Upload
indyaconz
View
222
Download
0
Embed Size (px)
Citation preview
8/9/2019 G Plus Issue # 28
1/23
Distributed free of cost
GLAMOR GOSSIP GRANDEUR
FORTNIGHTLY ISSUE NO. 28 AUGUST 15, 2010 AUCKLAND
RAJESH KUMAR- 14 years of Legal & Immigration experience- Specialise in Skilled Migrant Category & Family Residence
- Study to work t o Residence Permit- Visitor/Work Visa/Permit to Residence Permit for spouse/partner
- Residence Visa/Permit under Sibling/Adult Child category [last number]- Long Term Business Visa/Permit - Enterprenuer Category [Residence]- Appeal/Review/Reconsideration of declined cases.
Ph: (09) 279 9228
Mobile: 021 205 5507
Fax: (09) 279 9224
1st Floor, 150-A Great South Road, Papatoetoe, Auckland
P.O.Box 23450, Hunters Corner, Papatoetoe, Auckland
E-mail: [email protected]
Immigration Advisor
Rajesh KumarMA LLB, LLM Hons (NZ)
AJAY DEVGAN
I dont go by theI dont go by thenum bers gamenumbers game
Ajay Devgan is on a newhigh. The actor-produceris going through one ofthe best phases in hiscareer. To start with, heis overwhelmed with theextraordinary response forhis role in Milan LuthriasOnce Upon A Time.Also,producers and directors arequeuing up at his doorstepwith some of the most
promising offers. He talksabout this wave of successand more.
2 0 1 0
ANNUAL
BOLLYWOODHIGH SCHOOL
DANCE
COMPETITION
SATU DA 2 stAUGUST201 @
LOG N A PBELLC NT E
DESI INTERNATIONAL SHOWBIZ PRESENTS
Full coverage
on page 6 & 7
8/9/2019 G Plus Issue # 28
2/23
AUGUST 15, 2010, AUCKLANDWWW. LESS4U.CO.NZ ADVERTORIAL02
1 & 6 - 7 - Cover story
AJAY DEVGAN
3 - Stars Birthdays
4 - Previews
WE ARE FAMILY
HELLO DARLING
5 - Point of view
BIG B
8 - 9 - Whats up
10 - 11 Gupshup
12 -13 - King PosterCELINA JAITLY
16 - In the news
18 - Event
20 - Star Talk
DEEPIKA PADUKONE
22 - NZ diary
23 - Star Classified
PUBLICATION DETAILSPublisher: Metsons(N.Z) Ltd.
Editor: Vinay MehtaAssociate Editor ( Mumbai): M.J. Rajendrakumar.
Consulting Editor: R Manishaa ([email protected])
Address: 17-A, Robson street, Lynfield, Auckland.
Copyright reserved: Metsons (NZ) ltd.
For Advertising contact: Vinay Mehta - (09) 6294849,021893424
e mail: [email protected]. website: www.gplus.co.nz
Editors note,
Kudos to Ajay Devgn and his performance in Once Upon a Time In Mumbai.
In comparison to some of our other loud actors, who go overboard with their
performances, Ajay has this fine art of giving a subtle performance in whatever
role he attempts. It also reminds me that actors like Ajay are far better in comedythan Akshay Kumar and his types, who make a mockery of comedy, with their
performances.
Lets hope the audiences hail more such actors at the box-office.
Vinay Mehta - Editor
Readers feedback
CONTENTS
NEWZEALAND
MIGRATION&
INVESTMENT
NEWZEALANDMIGRATION&INVESTMENT
ASSOCIAT ION FORSSOCIAT ION FOR
TM
LICENSEDBYImmigration
AdvisorsAuthority
TM
ImmigrationAdvisers
Authority
ImmigrationAdvisersAuthority
newzealand.govt.nz
JP
DipB.S; Dip.Co-Law; Cert.BusLaw(UK); Dip.Acctg;Member -NZAMI; Member-MInstCM
RegisteredMarriageCelebrant
Member- CANZ
8/9/2019 G Plus Issue # 28
3/23
AUGUST 15, 2010, AUCKLAND STAR BIRTHDAYS 03WWW. LESS4U.CO.NZ
August 13 August 19
SRIDEVI RANDEEP HOODA
August 15 August 21
KAJOL BHOOMIKA CHAWLA
August 16 August 23
SAIF ALI KHAN MALAIKA ARORA
August 16August 16ManishaManishaKoiralaKoirala
You share your birthday with
8/9/2019 G Plus Issue # 28
4/23
AUGUST 15, 2010, AUCKLANDPREVIEWS04 WWW. LESS4U.CO.NZ
Dharma Productions We Are Family
is the official remake of the 1988 film,
Step Mom. Directed by Siddhartha
Malhotra and produced by Karan Johar,
the film tells the touching story of a terminally
ill divorcee who is faced with the prospect of
accepting the new woman in her husbands lifeas the stepmother of her kids. The film portrays
the problems that the two face even as they try
to enter into an understanding. The film will see
the coming together of two of Bollywoods most-
talked actresses, Kajol and Kareena Kapoor. The
last time they were seen together was in Kabhi
Khushi Kabhi Gham, which was also a Dharma
Productions movie. The music of the film has
been composed by Shankar-Ehsaan-Loy. The film
is scheduled to release on September 10,
Synopsis: Maya (Kajol) is the perfect mother.
