8
LexisNexis ® Information Professional update The newsletter specifically designed for legal information professionals ISSUE JULY 2008 7 08:049 Register and Get More— Such as this newsletter—via e-mail plus weekly updates. Go to http://www.lexisnexis.com/ infopro Can Your IP Team Master Current Practices in 230 Nations and Entities? LexisNexis ® Global IP Law Service Gives Them the Tools Today business is going global—taking their Intellectual Properties counsel with them on a wild ride through new due-diligence, compliance and filing territory. And the new clients walking through the door include: A family business that needs to know if their family name can serve as a trademark in Netherlands Antilles. Their people already spent hours searching the Internet. Consultants representing customers in Argentina. Is there a restriction on the number of domain names a single registrar may have? (By the way, the consulting group tried—in vain— through multiple phone calls to track down answers from Argentinean officials.) Industrial designers from one of your new corporate clients who are interested in obtaining a U.S. design patent. Will it be subject to annual maintenance fees? How about if they apply in Germany? The LexisNexis Global IP Law Service can tell you this and much more, providing comprehensive coverage of global IP law—IP practice and proceedings, IP legislation and regulations, and current news updates—from more than 230 nations and entities, such as The Isle of Man. Gain access to all resources found at GlobalIPLawService. com, plus global domain name practice, proceedings and legislation. And it’s all at lexis.com ® . Just select Search Global IP Law Service on the NEWS & BUSINESS tab. (Links are also now available in the Patent Law, Trademark Law, Copyright Law, International Trade and other Area of Law menus.) This is the world’s most extensive English-language online resource of national IP laws and international agreements. (More than 1,800 are available). It’s organized on a country-by-country basis rather than a topical basis, making research fast. And easy. You can even use many LexisNexis ease-of-use features. For example, click Search Global IP Law Service and select Global IP Law Trademarks Legislation. Enter a natural-language search: Can a family name serve as a mark in Netherlands Antilles? Or select Global IP Law Domain Names and enter: In Argentina, are there restrictions on how many domain name registrations a single registrar may have? LexisNexis Global IP Law Service finds the information quickly, saving the customer time and resources. That makes your organization a good value. Read more about LexisNexis Global IP Law Service on page 08:052 AALL Annual Meeting July 12 – 15 in Portland, Oregon ONLINE WITH See What LexisNexis Web Centers Offer Your Organization … Take a Tour With the LexisNexis Product Champion ........... 08:050 KNOWLEDGE EXCHANGE LexisNexis Web 2.0 Law Centers: A Librarian’s Perspective ....... 08:051 SPOTLIGHT ON Monitor IP Practice, Proceedings, Legislation—Even News— Across More Than 230 Nations and Entities ................. 08:052 Discover Integrated IP Solutions Through the LexisNexis Services . . 08:053 EXTRA! EXTRA! Elsevier Full-Text Journals— Now 1,000+ at lexis.com ® ..... 08:054 FYI FLASH No More Guesswork in Legislative/Regulatory Tracking; Set up Alerts—New Through Potomac Publishing Company ® .. 08:055 FOR IPS ONLY Register NOW as an InfoPro User! ............. 08:056 Ask Your Savvy Colleagues How to Capitalize on LexisNexis ® Publisher ......... 08:056

LexisNexis The newsletter specifically designed for …LexisNexis ® Information Professionalupdate The newsletter specifically designed for legal information professionals ISSUE 7

  • Upload
    others

  • View
    14

  • Download
    0

Embed Size (px)

Citation preview

Page 1: LexisNexis The newsletter specifically designed for …LexisNexis ® Information Professionalupdate The newsletter specifically designed for legal information professionals ISSUE 7

LexisNexis®

Information ProfessionalupdateThe newsletter specifically designed for legal information professionals

ISSUE JULY 20087

08:049

Register and Get More—Such as this newsletter—via e-mail

plus weekly updates.Go to http://www.lexisnexis.com/

infopro

Can Your IP Team Master Current Practices in 230 Nations and Entities?LexisNexis® Global IP Law Service Gives Them the Tools

Today business is going global—taking their Intellectual Properties counsel with them on a wild ride through new due-diligence, compliance and filing territory. And the new clients walking through the door include:• Afamilybusinessthatneedstoknowiftheirfamilynamecanserveasatrademark

in Netherlands Antilles. Their people already spent hours searching the Internet.• ConsultantsrepresentingcustomersinArgentina.Istherearestrictiononthe

number of domain names a single registrar may have? (By the way, the consulting group tried—in vain— through multiple phone calls to track down answers from Argentinean officials.)

