dan 1 mg/l BA + sukrosa 30 g/l + phytagel 3 g/l dan pH 5.7) dengan
penambahan 100 mg/l kanamisin, 50 mg/l cefotaksim dan 500 mg/l karbenisilin.
Komposisi media dasar MS ada pada Lampiran 2. Kultur pada media seleksi
diinkubasi pada ruang kultur dengan suhu 270C dengan fotoperiodisitas cahaya 16
jam terang/8 jam gelap. Eksplan disub-kultur setiap 2 minggu. Eksplan/Kalus
yang bertunas dipindahkan ke media pemanjangan tunas (MS dengan vitamin B5
+ 0,1 mg/l BA + sukrosa 30 g/l + phytagel 3 g/l dan pH 5,7) dengan penambahan
100 mg/l kanamisin, 50 mg/l cefotaksim dan 500 mg/l karbenisilin.
Perakaran tunas transforman
Tunas yang terbentuk pada media pemanjangan tunas dipisahkan dari
kalus dan dipindahkan ke media perakaran (1/2MS + Km100Cb100Ct50 +
sukrosa 30 g/l + phytagel 3 g/l dan pH 5,7) pada botol selai. Planlet yang
terbentuk siap untuk dipindahkan ke pot.
Isolasi DNA genom total tanaman tembakau transgenik putatif.
Isolasi DNA genom total tanaman temabakau transgenik putatif T0
menggunakan metode yang dikembangkan oleh Doyle & Doyle (1990) yang telah
dimodifikasi dengan penambahan 2% polyvinil pyrolidone (PVP). Sebanyak 3 g
daun tanaman dilembutkan dan ditambahkan dengan 700 µl bufer ekstraksi (20
mM EDTA, 100 mM Tris-HCl pH 8.0, 1.4 M NaCl, 2% CTAB, 2% PVP, dan
0.2% Mercaptoetanol) dan diinkubasi selama 15 menit pada penangas air 650C.
Selanjutnya ditambahkan larutan fenol-kloroform-isoamilalkohol (25:24:1) (v/v/v)
78
sebanyak 700 µl. Tabung dibolak-balik secara hati-hati selama 5 menit. Suspensi
disentrifugasi selama 15 menit dengan kecepatan 12000 rpm. Supernatan diambil
dan ditambahkan dengan 1/10x volume 3M Natrium asetat dan 0.7x volume
isopropanol dingin dan dibolak-balik perlahan-lahan. Untuk mengendapkan DNA
dilakukan sentrifugasi selama 10 menit pada kecepatan 12000 rpm. Endapan DNA
dicuci dengan ethanol 70% dan disentrifugasi kembali selama 5 menit pada 12000
rpm. Setelah itu pelet DNA dikeringkan dan dilarutkan kembali dengan bufer TE
1x. Suspensi DNA yang sudah larut siap digunakan untuk cetakan dalam proses
PCR.
Amplifikasi gen nptII pada tanaman transgenik tembakau dengan PCR
Amplifikasi gen nptII pada genom tanaman tembakau transgenik putatif
T0 dilakukan dengan menggunakan primer spesifik. Amplifikasi PCR dilakukan
pada volume total reaksi 25 µl yang mengandung 2-5 ul DNA genomik cetakan,
dNTPs dengan konsentrasi 25 µM, sepasang primer spesifik masing-masing
dengan konsentrasi 0,2 uM, MgCl2 dengan konsentrasi 1,5 mM, enzim Taq DNA
polymerase 0.15 unit dalam larutan bufer 1X. Setiap reaksi dilakukan pada tabung
mikro 200 ul. Reaksi amplifikasi dilakukan dengan program sebagai berikut:
denaturasi awal pada suhu 940C selama 5 menit sebanyak 1 siklus, denaturasi
pada suhu 940C selama 30 detik, penempelan primer pada suhu 55
0C selama 1
menit, dan pemanjangan/sintesis DNA pada suhu 720C selama 2 menit. Tahapan
PCR diulang sebanyak 35 kali. Pada tahap terakhir proses PCR dilakukan
pemanjangan akhir pada suhu 720C selama 5 menit sebanyak 1 siklus. Selain
DNA sampel, juga digunakan DNA plasmid pBI-CP sebagai kontrol positif (+)
dan DNA tanaman tembakau non transgenik serta air (tanpa DNA cetakan)
masing-masing digunakan sebagai kontrol negatif (-). Setelah proses PCR selesai,
sampel produk PCR dielektroforesis dengan gel agarosa.