Her life revolves around her three children, Aleya
(Aanchal Munjal), Ankush (Nominath Ginsburg),
and Anjali (Diya Sonecha), who think nothing
less than the world of her. Despite being divorced
from her husband, Aman (Arjun Rampal) Maya
has ensured that everything runs smoothly in her
house, under her watch, and that they continue
to remain a happy family unit. However, when
Aman introduces his girlfriend Shreya (Kareena
Kapoor), a career oriented woman, who has a lot
to learn about children, to the family, the situation
immediately takes an unexpected turn. When an
incident changes their lives drastically, bringing
the two women under the same roof, they find
themselves putting to test an unusual situation.
Can two mothers make a home?
Forced to make some unorthodox choices for her
family, Maya must confront her uneasy equation
with Shreya and find a way to bring everyone
together, despite their differences, to make them
a family once again. Can they make a happy home
and proudly say... WE ARE FAMILY!
Character Sketch:
Kajol as Maya - Maya has never accepted
that her marriage is over. So she pours her heartinto being the perfect mother. From finding the
impossible birthday present. to being there for
every single moment-no one can replace her. Maya
is focused on bringing up the kids with traditional
Indian values. She tries to give the children the
very best that she can. And she makes sure that no
one else has a say in their upbringing.
Arjun Rampal as Aman -Aman is the man
stuck in the middle! He is well respected as a
professional. He adores his children and tries to be
there for them as much as he can. Unfortunately
his career calls him away at crucial moments. He is
determined not to make the mistakes with Shreya
that he made in his first relationship. It is really
important to him that it works out, and he gives it
his level best.
Kareena Kapoor as Sherya - Is a young
designer who is struggling to get her career started.
She is madly in love with Aman - one of the top
commercial photographers. She is impulsive,
bright and unpredictable. Life with her is one
adventure after the other. She is an independent
thinker who finds the most unexpected solutions
to situations and problems. Her bubbly exterior
masks a tough core. Shreya is a survivor.
Diya Sonecha as Anjali - Snow white and
fairy tales are her reality. At six, shes the apple of
her familys eyes. Her innocence and simplicity
put a smile on their faces but when the evil witch
(daayan) enters her perfect fairy tale world, itchanges her understanding to reality and makes
her ask the question - do good witches also exist!
Nominath Ginsburg as Ankush - His
world is full of planets, books and stars. At 10 hes
quite mature for his age but he never quite allows
anyone to probe into his heart. His father is his
hero and his mother his world and somewhere
deep down he wants his parents to get back but
when hes thrown into this unusual situation, life
takes another meaning for him.
Aanchal Munjal as Aleya -At 13, staying
in a family without the presence of her father,
shes the protective sister of the family and her
mother is her universe but when destiny puts her
in an unusual situation, the question remains
whether she will she be able to face the harsh
realities of life.
Synopsis:
Hello Darling is a film about three young, beautiful,
smart girls (Gul Panaag, Eesha Koppikhar Narang and Celina
Jaitley) who work in a fashion design company in Mumbai.
Each are targets of their lusty boss (Jaaved Jaffery) who
eventually manages to trap them all a sticky situation in
whi ch al l three are made to dance to his tun es. They mus t
find ways to wriggle out of his control and unite to cook
up their own scheme to be free of him and his notorious
intentions once and for all.
Who outsm ar ts who m is the basis of this fun fi lled
hilarious comedy with chart-busting music by Pritam &
lyrics by Shabbir Ahmed, Ashish Pandit & Kumar. The film
is directed by debutant Manoj Tiwari and written by Pankaj
and Sachin who wrote blockbuster comedies like Apna
Sapna Money Money and Kya Kool Hain Hum.
Produced by Ashok Ghai under Mukta Arts banner, Hello
Darling is a rib-tickling, feel-good film all the way. The
film also stars Chunky Pandey in a brief role. It is slated for
a 27th August release.
Character Sketch:
Gul Panag as Mansi - A car eer- oriente d you ng
corporate woman who sheds much exuberance amongst
fellow co-workers. Despite the exploitations of her boss
Hardik, she clings very tightly to her job as she dreams of
one day making it big. Sh e teams up with Candy and Satavti
to teach Hardik a lesson he is not soon to forget.
Celina Jaitley as Candy - A very sexy- looki ng
girl who works as a PA to Hardik, and has always beenmisunderstood by her co-workers to be Hardiks mistress.
She is very romantic at heart and looks after her flop rock
star boyfriend Rocky (Chunky Pandey). She later partners
wit h Man si and Sa tvat i in a p lan to put Ha rdik in his ri ght ful
place.
Eesha Koppikar as Satvati - She is a middle class girl
from Hissar, Haryana. She joins company as a fresher and
gets along instantly with Mansi, realizing the truth behind
Candys stories, and becoming friends with both. Her entry
into the office is what acts as a catalyst in the three ladies
eventually bringing Hardik down on his knees.
Javed Jaffrey as Hardik - The 35 year old CEO of
the R B group of industries is an over-ambitious boss who
has manipulated his way up the ladder, leaving no stone
unturned to lure young, good-looking girls who work under
him to make them the prey of his lust.
WE ARE FAMILY
8/9/2019 G Plus Issue # 28
5/23
AUGUST 15, 2010, AUCKLAND POINT OF VIEW 05WWW. LESS4U.CO.NZ
And I dream of the days when work was scrappy,
And rare in our pockets the mark of the mint,
And we were angry and poor and happy,
And proud of seeing our names in print
I just chanced upon this little verse and felt it so apt in most of our lives, lives that
all of us have led and experienced and enjoyed, irrespective of what circumstances the
words may express.