• Industrialdesignersfromoneofyournewcorporateclientswhoareinterested in obtaining a U.S. design patent. Will it be subject to annual maintenance fees? How about if they apply in Germany?

The LexisNexis Global IP Law Service can tell you this and much more, providing comprehensive coverage of global IP law—IP practice and proceedings, IP legislation and regulations, and current news updates—from more than 230 nations and entities, such as The Isle of Man. Gain access to all resources found at GlobalIPLawService.com, plus global domain name practice, proceedings and legislation.

And it’s all at lexis.com®. Just select Search Global IP Law Service on the NEWS & BUSINESS tab. (Links are also now available in the Patent Law, Trademark Law, Copyright Law, International Trade and other Area of Law menus.)

This is the world’s most extensive English-language online resource of national IP laws and international agreements. (More than 1,800 are available). It’s organized on a country-by-country basis rather than a topical basis, making research fast.

And easy. You can even use many LexisNexis ease-of-use features. For example, click Search Global IP Law Service and select Global IP Law Trademarks Legislation. Enter a natural-language search: Can a family name serve as a mark in Netherlands Antilles?

Or select Global IP Law Domain Names and enter: In Argentina, are there restrictions on how many domain name registrations a single registrar may have?

LexisNexis Global IP Law Service finds the information quickly, saving the customer time and resources. That makes your organization a good value.

Read more about LexisNexis Global IP Law Service on page 08:052

AALL Annual Meeting July 12 – 15 in Portland, Oregon

Online With

See What LexisNexis Web Centers Offer Your Organization …Take a Tour With the LexisNexisProduct Champion . . . . . . . . . . . 08:050

KnOWledge exchange

LexisNexis Web 2.0 Law Centers: A Librarian’s Perspective . . . . . . . 08:051

SpOtlight On

Monitor IP Practice, Proceedings,Legislation—Even News— Across More Than 230 Nations and Entities . . . . . . . . . . . . . . . . . 08:052

Discover Integrated IP Solutions Through the LexisNexis Services . . 08:053

extra! extra!Elsevier Full-Text Journals—Now 1,000+ at lexis.com® . . . . . 08:054

FYi FlaSh No More Guesswork in Legislative/Regulatory Tracking; Set up Alerts—New Through Potomac Publishing Company® . . 08:055

FOr ipS OnlY Register NOW asan InfoPro User! . . . . . . . . . . . . . 08:056

Ask Your Savvy Colleagues How to Capitalize on LexisNexis® Publisher . . . . . . . . . 08:056

Page 2: LexisNexis The newsletter specifically designed for …LexisNexis ® Information Professionalupdate The newsletter specifically designed for legal information professionals ISSUE 7

08:050

Online With

See What LexisNexis Web Centers Offer Your Organization …Take a Tour With the LexisNexis Product Champion

Web Center Feature: PodcastsGet quick audio updates summarizing the most important events of the past week, including excerpts from oral arguments, conferences, lectures, etc. Podcasts also include weekly roundtables from outside contributors and law firms.BeSt practiceS: What a great way to get regular debriefs via the increasingly popular medium of podcasting. Plus these radio-style offerings frequently feature guest experts from firms and companies. Why not one of your experts?

Web Center Feature: Widgets & FeedsThese are the personalization tools that allow you to snap portions of the Web Centers into your Web site. Leverage existing Web content efforts, such as papers, presentations and news. You can even feature your attorneys or organization in free, e-mail alerts to clients and stakeholders. Or create personalized feeds of new content added to the sites. BeSt practiceS: Embrace the trends to create personalized centers through platforms such as My Yahoo! and iGoogle™.