79
Hasil
A. Konstruksi gen AV1 ke dalam vektor ekspresi
Amplifikasi PCR menggunakan asam nukleat total tanaman dan primer
spesifik gen AV1 Begomovirus dari isolat Kaliurang (CP8) dan Brastagi (CP11)
menghasilkan fragmen DNA berukuran 780 bp (Gambar 17a). Pemilihan isolat ini
berdasarkan dari hasil percobaan sebelumnya dimana kedua isolat tersebut
mewakili dua kelompok yang berbeda dari hasil analisis filogenetik delapan isolat
Begomovirus.
Fragmen gen AV1 hasil amplifikasi diklon ke vektor pGEM-T easy
(Promega) yang merupakan vektor untuk kloning fragmen DNA hasil PCR.
Tujuan pengklonan fragmen gen AV1 ke pGEM-T easy adalah untuk menyimpan
fragmen DNA sehingga mempermudah di dalam perbanyakan fragmen dan
pemilihan ensim restriksi yang sesuai untuk kloning. Setelah ditransformasi ke
bakteri E. coli DH5α, plasmid rekombinan pCP8 dan pCP11 diisolasi dari koloni
tunggal bakteri yang terbentuk. Jumlah koloni tunggal yang terbentuk setelah
transformasi adalah sebanyak 68 koloni untuk CP8 dan 17 koloni untuk CP 11.
Gambar 17 Elektroforesis pada gel agarosa 1%. (a) produk amplifikasi gen AV1
dari dua isolat Begomovirus (CP 8 dan CP11) menggunakan primer
spesifik CPPROTEIN-V1 dan CPPROTEIN-C1. (b) DNA plasmid
rekombinan pCP8 (1-6) dan pCP11 (1-6) hasil isolasi dari koloni
tunggal bakteri E. coli DH5α
Gen AV1
780 bp
1000 bp
850
650
500
CP
8
1 K
b
plu
s
CP
11
4000 bp
3000
2000
1600
1000
650
pC
P8-1
1 K
b
plu
s
pC
P8-2
pC
P8-3
pC
P8-4
pC
P8-5
pC
P8-6
pC
P11-1
pC
P11-2
pC
P11-3
pC
P1
1-4
pC
P1
1-5
pC
P1
1-6
pG
EM
-T e
asy
a b
80
Sebanyak 12 koloni bakteri yang terdiri dari 6 koloni pCP8 (pCP8-1,
pCP8-2, pCP8-3, pCP8-4, pCP8-5, dan pCP8-6) dan 6 koloni pCP11 (pCP11-1,
pCP11-2, pCP11-3, pCP11-4, pCP11-5, dan pCP11-6) dipilih untuk
memverifikasi plasmid rekombinan yang membawa gen AV1. Ternyata dari 12
koloni bakteri tersebut hanya 1 koloni yang tidak membawa plasmid rekombinan,
yaitu koloni pCP8-6 (Gambar 17b).
Untuk mendapatkan fragmen gen AV1 dan vektor ekspresi pBI121
mempunyai ujung yang kohesif sebelum diligasikan maka gen AV1 yang telah
diklon pada pGEM-T dipotong dengan 2 enzim restriksi XbaI dan SacI. Demikian
juga dengan vektor ekspresi pBI121. Enzim restriksi XbaI dan SacI hanya akan
memotong pada bagian gen GUS pada vektor plasmid pBI121 namun elemen
promoter 35S CaMV dan terminator NOS masih ada (Gambar 18). Bagian gen
GUS yang dipotong inilah nanti yang akan digantikan oleh gen AV1.
Pemotongan plasmid pCP8 dan pCP11 dengan enzim XbaI dan SacI dapat
menggambarkan orientasi dari sisipan gen AV1 pada pGEM-T easy (Gambar 19).
Dari 7 plasmid rekombinan yang dipotong dengan enzim restriksi terdapat lima
plasmid yang membawa gen AV1 dengan orientasi yang diinginkan yaitu pCP8-1,
pCP8-3, pCP8-4, pCP11-8, dan pCP11-11. Dua plasmid yang lain (pCP8-2 dan
pCP11-7) membawa gen AV1 dengan orientasi yang terbalik sehingga ketika
dipotong dengan enzim XbaI dan SacI tidak menghasilkan fragmen gen AV1.