Yes, we have all been through those days when we knew and felt
that the work that we were doing was not what we wanted to be doing
for the rest of our lives. We wanted work, we wanted to stand on our
own feet, we needed that independence, we needed to walk away from
being dependent on others, particularly family and parents. We took on
whatever came our way. It was a start. A beginning. If we saw a future a
continuity in it, we remained, if not, we quietly and most politely declined
it and went our way.But those times were rare. The mark in our pockets of that mint
lasted but for the shortest period of time. There was the regular upkeep
and existence that challenged our earnings each month. There was the
paucity for the luxury and the fun that we could buy. It made us angry.
Angry because we had the desire, but not the pocket to afford it. Angry
because we saw others in more affluent situations and lamented the fact
of not being in their shoes.
But we were happy. Happy to be where we were, in whatever we were and whatever
we had. The discomfort of not being in the other league was diminished in the company
of compatriots who were also in similar conditions. Somehow there was a brotherhood
of those in the same boat and suddenly it all did not look so bad after all. It became
fashionable to say we cannot afford it. We said it without any remorse, but with a
strange sense of pride. It was acceptable that we did not have everything.
In a sense it egged us on to struggle harder, to work towards a goal that would
provide us, or put us in that elusive basket where all was not ready made for us.
And then the print ! The first print mention in a sporting achievement or small
mention of that theatre experience. An assessment a presence, a few kind words of
description ; the very first time to confront what others thought of you, not in private,
but in the realm of a medium that would be public ! Such a joy and feel of
importance. The exuberance of sharing it with colleagues, friends, family
and in private repeatedly. Its safe custody in that little drawer where
all the personal letters were neatly kept. Its presence under the pillow
for several nights and then finally to store it away reluctantly, to glance
perchance within a time span !
The quote is from C.sK. Chesterton ( 1874 - 1936 ) and it is titled the
Song of Defeat. Six years before I was born he perished, but his thoughts
relevant today in 2010 in a manner which he may never have everenvisaged. He calls it a Song of Defeat. To me it is a song of victory, as I
am certain it would be for many others who found themselves perched
on the fence, about to slide across to the other side where the grass was
greener.
It has allowed me to look back. To reminisce, to wonder. It may seem
that I would have been through with it. It may still return, who knows.
But it still remains as a symbol to me of all that has an eternal value. One that needs to
be cherished, embellished and stored.
Thank you Lord for giving me the opportunity to look upon it in hindsight ..
You may very well have not !
Love and affection in more ways than one -
His success story, star charisma and immense talent remain unparalleled but there is yet an-other quality to Big B that makes him a cut above the rest-the fact that he values every mo-ment of his success. In this piece, he introspects about the little joys of success and how they
are cherished forever.
Looking Back
8/9/2019 G Plus Issue # 28
6/23
AUGUST 15, 2010, AUCKLANDCOVER STORY06 WWW. LESS4U.CO.NZ
Your performancein Once Upon
A Time... has
come for both
commercial and critical
acclaim. How does it feel?
I am delighted with the
audience response for the film.
I always look forward to the
feedback I get from my fans
and audiences. Their response
is an indicator that my hard
work has paid off.
Your characterization and
look in the film has also
come for appreciation.
As for the characterization,
it was entirely director Milan
Luthrias vision. I did work on
my look for the film, the long
hair, the style of dressing. The
film is based on the 70s so we
decided that bell bottom pants
and high heeled shoes, would
be apt in keeping with the
period. Also, we all researched
on the look. Alim Hakim who
styled my hair remembered
what the look was in the 70s,
when he would accompany hisfather on the sets. Designers
Rishi and Manushi worked
on the costumes, so it was a
combined effort.
How much did you know
about Haji Mastan as a
man before you attempted
the role?
I knew that he was a
smuggler but one who was
very good at heart. Besides, he
only indulged in the smuggling
of banned goods. In terms of
the character, I felt that he
had a very different persona in
comparison the other dons, one
who was mean and at the same
time romantic. On one side he
had a wry sense of humour,
on the other he was very soft-
hearted, which is why people
took advantage of him. He has
a wry sense of humour and at
the same time he is a softie at
heart and thats why people
take advantage of him.
How was it working with
Milan Luthria?We are old friends. We have
grown together over the films
we have done over the years.
We did Kachche Dhaage and
Deewar together we have
been friends since then, so the
comfort level is much more
now.
You seem to be consciously
attempting roles in various
genres, be it drama,
comedy or action. Are
you happy with the
kind of work you are
doing?
I do want to get into
different genres and I
am making efforts in that
direction. I am the kind of
actor who would like to go
one step further beyond my
limitations. For me acting is
a process of eternal learning.
Also, I believe that every
person learns from his
own mistakes.
You are reportedly
playing the role of
a terrorist in your
next film, Bullet
Train?
I would
not like toc o m m e n t
on the
film at this
stage since
we have not yet
started shooting for it.
However, I will definitely
be able to talk about
Priyadarshans Aakrosh. It
is a complete action film and
we have just wrapped up the
shooting for the film. .
The news goes that
Aakroshwill have
you performing
some dare-devil
stunts on par with what
you had done in Patthar
Ke Phool
Thats not entirely true. I
dont think it will be able to
do the kind of stunts I did in
Patthar Ke Phoolat this stage.