You’ve got the good news: case victories, deals executed, new blogs, new practice groups, new books, papers or speaking engagements.

Now you have to use it—and help your organization’s marketing team—turn the good news into business opportunities.

Get targeted exposure on the open Web with 12 new LexisNexis Web Centers focused to practice areas. These centers surface when Web users research on search engines. More LexisNexis Web Centers, targeted to additional practice areas, are under development. And soon the centers will be available at www.martindale.com as well as at www.lexisnexis.com.

There is no charge to participate. Charges only come into play if users link into lexis.com resources not in their plan. (LexisNexis flags links that might come with a fee.) The more a firm participates, the more exposure you receive.

So how do you make the most of this new marketing avenue? Below, Tom Hagy, LexisNexis Vice President, Open Web Content, shares what the early innovators have been doing to capitalize on LexisNexis Web Centers. (Have additional ideas? Contact Hagy at [email protected]) LexisNexis Senior Librarian Relations Consultant Bridget MacMillan shares a librarian’s perspective on Web Centers on the next page.

Web Center Feature: Expert Forums (Insights & Analysis)Generous abstracts from the new Expert Commentary are featured on the site with information about the author and links to the full-text commentary on lexis.com. Other articles are featured as well, including law firm papers or Mealey’s™ Commentary. BeSt practiceS: Attorneys, law professors, corporate counsel and others can demonstrate their expertise either by publishing with LexisNexis or by commenting on what the featured experts are sharing on the site. Increase exposure to your brand too. Reach thousands of visitors. (You benefit from LexisNexis Web optimization expertise as well.)

Web Center Feature: Blogs (Law Blogs, Featured Content, Product Updates, etc.)This is topical, observational and directional commentary posted predominantly by LexisNexis editorial and practice-area experts. But you’ll also find “guest appearances” and comments from guest authors. That’s why the writing style is informal; it invites interaction with site visitors. BeSt practiceS: Try these new lines of communication; they open doors to LexisNexis experts who are quite willing to share their expertise, news or insights. And invite your experts to post. Remember … law firm posts will link back to your Web site to drive traffic. You can also use your organization’s contributions to enhance Martindale-Hubbell® profiles and traffic.

Web Center Feature: Top BlogsInternal practice area experts select high profile/other important cases/blogs to feature.BeSt practiceS: These editorially selected blogs provide some “best of the legal Web” commentary by attorneys and other experts. Save blog vetting time!

Web Center Feature: News Headlines/Movers & ShakersAs the name implies, these are the headlines to watch, covering people in the industry, law firms and corporations. News headlines are posted to the Web centers and updated regularly with links to the full text on lexis.com. BeSt practiceS: Get a quick briefing on the latest legal and industry news, including what’s going on with leaders in the space.

Start Now!Register. Participate. Read articles—and post comments. Assign a content liaison … or just jump in.

Get more details on participating Contact Tracie Morris of the LexisNexis Web Center Team at [email protected]

LexisNexis Web Centers at: www.lexisnexis.com/hub(See Practice Area Centers)

Insurance Torts Environment Emerging Issues Trademark Law International Law

Commercial Law Business Law Bankruptcy Law Copyright Law Real Estate Patent Law

Page 3: LexisNexis The newsletter specifically designed for …LexisNexis ® Information Professionalupdate The newsletter specifically designed for legal information professionals ISSUE 7

08:051

l a w. l e x i s n e x i s . c o m / i n f o p r o

08:051

l a w. l e x i s n e x i s . c o m / i n f o p r o

LexisNexis Web 2.0 Law Centers: A Librarian’s Perspectiveby Bridget MacMillan, LexisNexis Senior Librarian Relation Consultant