Gambar 18 Peta plasmid biner pBI121 yang membawa gen pelapor gus dan gen
marker nptII pada struktur T-DNAnya
GUS
pBI 121 13950 bp
81
Gambar 19 Elektroforesis fragmen gen AV1 yang dipotong dari vektor pGEM-T
easy dan fragmen gen GUS dari vektor ekspresi pBI121 dengan
enzim restriksi XbaI dan SacI pada gel agarosa 1%. AV1 = fragmen
gen AV1 yang berukuran 780 bp; GUS = fragmen gen GUS yang
berukuran 2000 bp.
Selanjutnya hasil ligasi antara fragmen sisipan (gen AV1 atau gen GUS)
dan vektor pBI121 ditransformasi ke bakteri E. coli DH5α. Jumlah koloni yang
terbentuk pada transformasi plasmid rekombinan hasil ligasi antara gen AV1 dan
vektor ekspresi pBI121 adalah sebanyak 12 koloni untuk pBI121/AV1-CP8 dan
16 koloni untuk pBI121/AV1-CP11. Setelah diperoleh DNA plasmid dari koloni
tunggal bekteri hasil transformasi, dilakukan verifikasi untuk memilih plasmid
rekombinan yaitu memiliki gen AV1 sebagai sisipannya.
Dari delapan koloni tunggal yang mengandung plasmid rekombinan
diperoleh empat plasmid rekombinan yang mengandung sisipan gen AV1, masing-
masing 2 plasmid rekombinan dari CP8 (pCP8-1-2 dan pCP8-1-3) dan 2 plasmid
dari CP11 (pCP11-8-1 dan pCP11-8-2) (Gambar 20). Dari plasmid rekombinan
tersebut dapat dibuat peta plasmid yang baru (Gambar 21). Plasmid rekombinan
tersebut telah berhasil ditransformasi ke bakteri A. tumefacies dan menghasilkan
koloni tunggal bakteri yang siap digunakan untuk transformasi genetik tanaman
tembakau.
pB
I12
1
12000 bp
3000
2000
1600
1000
500
100
GUS
AV1 AV1 AV1 AV1 AV1
pC
P8
-1
pC
P8
-2
pC
P8
-3
pC
P8
-4
pC
P1
1-7
pC
P1
1-8
pC
P1
1-1
1
1 K
b p
lus
82
Gambar 20 Elektroforesis hasil verifikasi insersi fragmen gen AV1 dengan enzim
restriksi XbaI dan SacI. Fragmen gen GUS ditandai dengan pita DNA
berukuran 2000 bp dan fragmen gen AV1 ditandai dengan pita DNA
berukuran 780 bp.
Gambar 21 Peta konstruksi plasmid biner pBI-CP yang membawa gen AV1
Begomovirus dengan promoter 35S-CaMV dan terminator nos, dan
gen marker nptII pada struktur T-DNA
12000 bp
3000
2000 1600
1000
500
100
Gen GUS
2000 bp
Gen AV1
780 bp
pB
I121
pC
P8-1
-1
pC
P8-1
-2
pC
P8-1
-3
pC
P8-1
-4
pC
P11-8
-1
pC
P11-8
-2
pC
P11-8
-4
1 K
b p
lus
pC
P11-8
-3
83
B. Introduksi gen AV1 ke tembakau dengan vektor A. tumefaciens
Introduksi gen AV1-Begomovirus ke tanaman tembakau melalui tahapan
transformasi genetik dengan bantuan vektor A. tumefaciens (Gambar 22)
dilakukan 4 kali (dua kali untuk masing-masing konstruksi gen CP8/AV1 dan
CP11/AV1). Transformasi dilakukan dengan jumlah total eksplan sebanyak 273
potongan daun. Dari empat kali transformasi dihasilkan sebanyak 1593 tunas yang
tahan pada media seleksi yang mengandung antibiotik kanamisin 100 mg/l dengan
rerata tunas per eksplan adalah sebesar 5,84. Setelah dipindahkan ke media
perakaran dan diaklimatisasi diperoleh sebanyak 1399 planlet yang tahan
kanamisin dengan rerata planlet per eksplan adalah 5,12 (Tabel 7). Dari data yang
diperoleh, rerata persentase keberhasilan tunas menjadi planlet adalah sebesar
88,52%.