When I did the film, I was young,
fearless and ready to take risks.
It meant conditioning my bodyand putting in a good deal of
hard work. Today my body
may not be able to take that
kind of pressure. Also my
responsibilities in life have
doubled up. I will think twice
before taking such a step.
How has Golmaal-3
shaped up? Are you
planning to go ahead
with another
sequel?
Its been great
doing all the
Golmaalseries. In
fact, the laugh
riot seems to
be getting
m o r e
h i l a r i o u s
with every
s e q u e l .
We have
not yet
d e c i d e d
a b o u t
a n o t h e r
sequel but
we may just
go ahead
with one. We
are enjoying iti m m e n s e l y
and so are the
audiences.
What is
it about
f i l m m a k e r
Rohit Shetty,
that keeps you
inspired to work
with him again
and again?
I and Rohit have
been together for the
last 19 years. We met
during the making of
Phool Aur Kaante
in 1991, my debut venture, in
which he was working as an
assistant director. In 2003 he
turned a full-fledged director
with Zameen and decided
to cast me in the lead. Our
friendship has grown over the
years and we are more like
family now. When you are
friends you share everything.Yes, we do have our share of
fights and arguments but then
we dont let it come in the way
of our friendship. We are no
longer in the actor-director
kind of relationship now.
What according to you is
the formula for success?
I dont believe in a success
formula, nor do I go by the
numbers game. For me a high
in my career is the appreciation
I get from the audiences. On
my part, I try and choose the
right films. Like I said earlier,
success for me is more about
trying to please my fans and
fulfilling their expectations.
Have you ever been
through a low phase in
life?
I have fortunately been lucky
in my career and have never
quite seen low phases. I have
been working continuously for
the last 20 years. I didnt have
a hit for one or two years but
that didnt dampen my spirits.
Do you ever carry your
stress back home?I never do that. For me the
moment I pack up, I switch off.
If you take your work home,
your life gets disturbed. It
can get dangerous to a point
where people end up becoming
a wreck. I can remember
only one occasion when I got
seriously intimidated by the
character I was playing. That
was the role of Bhagat Singh
for which I had done immense
research. We didnt want to
make mistakes so I had to be
careful but I ended up thinking
about him day and night.
8/9/2019 G Plus Issue # 28
7/23
AUGUST 15, 2010, AUCKLAND COVER STORY 07WWW. LESS4U.CO.NZ
How beneficial is it when an
actress is your wife?
Its much easier. She understands
my pressures. She understands when
I cant give her time. I can discuss
my work with her and take her
suggestions.
You are heading for fatherhood
once again. How does it feel?
I am excited and am looking forward
to becoming a father for a second time.
I am keeping my fingers crossed. I
am not gender biased. I want to have
a healthy child. In fact my daughter,
Nysa is more excited and is looking
forward to have a sibling. I am thinking
of giving up smoking now.
By Sharmishta T
I dont think it will be able to do the kindof stunts I did in Patthar Ke Phool at this
stage. When I did the film, I was young,fearless and ready to take risks.
Auckland office:
1/131 Kolmar Road, Papatoetoe, Auckland Phone 09 929 3855
Email [email protected]
Postal Address P O Box 23136, Hunters Corner, Auckland 2025
www.national.org.nz
Were working for you
Kanwaljit Singh Bakshi MP and Hon John Key, MP for Helensville, Prime Minister
GET JOHN KEYS NEWSLETTER
www.johnkey.co.nz
Zoya Akhtars cast zooms off on long drives every dayNEWS
Film-maker Zoya Akhtar has devised new ways to ensure
that the actors starring in her film, Zindagi Mile Na Dobara,
share a great comfort level and are in tune with each other.
Since her movie is about a road trip of three best friends played
by Hrithik Roshan, Farhan Akhtar and Abhay Deol, besides the
lead girls Katrina Kaif and Kalki, Zoya has asked them to hang out
together everywhere
they go.
She even asked
the five actors to
take long drives
together so that they
could get friendly
with each other and
the chemistry would
eventually reflect onscreen. Besides, Zoya
has set up the sets at
a 40 to 45 minute
drive from the hotel.
This way the actors
leave together for
the shoot and return
together. The entourage follows them later. This gives them more
time with each other.
Unit sources inform that the actors are having a blast on the
sets with each other ever since. In fact, they have all become so
comfortable that they dont go out without each other so much
so that they even cycle and gym together these days. That sure is
a novel way of making work an enjoyable experience. The other
directors need to take a cue from Zoya.
8/9/2019 G Plus Issue # 28
8/23
AUGUST 15, 2010, AUCKLANDWWW. LESS4U.CO.NZ08 WHATS UP
Remembering Mr. Bharaton Independence Day
Asif Bhamlas birthday bash
Television Producer, Manish Goswami, Bhojpuri superstar Manoj
Tiwari and music connoisseur, Anil Mishra presented Manoj Kumar,
popularly known as Mr. Bharat, Indias national flag for his patriotic
movies ahead of Independence Day celebrations on August 15. Needless to
add, the veteran actor was delighted at the gesture. He was too happy to see
the flag as he hugged it, said Mishra.
Politician Asif Bhamlas recent
bir thd ay bas h at Cest la via
lounge in Bandra witnessed a
deluge of celebrities from all walks
of life. The day also happened to be
the 12th anniversary of his N.G.O
We Love India that supports
education for the poor, the cause
of the spastics, autism, deaf and
dumb. A number of people from the
film, business, political and social
fraternity, were seen at the event.