When you begin a research project, do you search the open Web? About 74% of researchers begin either on the open Web or through their organization’s information portal.1 To assist you, LexisNexis created free, Practice-Area Web centers that surface when you search the Web. For example, as I wrote this, I searched “insurance law center” on Google, and the LexisNexis Insurance Law Center is the first result. http://law.lexisnexis.com/blogs/Insurance

What are LexisNexis Web centers, and How are They Different from the LexisNexis Services? The goal of these Web centers is to create communities for practitioners. The sites are built upon Web 2.0 technologies, including:

• blogsanddiscussions• expertcommentary• emergingissues• RSSfeeds• Podcasts

To save you time and direct you to the most appropriate resources on the LexisNexis services, there are groupings of links to the best sources for that practice area.

When you gain access to the LexisNexis Insurance Law Center, for example, the familiar LexisNexis logo is in the upper left corner. The page is laid out systematically, with content listed, boxed and titled so that you can easily navigate the page.

Within the Expert Forum are full-text commentaries on many topics specific to that each practice area. On the Insurance Law Center, there are currently 18 topics covered, including Climate Change/Insurance, Industry Trends, and Sub-prime Lending.

Delve deeper into the Insider Perspective Blog, and you will find the most recent posts, but you can also explore the blog through the 21 topics it covers, like Advisory Board Perspective, Legal Blogging (Insurance), and Worker’s Compensation. Some of the topics are duplicative of the topics in the Expert Forum, but some are different.

The blog differs from the Expert Forum because it is the place for community members to share news or commentary, not necessarily an expert’s analysis. You can share what’s on your mind or what you are observing in your field. It can be a very personal post, as you can see from this one at the right:

KnOWledge exchange

Bridget MacMillan

Legal Blogging (Insurance)3/11/2008 7:05:26 p.m. ESTThe Way I Drink ItPosted by Tom Hagy VP LexisNexis

So I am having a cup of coffee at Starbucks and in a dubious moment of consciousness (I am not a morning person; I am not even an afternoon person) I noticed a feature on the cup that’s probably been around for 10 years: Starbucks’ “The Way I See It” series of quotes from famous people. My coffee mates, one live, one virtual (don’t ask) had quotes from Newt Gingrich and Madeline Albright. I had this one from Presumed Innocent author Scott Turow. The Way I See It #271: “The law, for all its failings, has a noble goal—to make the little bit of life that people can actually control more just. We can’t end disease or natural disasters, but we can devise rules for our dealings with one another that fairly weigh the rights and needs of everyone, and which, therefore, reflect our best vision of ourselves.” Nice, huh? Nothing controversial there! Does anyone want to step up and disagree? Agree? Positioned right below the message was Starbucks’ disclaimer: “This is the author’s opinion, not necessarily that of Starbucks.” You know it’s a tough environment when a major corporation, known for coming out with deliciously strong coffee, can’t come out strongly in favor of, say, law. Or, well, justice.

DISCLAIMER: This opinion about how the quote is not the opinion of Starbucks is the opinion of the author and is not necessarily the opinion of LexisNexis or its parent Reed Elsevier. It’s not even an opinion so much as a quasi-humorous observation. The statement that this is more of a quasi-humorous observation and less of an opinion is the opinion of the author; it is not necessarily the opinion or quasi-humorous observation of LexisNexis or its parent Reed Elsevier …

continued on page 08:054

1 Market Intelligence Service Report – Outsell, 3/24/2008

Page 4: LexisNexis The newsletter specifically designed for …LexisNexis ® Information Professionalupdate The newsletter specifically designed for legal information professionals ISSUE 7

08:052

SpOtlight On

Monitor IP Practice, Proceedings, Legislation—Even News—Across More Than 230 Nations and Entities The Global IP Law Service2 on www.lexis.com helps your IP practitioners make better business decisions with the most comprehensive and current database covering Intellectual Properties practice, proceedings and legislation for more than 230 countries.