Tabel 7 Jumlah tunas dan planlet yang dihasilkan serta persentase tunas menjadi
planlet pada transformasi genetik tembakau dengan gen AV1
Begomovirus melalui vektor A. tumefaciens
Konstruksi
gen
Transf.
ke -
Jumlah
eksplan
Jumlah
tunas*
Jumlah
planlet**
%-ase tunas
menjadi
planlet***
1 62 332 (5,44) 298 (4,88) 89,76 CP8/AV1
2 62 323 (5,38) 290 (4,83) 89,78
1 90 627 (7,29) 532 (6,18) 84,85 CP-11/AV1
2 59 311 (5,36) 279 (4,81) 89,71
Total 273 1593 1399 -
Rerata 68,25 398, 25(5,84) 349,75 (5,12) 88,52
* Angka dalam kurung menunjukkan jumlah tunas/eksplan
** Angka dalam kurung menunjukkan jumlah planlet/eksplan
*** Persentase tunas menjadi planlet dihitung berdasarkan jumlah planlet yang
terbentuk dibagi dengan jumlah tunas yang terbentuk dikalikan dengan 100%
84
Gambar 22 Transformasi genetik tembakau dengan gen AV1 melalui vektor A.
tumefaciens. (a) Tanaman tembakau in vitro sebagai sumber eksplan,
(b) Eksplan potongan daun pada media induksi kalus yang
mengandung kanamisin 100 mg/l setelah ko-kultivasi dengan bakteri
A. tumefaciens, (c) Eksplan mulai memperlihatkan adanya
pertumbuhan tunas, (d) Eksplan dengan tunas-tunas yang muncul di
tempat pelukaan, (e) Eksplan tidak ditransformasi yang ditumbuhkan
pada media seleksi kanamisin 100 mg/l, (f) Tunas-tunas hasil
transformasi pada media perakaran, (g) Tunas-tunas yang sudah
berakar pada media perakaran di tabung reaksi, (h) Tunas-tunas yang
sudah berakar pada media perakaran di botol, (i) Planlet yang sudah
diaklimatisasi pada media tanah pada bak plastik
a b c
d e f
g h i
85
Analisis PCR untuk deteksi gen ketahanan terhadap kanamisin nptII
Amplifikasi gen nptII dengan PCR pada 46 tanaman tembakau transgenik
putatif generasi T0 menggunakan primer spesifik menghasilkan 35 tanaman yang
mengandung gen nptII (Gambar 23). Hal ini diindikasikan dengan terbentuknya
pita DNA berukuran sekitar 250 bp. Persentase tanaman yang mengandung gen
nptII dibandingkan dengan jumlah total tanaman yang dianalisis adalah sebesar
76,1%. Pada kontrol negatif yang digunakan (tanaman tembakau yang tidak
ditransformasi dan air) tidak menunjukkan adanya pita hasil amplifikasi (250 bp)
(Gambar 23). Hal tersebut menunjukkan bahwa prosedur teknik PCR yang
digunakan untuk amplifikasi gen nptII sudah benar dan tidak terdapat kontaminasi
oleh DNA dari sampel yang diuji atau DNA dari sumber yang lain.
Gambar 23 Elektroforesis gel hasil amplifikasi gen nptII pada 46 tanaman
tembakau transgenik putatif generasi T0 menggunakan primer PCR
spesifik. Kolom no 1-46 = sampel tanaman, K− = tembakau non
transforman, A = Air, + = Plasmid, M = 1 Kb plus ladder (In
vitrogen)
21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 K- M A + 41 42 43 44 45 46
nptII
500 bp
100
300
17 18 19 20 K- M A +
nptII 500 bp
100
300
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16
86
Pembahasan
Salah satu komponen penting di dalam mempelajari ekspresi suatu gen
adalah kegiatan kloning dan konstruksi dari gen yang akan diekspresikan tersebut.
Pada penelitian ini, gen yang akan dikloning dan dikonstruksi adalah gen AV1
yaitu gen yang mengekspresikan protein selubung. Protein selubung adalah suatu
protein yang berperan di dalam penentuan spesifisitas penularan virus (Briddon et
al. 1990) dan perkembangan gejala (Gardiner et al. 1988). Berdasarkan kenyataan
ini, maka melalui strategi pendekatan pathogen derived resistance (PDR) gen AV1
dapat digunakan untuk mentransformasi tanaman inang sehingga memberikan
proteksi terhadap infeksi Begomovirus.