Among the pro min ent people
from the film fraternity who were
present were Vivek Oberoi, Bindu
Dara Singh, Apoorva Lakhia,
Shekhar Suman, and Parmeet Sethi
wit h his wif e Arc han a Pur an Sin gh,
Mink, producer Manish Goswami
and Manoj Bidwai.
The cast and crew of Ram
Gopal Vermas latest film,
Raktacharitra threw a party
to celebrate the films completion.
Randeep Hooda, Makrand
Deshpande and Ram Gopal Verma
were s een enjoy ing their drinks whi le
Vive k Oberoi hit the danc e f loor a nd
showed his moves in the midst of the
whole crew. Vive k looked radiant in
his new moustached avatar that he
has donned for the film. Also present
were Nikhil Dwiv edi and Arja n
Bajwa.
Entrepreneur turned actor, Boman Irani recently took on a new mission.
Boman has chosen to become the face of the NGO Ahead which believes
in theatre for a purpose and entertainment for a meaning. Boman revealed
this at a press conference held at The Leelas, where he expressed his solidarity
for the development of the disabled. He also announced a fund-raiser play titled
The Melody of Love, starring Tom Alter, Lillette Dubey, RJ Mantra and Indias
only National and Presidential award winner Divya Arora, who is also disabled
and is the soul of the organization.
Ram Gopal Varmas memorable
Raktacharitra party
Boman Irani becomes the Brand
Ambassador of the NGO AHEAD
8/9/2019 G Plus Issue # 28
9/23
AUGUST 15, 2010, AUCKLAND WWW. LESS4U.CO.NZ 09WHATS UP
Actors who are looking at Hollywood as their final destination may
wel l be hap py to lea rn tha t the y can get a hel pin g han d fro m Poo ja
Batra in their Hollywood endeavours. The former model-turned-
actress who was seen in super hit films like Virasat, Kahin Pyaar Na Ho
Jaaye and Haseena Maan Jaayegi, and settled in Los Angeles after her
marriage, has now started her own casting agency, Glow Bell Inc., in L.A.
We now hea r t hat her com pany i s help ing LA cas tin g, a f ull -fl edg ed cas tin g
agency to set shop in India.
Pooja will be spearheading the India operations and will thereby render
a platform to industry professionals to get one step closer to Hollywood.
People who are looking to cast Indian models or actors in Hollywood or
even Indian productions will now have a professional helping tool to select
the talent from a pool, Pooja explains.
Incidentally, Poojas company had acquired Sylvester Stallone and
Denise Richards for Sajid Nadiadwalas Kambakkht Ishq last year. With
such interesting work under her kitty, Pooja Batra gives the phrase Beauty
with b rai ns an alt ogethe r n ew mea nin g.
Pooja Batra: ConnectingHollywood & Bollywood!
PLUSTAILORING LTD
HOLLYWOODBOLLYWOOD
TAILORINGALTERATIONS
MOVIES, GAMES,
AUDIO CD'S
MADE TO MEASURE
OPEN 7 DAYS Mon-Thur- 10.30am-8 pm. Fri-Sun - 10.30am-9pm
Phone
Mob
Fax
SHOP 23, 16 LAMBIE DR
MANUKAU, AUCKLAND
Email: [email protected]
Saree Blouses / Salwar Kammez
Puletasis
Ball & Wedding Dresses
Men's Garments
Uniform Contractors
Western & Island Garments
:
:
:
(09) 262 1113
021 026 73452
(09) 262 1103
Ladies, Gents, Childrens Wear
8/9/2019 G Plus Issue # 28
10/23
AUGUST 15, 2010, AUCKLANDGUPSHUP10 WWW. LESS4U.CO.NZ
Anil Kapoors new Papa!
Anil Kapoor has found himself a
new Papa and before you start
getting ideas...its none other
than Siddhartha Kannan. Recently
Anil went for a studio interview
for Sids show...When Sid
asked him the secret behindhow he was looking younger
by the day, Anil told him
about his five plastic
surgeries and his nose
rectification job.
However, knowing
his penchant for
humour, Anil
suddenly stood
up and called
him Papa Sid to
which Sid promptly
replied, I always wanted a son like you-
Beta Anil.
Anils daughter Rhea and music
composer Amit Trivedi went berserk
laughing at the Father -Son duo
having a blast with each other.
The icing on the cake was Anilasking Sid for his aashirwad
which Sid was more than happy
to oblige!
When asked about his
experience with Anil
Kapoor, Sid says, His
humility touches your
heart and his sense of
humour can teach a
thing or two to the best
of comedians.
Actress Mugdha Godse is merely
two films old and is eagerly looking
forward to her first horror movie
but the actress already has enough horror
tales to narrate. I knew it was too early in
my career to do such a film but then when
I heard the script, I simply couldnt say no,
she says.
In the film, Mughda plays the role of
Pia, the wife of a horror film-maker. We
have marital problems and in the midst of
the troubled marriage we have to rush to
Mauritius to visit my ailing father. Thats
where we find unusual things happening
around us.
The last time Mughda had a tryst with
ghosts was during her modeling days.