Global IP Law Service features up-to-date global IP legal information covering patents, trademarks, industrial designs, utility models and domain names as well as IP legislation and regulations from more than 230 countries. With easy access to up-to-date legal resources from around the globe, your users can get the broadest legal perspective needed to succeed. They can count on:

• Expertguidance: The Global IP Law Service database provides IP practice and proceedings guidance from a network of international IP practitioners. It is written by IP experts from 99 intellectual property law firms around the world —professionals who understand the intricacies of international IP law.

• Increasedproductivity: Sifting through all the information on international IP law to find what you need can be time consuming. The Global IP Law Service database consolidates this information in one easy-to-use, searchable database. Use the same, familiar Lexis® syntax. Save your users’ precious time—and yours.

• Greaterconfidence:Depend on comprehensive, up-to-date global IP law information covering IP practice and proceedings, IP legislation and regulations. And the LexisNexis Global IP Law Service is updated weekly.

Gaining access to the current, in-depth LexisNexis Global IP Law Service information is as easy as:

1. Click Search Global IP Law Service on the NEWS & BUSINESS tab. Choose from a variety of sources based on the information you need.

2. Once you’ve selected a resource, e.g., Global IP Law Domain Names Practice & Proceedings, you can enter a search—with terms and connectors or natural language.

So … How Can Your Library Use LexisNexis Global IP Law Service?To help your IP Practice area:

• Keepupwithchangestopracticerequirements and legislation in non-U.S. countries.

• Stayupdatedonhowtofilepatents(or trademarks, etc.) in the United States—and around the world. Get very specific details about filing requirements, maintenance fees and other practice-related matters on a country-by-country basis. Locate these details in an easy-to-browse Table of Contents.

• HowislegislationaffectingIParoundthe world? LexisNexis Global IP Law Service keeps your organization updated on changes to the Patent Cooperation Treaty, the Madrid Agreement, or the Paris Convention and more.

• Stayinformedonglobalissuesaswell, e.g., ICANN’s effort to support non-ASCII characters in domain names (i.e., “Internationalized Domain Names” or “IDNs”). Global IP Law Service’s coverage of this issue will keep you up-to-date.

Or click Browse TOC (next to the SEARCH button) to review the country and topic list.

Choose a nation, e.g., Argentina, then drill down to sections of interest.

Page 5: LexisNexis The newsletter specifically designed for …LexisNexis ® Information Professionalupdate The newsletter specifically designed for legal information professionals ISSUE 7

08:053

l a w. l e x i s n e x i s . c o m / i n f o p r o

Discover Integrated IP Solutions Package Through the LexisNexis Services

LexisNexis Toolbar Gives You Fast Access to Many IP Resources

Have your IP practitioners downloaded this time-saving toolbar yet? They should. Included in the toolbar is one-step access to:

• U.S.,European,PCTandU.K.full-text patents and Japanese patent abstracts

• Non-patent prior-art resources, including one-step access to Elsevier Full-Text Journals, IP.com and Research Disclosure with the latest version (1.1) of the LexisNexis Toolbar.

• Matthew Bender treatises such as Chisum on Patents, Milgrim on Trade Secrets and Baxter World Patent Law

Download the LexisNexis Toolbar at www.lexisnexis.com/toolbar

Obtain and protect intellectual property—including patents, trademarks, copyrights, and trade secrets—with technology that’s innovative, integrated with the way your professionals work, and designed to help your organization make better business decisions.

The LexisNexis Global IP Law Service brings unique content to lexis.com, covering more countries than any other analytical offering at lexis.com. Plus it is organized on a country-by-country basis rather than a topical basis. And it covers industrial designs and utility models; no other LexisNexis services products cover these areas of intellectual property.

Yet the LexisNexis Global IP Law Service is part of an integrated suite of IP solutions available from LexisNexis. For example, IP practitioners can also turn to:

• MatthewBender® treatises: Round out research with world-class titles such as Chisum on Patents, Nimmer on Copyright ®, Gilson on Trademarks®, Milgrim on Trade Secrets® and McGrady on Domain Names. Baxter World Patent Law explains the patent process, from filing to grant, for all industrialized nations. World Trademark Law and Practice offers a complete guide to world trademark law and practice, with detailed coverage of 35 major jurisdictions and summary coverage of 100 more. International Copyright Law and Practices brings together the global analysis of the international copyright system with in-depth treatments of national laws.