Pada penelitian ini, gen AV1 dari dua isolat begomovirus yaitu isolat
Kaliurang (diberi kode CP-8) dan isolat Brastagi (diberi kode CP-11) telah
berhasil diamplifikasi menggunakan primer spesifik yang didesain untuk
mengamplifikasi gen tersebut. Keberhasilan ini ditandai dengan diperolehnya
amplikon yang berukuran sekitar 780 pasangan basa (Gambar 25). Untuk
memfasilitasi pemilihan enzim restriksi yang akan digunakan untuk kloning gen
AV1 pada vektor ekspresi maka amplikon gen AV1 tersebut dikloning ke dalam
suatu vektor kloning pGEM-T easy (Promega). Vektor kloning ini mempunyai
beberapa keuntungan, diantaranya adalah 1) dapat digunakan untuk mengkloning
fragmen hasil PCR yang menggunakan enzim DNA polymerase tertentu yang
akan menghasilkan fragmen dengan ujungnya mempunyai ekor basa A dimana
vektor pGEM-T mempunyai ujung T, 2) vektor ini juga mempunyai polycloning
site yang akan mempermudah di dalam pemilihan enzim restriksi untuk kloning.
3) Vektor ini juga merupakan plasmid yang memiliki kemampuan propagasi
tinggi sehingga sangat membantu di dalam perbanyakannya pada sel kompeten
seperti E. coli.
Untuk melihat ekspresinya, gen AV1 disisipkan pada vektor ekspresi
pBI121 (Clontech Labs Inc., Palo Alto, CA) yang merupakan vektor ekspresi
konstitutif untuk tanaman yang mengandung gen neomycinphospho-transferase II
(nptII) untuk seleksi dan gen pelapor β-glucuronidase (gus). Konstruksi gen
dilakukan dengan memotong dan mengganti gen pelapor gus yang berukuran
87
2000 bp dengan gen AV1 yang berukuran sekitar 780 bp. Proses ligasi standar atau
klasik dilakukan dengan cara menggabungkan satu fragmen DNA sisipan linier ke
satu DNA vektor (Sambrook et al. 1989). Pada penelitian ini, pendekatan ligasi
yang dilakukan adalah dengan ”competition approach” dimana ada dua gen
sisipan yang digabungkan dengan satu DNA vektor. Dalam hal ini, gen AV1 dan
gen gus akan berkompetisi untuk berligasi pada vektor ekspresi pBI121. Ini
dilakukan dengan cara meligasikan vektor ekspresi pBI121 (yang sebelumnya
telah dipotong dengan enzim XbaI dan SacI) dengan fragmen gen AV1. Skrining
plasmid rekombinan dilakukan dengan memotong kembali plasmid dengan enzim
XbaI dan SacI. Plasmid rekombinan yang diinginkan akan mudah teridentifikasi
karena fragmen gen AV1 (780 bp) dan gus (2000 bp) mempunyai ukuran yang
berbeda (Gambar 20).
Untuk mempelajari ekspresi gen AV1 dari Begomovirus yang
menyandikan protein selubung di dalam hubungannya dengan ketahanan terhadap
penyakit keriting daun maka gen AV1 diintroduksikan ke dalam genom tanaman
tembakau. Integrasi gen AV1 ke dalam tanaman model ini diharapkan akan
memberikan informasi mengenai keefektifan gen tersebut untuk mengendalikan
penyakit keriting daun yang disebabkan oleh infeksi Begomovirus tersebut.
Tanaman model tembakau selama ini telah terbukti efektif untuk kegiatan
rekayasa genetika karena tanaman tersebut mempunyai kompetensi regenerasi dan
transformasi yang tinggi. Selain itu, tanaman tembakau juga merupakan salah satu
tanaman inang yang dapat diinfeksi oleh Begomovirus sehingga akan
memudahkan di dalam pengujian ketahanan terhadap virus. Beberapa penelitian
yang mempelajari ekspresi gen untuk ketahanan terhadap virus melalui
transformasi genetik menggunakan tanaman tembakau telah dilaporkan (Pascal et
al. 1993; Sinisterra et al. 1999; Mubin et al. 2007).