We were put up at a hotel and I was with
another model. I thought she was talking to
her boyfriend on the phone and asked her
about it. However, I later learnt that she
believed the same and we both continued to
hear the same voice through the night. We
changed our rooms the very next morning,
she recalls. After all the experiences, the
actress has now overcome her fear about
ghosts. She even makes it a point to watch
horror films now. I can afford to watch one
horror film every week now. And I enjoy
watching it in the dark, she smiles.
After Raavan, Aishwarya is looking
forward to working with hubby
Abhishek Bachchan once again.
We hear that the actress has agreed to
do a cameo in Rohan Sippys Dum Maro
Dum. According to sources often visited
the sets to meet her hubby. So when
Rohan Sippy wanted an actress for a
cameo, hers was the first name that came
to his mind. Ofcourse, Ash was more than
delighted to accept the offer considering
that she and Abhishek hardly ever got
time together with the many solo films
they had signed earlier. In fact, the two
have now decided that working together
is the best time spent with each other,
be it films or commercial. Coming back
to Dum Maro Dum, the action thriller
has Abhishek playing the role of an
undercover cop on the lines of his father
Amitabh Bachcans role in Zanjeer
during the 60s.
Now that the Pataudi
girl, Soha Ali Khan
has openly admitted
to being in relationship with
actor Kunal Khemu, we hear
more and more about this
latest Bollywood couple.
Sources reveal that when
Kunal celebrated his birthdayin May, Soha had also gifted
him a watch that cost her
Rs 4 lakhs. Kunal has been
happily flaunting his gift to
his friends ever since. In fact,
word goes that Soha has also
met Kunals parents and often
stays back at his home for
dinner, whenever she visits
them. However, though
both Kunal and Soha have
met each others parents,
marriage is not quite on the
cards for the couple yet, this
source reveals.
Aishwarya and Abhishek are hoping to w ork with each otherAishwarya and Abhishek are hoping to work with each other
Bollywoods
NewestCouple
MughdaGodses
horrortales
8/9/2019 G Plus Issue # 28
11/23
AUGUST 15, 2010, AUCKLAND GUPSHUP 11WWW. LESS4U.CO.NZ
Qudos to Dev Anand
Ever green actor Dev Anands
energy is commendable. The 87-
year old actor, who refuses to get
bogged down by his age, is now set to
remake his memorable hit, Hare Rama
Hare Krishna. He recently revealed
his plans and also admitted that hewas planning to shoot the entire film
in Nepal like the
earlier version.
People often
keep asking me
about the remake
of Hare Rama
Hare Krishna
and this has been
going on in my
mind for some
time. I have
many scripts.
I am all alone
but not lonely.
If people can
remake Hindi
movies and southmovies here in
Hindi, why cant
I remake my own
film? What fun
is it to wear anothers shirt? he asked
enthusiastically
When asked if he would cast Zeenat
Aman in the lead again Dev Anand said,
Dont be surprised. I will cast anyone
who does justice to the role. India is a
beautiful country and there are many
young good-looking boys and girls on
the streets who dream of becoming
stars. They call me up saying that they
want to be film stars but are not getting
breaks.
Hare Rama Hare Krishna was
made keeping in mind the hippie culturethat was rampant in those times. There
were hippies in the
70s, now it is the
drugs he added.
Currently, Dev
Anand is busy
preparing for the
release of his latest
directorial venture
Charge sheet, a
suspense thriller
in which he plays
the pivotal role.
The film also stars
Samajwadi leader
Amar Singh as a
home Minister. I
met Amar Singhat a party and he
hailed me. I hailed
him back. He
asked me when I
am going to cast him in my film. I told
him about this role in Charge sheet and
he agreed. We shot at his home in Delhi.
He is very ---happy with the outcome.
You can feel the dream in his eyes he
concludes. Qudos to ever-green young
hero.
SALON
SALON365
For all kinds of Hair and
Beauty Treatments
365 Bolckhousebay Road, Auckland-1007Ph. : 09-8288925 A/H 09 829 2020
Urmy Goradia
Big Showroom Big Sale
Bridal Lehngas Designer Sarees Ladies Suits2 White Swan Road, M t Roskill, Auckland
Ph: 09 627 6404www.khoobsuratnz.co.nz Email: [email protected]
Undercover Car Park
A i s i v a r i e t y j o h p a h e l e k a b h i A u c k l a n d m e i n d e k h i n a h i
Sale $1, $2, $3
Shop 2 Win
Shop at Khoobsurat and get a
chance to win prizes
Sale Sale Sale Sale Sale Sale Sale Sale Sale Sale Sale Sale Sale Sale Sale Sale
Sale Sale Sale Sale Sale Sale Sale Sale Sale Sale Sale Sale Sale Sale Sale Sale
Sale
Sale
Sale
Sale
Sale
Sale
Sale
Sale
Sale
Sale
Sale
Sale
Sale
Sale
Sale
Sale
Sale
Sale
Sale
Sale
Sale
Sale
8/9/2019 G Plus Issue # 28
12/23
AUGUST15
,2010,
AUCKLAND
AUGUST15,
2010,
AUCKLAND
KINGP
OSTER
KINGP
OSTER
12
13
CnCelinascareerisonarollThehotandsexyCelinaJaitlyisbetterknownforthesocialcausessheisassociatedwith.However,thesedaysthelissomelassisinthenewsforhercareermovesandthemanyfilmsshehasbagged,allofthemwithpromisingdirectorsand
peculiarlyEnglishtitles.WejusthopetheEnglishmantraworksforCelinaattheboxoffice.