• Intellectual Property: Mealey’s™ Litigation Report: Covers all areas of intellectual property litigation, including copyright, patent, trademark, trade dress, trade secret and unfair competition disputes, both in courts and before administrative bodies. Also find issues related to the Internet and disputes over insurance coverage for intellectual property suits.

• TotalPatent™: Now available as a link through lexis.com. While the Global IP Law Service focuses on patent law and process, TotalPatent focuses on patents themselves, offering the full text from 22 authorities, bibliographic and abstract data from an additional 74 authorities, searchable both in the language of publication and in English-language machine translations. Also get images, legal status, citations and patent-family data.

• PatentOptimizer™: Adds to your IP arsenal by helping your IP professionals construct well-tailored patent applications that yield stronger, more defensible patents. Also an effective analysis tool during litigation, the service can quickly deconstruct online-issued patents and pinpoint ambiguities, issues or problems that have previously gone undetected.

2 LexisNexis Global IP Law Service may not be available to law school and government subscribers. Please contact your LexisNexis account manager for more details.

Page 6: LexisNexis The newsletter specifically designed for …LexisNexis ® Information Professionalupdate The newsletter specifically designed for legal information professionals ISSUE 7

08:054

extra! extra!

Elsevier Full-Text Journals—Now 1,000+ at lexis.com®

Now there are more than 1,000 Elsevier Full-Text Journals 3 available through lexis.com, a newly expanded collection covering science, patents and technology; the environment; health and medical issues.

Did your library visitor see a reference to an Elsevier article on blood-borne pathogens in a patent? You can pull the peer-reviewed article—more than the words. Embedded graphics such as charts and illustrations are included for review, download or print. Or link to a PDF 4 of the article you need—no additional search needed.

There’s so much more. Elsevier Full-Text Journals are often cited in patents by the inventors and are key to prior-art investigations. You can also provide organization leaders with expert analysis on new economic and technological theories.

And for litigators, it’s a bonanza—directing you to lead thinkers (or opposing viewpoints). You can pull all expert writings, uncover links among experts, identify leading studies, discover mitigating conditions and determine reasonable standards for the time period.

These are highly technical resources. But that doesn’t mean they are difficult to research. As your organization’s information expert, keep in mind:

• ElsevierFull-TextJournalsareconvenientlylocatedthroughoutlexis.com. Find them on the main LEGAL tab page. And within the 54 state and territories pages (right under Search Law Reviews & Journals). This source is even listed under the NEWS & BUSINESS tab.

• LexisNexis® Total Litigator offers easy access to Elsevier journals too. For example, under Gather Intelligence, select Medical Research.

• OrcheckoutthelinkontheLexisNexis Toolbar. The premium collection can be surfaced via Select A Source > Law by Topic then Prior Art/Non-Patent. Your patent researcher can highlight a patent claim, medical or technical term in documents and launch a Boolean or natural-language search directly into Elsevier journals.

Why Should Librarians be Interested in Web Centers? First of all, they are sources of free information which makes them a natural

starting point for research. As the summer associates move through your firm, you can direct them to these centers to increase their comfort and knowledge of that area of law. Associates can quickly grasp an overview of the topics that shape this area of law through the news headlines and expert’s forum.

Second, in addition to the information being freely available, the centers are also the best place to start when looking for information on emerging issues. The Expert Forum and the Insider Perspective Blog can help researchers hone in on a particular issue and the language being used to discuss the issue. This makes constructing additional searches easier.

Third, these centers are also concrete examples of Web 2.0 technologies in practice. They can be a model for building similar sites within a firm or organization. At the very least, by becoming familiar with them, you can expand your knowledge and understanding of Web 2.0 possibilities.