Hasil penelitian ini menunjukkan bahwa tanaman tembakau mempunyai
kompetensi transformasi dan regenerasi yang tinggi. Kompetensi transformasi
diindikasikan oleh tingginya jumlah tunas yang dihasilkan pada media seleksi
yang mengandung antibiotik kanamisin 100 mg/l dengan rerata jumlah tunas per
eksplan adalah 5,84 (Tabel 7). Kompetensi regenerasi tanaman tembakau yang
tinggi diindikasikan oleh kemampuan eksplan beregenerasi membentuk tunas dan
88
akhirnya tumbuh menjadi planlet dengan persentase tunas menjadi planlet adalah
88,52% (Tabel 7). Perlakuan transformasi dengan bakteri A. tumefaciens dan
tekanan seleksi dari antibiotik kanamisin (100 mg/l) pada media regenerasi tidak
mempengaruhi kemampuan eksplan untuk membentuk tunas.
Salah satu parameter keberhasilan dari teknik transformasi adalah
tersisipnya gen yang diinginkan ke dalam genom tanaman. Untuk mendeteksi
keberadaan gen pada tanaman transgenik putatif dapat dilakukan dengan analisis
molekuler, salah satunya menggunakan teknik PCR. Meskipun teknik ini belum
menjamin bahwa transgen telah terintegrasi ke dalam genom tanaman namun
teknik ini dapat digunakan untuk skrining awal secara cepat tanaman transgenik
putatif. Pada penelitian ini, telah berhasil dideteksi tanaman tembakau transgenik
putatif yang membawa gen ketahanan terhadap kanamisin dengan teknik PCR
menggunakan primer spesifik gen nptII. Gen nptII ini berada satu konstruksi
dengan gen AV1 pada T-DNA, sehingga diharapkan tanaman yang terdeteksi
membawa gen nptII juga membawa gen AV1.
Tanaman yang diperoleh dari hasil transformasi genetik menggunakan gen
AV1 selanjutnya perlu untuk dikonfirmasi keberadaan, integrasi dan jumlah kopi
dari transgen yang diintroduksikan menngunakan teknik molekuler seperti teknik
PCR dan Southern Blot, meskipun planlet-planlet merupakan planlet-planlet yang
putatif transgenik karena telah lolos pada media seleksi. Selain itu, ekspresi dari
gen yang sudah terintegrasi pelu diuji dengan menggunakan virus target sehingga
akan diketahui tingkat efektifitas dari gen yang telah disisipkan.
Simpulan
1. Gen AV1 dari isolat Begomovirus yang berukuran sekitar 780 telah dapat
diamplifikasi dan dikonstruksi pada vektor ekspresi untuk digunakan dalam
transformasi genetik.
2. Transfomasi genetik tanaman tembakau dengan gen AV1 menggunakan vektor
bakteri A. tumefaciens telah menghasilkan transforman-transforman yang
membawa gen ketahanan terhadap kanamisin (gen nptII).
89
Daftar Pustaka
Aidawati N, Hidayat SH, Suseno R, Hidayat P, Sujiprihati S. 2005. Identifikasi
geminivirus yang menginfeksi tomat berdasarkan pada teknik Polymerase
Chain Raction-Restriction Fragment Length Polymorphism. J Mikrobiol
Indones 10:29-32
AVRDC Centerpoint newsletter-spring 2003 issue
Bendahmane M, Fitchen JH, Zhang G, Beachy RN. 1997. Studies of coat protein-
Mediated Resistance to tobacco mosaic Tobamovirus: Correlation between
assembly of mutant coat proteins and resistance. J Virol 71(10): 7942-
7950
Briddon RW, Pinner MS, Stanley J, Markham PG. 1990. Geminivirus coat protein
gene replacement alters insect specificity. Virol 177:85-94
Dasgupta I, Malathi VG, Mukherjee. 2003. Genetic engineering for virus
resistance. Current Scim 8(3): 341-354
Gardiner WE, Sunter G, Brand L, Elmer JS, Rogers SG, Bisaro DM. 1988.