8/9/2019 G Plus Issue # 28
13/23
7KHWK$QQXDO%ROO\ZRRG+LJK6FKRRO'DQFH&RPSHWL
WLRQ&RXQWGRZQ
7KH+HDWLVRQIRUWKH)LUVW6SRW
/RJDQ&DPSEHOO&HQWUH6DWXUGD\$XJXVWVWSPVKDUS
7KHPXFKDQWLFLSDWHGDQGDZDLWHGWKHDQQXDODQGRULJLQDO%ROO\ZRRG+LJK6FKRRO'DQFH&RPSHWLWLRQLVKHUHDJDLQ7KHWK\HDULQWKHUXQQLQJWKLV\HDUVWKHPHLVWKHIXVLRQRI%ROO\ZRRGZLWK+ROO\ZRRGWKDWZLOOGHSLFWWKHDVVLPLODWLRQRIRXU.LZLGLYHUVLW\WKURXJKGDQFHPXVLFDQGDUWV7KH*OLW]WKH*ODPRXUWKH7DOHQWZLWKKHDUWWKUREELQJSHUIRUPHUVLVDOOVHWWRNLFNRII%HWZHHQWR+LJK6FKRROVIURPDOODURXQG1RUWK,VODQGDUHQHUYRXVEXWFRQILGHQWWRSHUIRUPDQGFRPSHWHDJDLQVWHDFKVFKRROWRZLQWKLV\HDUVFURZQ
/DVW\HDUVZLQQHU3DSDWRHWRH+LJK6FKRROZLOOWU\WRPDNHLWWZRLQDURZZKLOHWKHILUVWUXQQHUXS.HOVWRQ%R\V+LJK6FKRRODQGWKHWKLUGSODFHJHWWHU0DQXUHZD+LJK6FKRROZLOOGRWKHLUXWPRVWEHVWWRWXUQWKHWDEOHVDQGWDNHWKHFURZQ2IFRXUVHQRWIRUJHWWLQJWKHXVXDOSURPLQHQWVFKRROVIURPLQDQGDURXQG$XFNODQG7KHVFKRROVKDYHEHHQEXV\SXWWLQJHYHU\WKLQJWRJHWKHUDQGWKHUHDSSHDUVWREHDQHOHPHQWRIH[FLWHPHQWWKULOODQGHYHQVHFUHF\DVWKH\DUHQRWZLOOLQJWRWHOORWKHUFRPSHWLWRUVZKDWWKH\KDYHXSWKHLUVOHHYHV7KH\KDYHEHHQSUHSDULQJVSHFLDOFRVWXPHV WRVXLWWKHLUUHVSHFWLYHLWHPVDQGWKHVHWXS5HKHDUVDOVKDYHEHHQKHOGFRQWLQXRXVO\WR UHDFKWKHSHDNRISHUIRUPDQFHWKDWV\QFKURQLVHVZLWKWKHPXVLFDQGPRYHPHQWV(DFK\HDUVFKRROVDUHJHWWLQJPXFKPRUHFRPSHWHQWZKLFKPDNHVLWPXFKKDUGHUIRUWKHMXGJHVDQGDXGLHQFHWRMXGJHDVWKHLUSHUIRUPDQFHJRHVXSRQHQRWFKKLJKHUDQGMXGJLQJJHWVKDUGHUDQGFRQIXVLQJ7RPDNHMXGJLQJHDVLHUVRPHFKDQJHVKDYHEHHQPDGHWKLV\HDU7KHRUJDQLVHURIWKH&RPSHWLWLRQ'HHSDH[SODLQHGWKHFKDQJHV
,QRUGHUWRPDNHLWPRUHFRPSHWLWLYHIRUVWXGHQWVWHDFKHUVMXGJHVDQGWKHRUJDQL]HUVWKLV\HDUZHKDYHPDGHWKHMXGJLQJFULWHULDPXFKKDUGHUDQGFKDQJHGRXUSRLQWVV\VWHP:HKDYHPDGHLWWRDSULYDWHMXGJLQJDQGSXEOLFMXGJLQJ6FKRROVDUHDOOVHWDQGH[FLWHGDERXWWKHVHFKDQJHVDQGDUHPXFKPRUHPRWLYDWHGDQGFRQILGHQWWRGHOLYHUWKHLUEHVWSHUIRUPDQFHWKLV\HDUWRWDNHWKHFURZQ6D\V'HHSD%LQHVK.XPDU 6XPHU WKHFRQYHQRURI WKHSURJUDPPH LVD IDPLO\SHUVRQ IURP D VWDEOH IDPLO\EDFNJURXQGZLWK KLVGDXJKWHUVDQGVRQVJLYLQJDKHOSLQJKDQGWRPDNHWKLVDIDPLO\DIIDLU+HDSSUHFLDWHVDQGSURPRWHVIDPLO\YDOXHV,QWKLVUHVSHFWIDPLOLHVDUHDVVXUHGRIWKHWLJKWHVWVHFXULW\DWWKHYHQXHZKLFKZLOODOVREHDVPRNHIUHHDQGDOFRKROIUHHDUHDIRUWKHIXQFWLRQ)RRGDQGQRQDOFRKROLFKRWDQGFROGEHYHUDJHVZLOOEHRQVDOHDWWKHIXQFWLRQ7KHUHIRUHPDNHWKLVDZRUWKZKLOHHYHQLQJIRUWKHZKROHIDPLO\IRUDQLJKWRXWWRDPDJQLILFHQWWKXQGHURXVDQGGD]]OLQJEDWWOHRIWKHEHVWLQWKH%ROO\ZRRG+LJK6FKRROGDQFHFRPSHWLWLRQ&RPHRQDQGZLWQHVVWKHEHVWRIEHVWLQWKLVWKDQQLYHUVDU\RIWKHRULJLQDO%ROO\ZRRG+LJK6FKRRO&RPSHWLWLRQ
*HWUHDG\IRUWKHHYHQWRIWKHGHFDGHFRPLQJVRRRQYHU\VRRRRRQVW$XJXVW
6((
8/9/2019 G Plus Issue # 28
14/23
2 0 1 0
ANNUAL
BOLLYWOODHIGH SCHOOL
DANCE
COMPETITION
UR 21s 0LOG AM .