LexisNexis Web 2.0 Law Centers: A Librarian’s Perspective—continued from page 08:051

• Usegroup sources—even practice-area groupings. Or create your own source mix. Search specific document segments. Use LexisNexis SmartIndexing Technology™ terms to pinpoint research.

• Just need specific full-text articles? GET A DOCUMENT functionality is available for all 1,000+ Elsevier Full-Text Journals. Gather citations from experts’ curricula vitae and quickly retrieve those articles with a basic set of parameters. Choose the GET A DOCUMENT tab and click Citation Formats. Enter a publication name, e.g., Lancet Neurology; Click FIND. Click the citation link provided. Add year, volume, number and page range. Click GET.

3 Elsevier journals are not available to law school subscribers and may not be available to government subscribers. Contact your LexisNexis account manager for more details.

4 Please note there is an additional charge to retrieve the PDF.

Currently, LexisNexis has 12 Web centers available: Bankruptcy, Business & Corporate, Commercial, Copyright, Emerging Issues, Environment, Insurance, International, Torts, Patent, Real Estate and Trademark Law. You can easily access them at http://www.lexisnexis.com/hub/

Spend some time exploring these Web Centers. I believe you will be impressed by what you find there!

Page 7: LexisNexis The newsletter specifically designed for …LexisNexis ® Information Professionalupdate The newsletter specifically designed for legal information professionals ISSUE 7

08:055

l a w. l e x i s n e x i s . c o m / i n f o p r o

FYi FlaSh

No More Guess Work in Legislative/Regulatory Tracking;Set Up Alerts—New Through Potomac Publishing Company®

Guess what changed yesterday?Was it a little known state statute section … or did that long-awaited legislation

finally hit its enactment date?It’s business imperative to know the impact of new and pending legislation

and regulations. And it doesn’t have to be a difficult task. In fact, now new Alerts from federal and

state Legislative Impact® and federal Regulatory Impact® make it an automated task.5

With a simple set-up—much like the LexisNexis® Alert—your organization can select the information it wants to track. For example, track any legislation that affects a:

• USCSorCFRsection—oranentirepartortitle,e.g.,Title29.• Statecodesection6

• U.S.orstateagency,e.g.,EPA• Specificact(usethepopularnameifyou’dlike)

Get an e-mail alert notice as soon as the online product is updated. Are you expecting a legislation change? You can also request daily alert updates at a time you choose, like before the staff meeting. Even get alerts to tell you when there is no change. (Sometimes reporting that nothing happened is important news.)

This new legislative alerting capability from Potomac Publishing Company is available only through lexis.com

You can set up an alert right from your Legislative Impact or Regulatory Impact results. As you view a document, click the Save as Alert link. Name your alert and designate notification:

• Time frame: only when change occurs or request daily updates. Or select to be notified on a daily basis even if no changes occur.

• Method: online or via e-mail. Add up to three e-mail addresses. (If you select online, you can see right at the main Potomac Publishing Company Materials screen that you have new results. New results are also flagged on the master Manage Alerts screen.)

You can also set up your Legislative Impact or Regulatory Impact Alert directly from the main Potomac Publishing Company menu. (Potomac Publishing Company Materials are listed throughout lexis.com. For example, click Federal Legal – U.S. on the LEGAL tab.) Select Alerts under Additional Features. Then click Add a New Alert.

What a perfect application for firm practicegroups!Keeptrackof“hot”legislation or monitor an entire code or title.

Did the hot issue cool off? Is the practitioner who needs the information going on vacation? You have a variety of options under the Manage Alerts link on the main Potomac Publishing Company Materials page. Pause an alert. Edit or delete. Also view an alert history for 90 days as well as review the newest results.

5 Not available to law school subscribers. May not be available to government subscribers. Contact your LexisNexis account manager for more details.

6 16 states now available: Arizona, California, Colorado, Florida, Georgia, Illinois, Massachusetts, Michigan, Nevada, New Jersey, New York, Ohio, Oregon, Pennsylvania, Texas and Virginia. More states coming!