Genetic analysis of tomato golden mosaic virus: The coat protein is not
required for systemic spread or symptom development. Eur Mol Biol
Organ J 7:899-904
Hanson P, Bernacchi, DM, Green S, Tanksley SD, Muniyappa V, Padmaja AS,
Chen HM, Kuo G, Fang D, Chen JT. 2000. Mapping a Wild Tomato
Introgression Associated with Tomato Yellow Leaf Curl Virus Resistance
in Cultivated Tomato Line. J. Amer. Soc. Hort. Sci. 125(1):15-20
Harrison BD. 1985. Advances in geminivirus research. Ann Rev Phytopathol 23:
55-82.
Hidayat SH, Chatchawankanpanich O, Rusli E, Aidawati N. 2006. Begomovirus
associated with pepper yellow leaf curl disease in west Java, Indonesia. J
Indon Microbiol 11 (2): 87-90
Kasrawi MA, Suwwan MA, Mansour. 1988. Sources of resistance to tomato
yellow leaf curl virus in Lycopersicon species. Euphytica 37:61-64
Lapidot M, Friedmann M, Pilowsky M, Ben-Joseph, Cohen S. 2001. Effect of
host plant resistance to Tomato yellow leaf curl virus (TYLCV) on virus
acquisition and transmission by its whitefly vector. Phytopathol 91:1209-
1213
Lazarowitz SG, Lazdins IB. 1991. Infectivity and complete nucleotide sequence
of the cloned genomic components of a bipartite squash leaf curl
geminivirus with a broad host range phenotype. Virol 180(1):58–69.
Mason G, Rancati M, Bosco D. 2000. The effect of thiamethoxam, a second
generation neonicotinoid insecticide, in preventing transmission of tomato
yellow leaf curl geminivirus (TYLCV) by the whitefly Bemisia tabaci
(Gennadius). Crop protection 19:473-479
90
Mubin M, Mansoor S, Hussain M, Zafar Y. 2007. Silencing of the AV1 gene by
antisense RNA protects transgenic plants against a bipartite begomovirus.
Virol J 4(10):1-4
Pascal E, Goodlove PE, Wu LC, Lazarowitz. 1993. Transgenic tobacco plants
expressing the Geminivirus BL1 protein exhibit symptoms of viral disease.
Plant Cell 5: 795-807
Pico B, Diez MJ, Nuez F. 1998. Evaluation of whitefly-mediated inoculation
techniques to screen Lycopersicon esculentum and wild relatives for
resistance to Tomato yellow leaf curl virus. Euphytica 101:259-271
Polston JE, Anderson PK. 1997. The emergence of whitefly-transmitted
geminiviruses in tomato in the Western hemisphere. Plant Dis 81:1358-
1369
Raj SK, Singh R, Pandey SK and Singh BP. 2005. Agrobacterium-mediated
tomato transformation and regeneration of transgenic lines expressing
Tomato leaf curl virus coat protein gene for resistance against TLCV
infection. Current Sci 88 (10): 1674-1679
Sanford JC, Johnson SA. 1985. The concept of parasite-derived resistance:
deriving resistance genes from the parasites own genome. J Theor Biol
115:395-405
Sambrook J. Fritsc EF, Maniatis T. 1989. Molecular cloning, a laboratory
manual2nd
edition. Cold Spring Harbor Laboratory Press. Book 1, 2 dan 3
Sinisterra XH, Polston JE, Abourized AM, Hiebert E. 1999. Tobacco plants
transformed with a modified coat protein of tomato mottle Begomovirus
show resistance to virus infection. Phytopathol 89:701-706
Sudiono, Hidayat SH, Suseno R, Sosromarsono S. 2001. Molecular detection and
host range study of tomato-infecting begomovirus. In : Proceeding of
Indonesian Phytopathology Soc. Seminar. Bogor. Aug 22-24, 2001. p.
208-217.
Vidavsky F, Czosnek H. 1998. Tomato breeding lines resistant and tolerant to
tomato yellow leaf curl virus issued from Lycopersicon hirsitum.
Phytopathol. 88:910-914
Vidya CSS, Manoharan M, Kumar CTR, Savithri HS, Sita GL. 2000.
Agrobacterium-mediated transformation of tomato (Lycopersicon
esculentum var. Pusa Ruby) with coat protein gene of Physalis mottle
tymovirus. J Plant Physiol 156: 106-110
Zakay Y, Navot N, Zeidan M, Kedar N, Rabinowitch H, Czosnek H, Zamir D.
Screening Lycopersicon accessions for resistance to tomato yellow leaf
curl virus: presence of viral DNA and symptom development. Plant Dis
75:279-281