Page 8: LexisNexis The newsletter specifically designed for …LexisNexis ® Information Professionalupdate The newsletter specifically designed for legal information professionals ISSUE 7

08:056

LexisNexis® Information Professional UpdateNewsletter editions are also available at http://www.lexisnexis.com/infopro

LexisNexis Information Professional Update is a monthly newsletter (November/December issues combined) for law-firm, law-school, corporate, and government information professionals published byLexisNexis, P.O. Box 933, Dayton, OH 45401-0933.

Managing Editor Barbara M. Byrd [email protected]

ContributorsGeorgia Akers Linda Banks KaraCox Carol Sandy

Legal LiaisonShari Townsend

For comments or questions regarding legal products, contact:

Cindy Spohr, MLS Senior Director, Librarian Relations Group [email protected]

LexisNexis, lexis.com, Lexis, Martindale-Hubbell and theKnowledgeBurstlogoareregisteredtrademarks,and LexisNexis SmartIndexing Technology is a trademark of Reed Elsevier Properties Inc., used under license. TotalPatent, PatentOptimizer and Mealey’s are trademarks of LexisNexis, a division of Reed Elsevier Inc. Matthew Bender is a registered trademark of Matthew Bender Properties Inc. Nimmer on Copyright, Gilson on Trademarks and Milgram on Trade Secrets are registered trademarks of Matthew Bender & Company, Inc. Legislative Impact, Regulatory Impact and Potomac Publishing Company are registered trademarks of DataStream Content Solutions, LLC. Other products or services may be trademarks or registered trademarks of their respective companies. © 2008 LexisNexis, a division of Reed Elsevier. All Rights Reserved. LB2008-7 0608

FOr ipS OnlY

Register NOW as an InfoPro User!It takes two minutes. You get access to new and member-exclusive information.

Register now as a user on the LexisNexis InfoPro Web site for Information Professionals! As a registered member, you will gain access to new and exclusive information and resources, for example:

• futuremembers-onlyWebpages• upcominglibrariancasestudiesandwhitepapers• futureissuesofLexisNexis Information Professional Update • productliteraturedirectlyfromtheSLAandAALLmeetingexhibitfloor.

Download or print just what you need.

You’ll also get notices and updates on what’s new to InfoPro through LexisNexis This Week so you can tap in and take advantage of the latest information quickly.

Go to www.law.lexisnexis.com/infopro. At the main screen (right above KeepingCurrent),clickRegister. At the same time, new users can also sign up for LexisNexis This Week e-mails and the electronic, monthly LexisNexis Information Professional Update.

Ask Your Savvy Colleagues How to Capitalize on LexisNexis® PublisherHow are you using LexisNexis® Publisher7 to keep your organization informed? Do you know what your colleagues are doing?

Get some great application ideas as well as some tips for making the most of the flexible Publisher features. Join the LexisNexis Publisher Users Group. During these teleconferences, law librarians and the LexisNexis Publisher product specialists share their insights.

The next LexisNexis Publisher Users Group meetings are Wednesday, August 20, 1 p.m. or 3 p.m. EDT. Can’t make it? You have another opportunity to dial in Tuesday, August 26, 2 p.m. EDT.

August’s topic will be: Reviewing Best Practices, Features and Functionality of LexisNexis Publisher.

You may also reserve calendar space for these future LexisNexis Publisher User Group meetings.

FALL: Wednesday, October 8, 1 p.m. and 3 p.m. EDT or Tuesday, October 21, 2 p.m. EDT WINTER: Wednesday, December 3, 1 p.m. and 3 p.m. EST or Tuesday, December 9, 2 p.m. EST

Get more details on the LexisNexis Publisher Users Group—and/or register. Just send a note to Senior LexisNexis Librarian Relations Consultant Bridget MacMillan at [email protected]. And check out the LexisNexis Publisher Resource Center—full of product information, downloadable guides and Publisher Web examples—at the LexisNexis InfoPro Web site at www.lexisnexis.com/infopro Just click Product Resource Centers under Training & Resources.

7 LexisNexis Publisher is not available to law school subscribers.