TICKETS AVAILABLE AT ALL MAJOR INDIAN OUTLETS & PARTICIPATING SCHOOLS
* Conditions Apply
A DESI INTERNATIONAL SHOWBIZ PRESENTATION
TICKETFOR ALL
AGES
Alfriston College Auckland Girls Grammer Avondale College Botany Downs CollegeDe La Salle College Epsom Girls Glenfield College Hamilton Boys High
James Cook High Kelston High Lynfield College Marist CollegeMt Albert Grammer Mt Roskill Grammer One Tree Hill College Onehunga High
Otahuhu College Pakuranga College Papatoetoe High Rutherford CollegeSouthern Cross College Westlake Girls High Edgewater College Greenbay High School
St Kentigern College Tangaroa College TuaKau CollegePukekohe High Strathalan College
For Further details contact Deepa on 021 527 970 or Binesh 021 496 321, A/H 828 0150 or visit www.desiinternationalshowbiz.co.nz
Binesh Sumer
AUCKLAND
INDIAN SWEETS
MONUMENT
VIDEO
INDIAN SWEETS & VIDEO
MANUREWA
(dj nigels)'*-.$*5:K N Kitchen Joinery Ltd SN Windows & Doors Ltd Catering Masters Ltd SMOKE FREE
Mt.Roskill
Raj KumarBarfoot & Thompson, Manurewa
8/9/2019 G Plus Issue # 28
15/23
AUGUST 15, 2010, AUCKLANDWWW. LESS4U.CO.NZ16 IN THE NEWS
Mallika Sherawat now shifts her gaze to Bollywood
Manisha Koirala signs her first film post marriage
Mallika Sherawat is certainly
making hay in Hollywood
while the sun is still shining
there. But the actress is a bit anxious
that her Bollywood fans may soon
forget her and consider her a non-
entity here, which is why she has gone
ahead and signed a Hindi film with
director Indra Kumar. Reportedly,
Mallika has replaced Vidya Balan in
the much awaited sequel of Dhamaal
titled Dhamaal-2 after the latter opted
out of the film.
It may be recalled that Mallika has
not had a single Hindi release after
Dashavatar in April last year. Her
last two releases were both Hollywood
ventures namely, Hisss and Love
Barrack. We will have to wait and watch
whether Dhamaal indeed proves to be
a fun-ride for her after her tryst with
Hollywood.
Actress Manisha Koirala, who
quit the industry midway, is
looking at a second innings
in the industry post-marriage.
film Jai Bhim, in which she
will play the role of a hard-core
politician- a Dalit leader.
It may be recalled that
Manishas last movie was Partho
Ghoshs Ek Second Jo Zindagi
Badal De, after which she decided
to switch over to filmmaking. Later
she even trained in filmmaking
at New York and announced her
decision to direct a film. However,
the actress seems to have
postponed the project for now.
I dont know when I will start
directing it. First, I have to get myacting career back on track. Thats
why I am giving a lot of thought
to the movies I sign, she revealed
when asked about it.
Jai Bhim is being made under
the banner of Yograj Cinevista,
with the producer and director
both hailing from Dehradun. So
far only cinematographer Ashok
Mehta has been signed for the
movie.
The producers are now
planning to promote local
talent through the film and will
be shooting the entire film in
Dehradun to promote the place
through their film.
Salman Khan is no doubt known
for his obstinate nature and his
whimsical ways but the superstar
has always come for praise for his one
quality- his extensive charitable work.In fact, Salman does not spare a single
moment when it comes to espousing a
charitable cause. Recently, when he was
shooting for a film in Sri Lanka, Salman
chose the opportunity to continue with
his charitable work under the aegis of
Being Human foundation. The actor
provided a bright future for the poor in
Jaffna and Vavuniya, by organizing 500
cataract operations in both the cities in
a span of 10 days. He also flew down
four doctors especially from Mumbai to
perform the operations.
We are not surprised why Salman
Khans fan-following only seems to be on
the rise as the years pass by. Accordingto Deepak Anand, who worked on the
production team of Salmans last film
Veer and has just started an acting
academy in Bengaluru, students who
have started enrolling are keen to
know whether their favourite Salman
Khan will be part of the faculty. Anand
constantly jokes that he would need
military security if Salman Khan visits
the academy. The excitement and craze
for Salman is so huge he says.
Theres bad news for
those who were looking
forward to play the
role of Buddha in Ashutosh
Gowarikers next magnum
opus. Reports suggest that the
Rs 600 crores film which was
announced with much fan fare
has been shelved as of now.
Sources inform that
the producers had initially
announced the film on a grand
scale. However, as the days
passed by, they cut down their
budget drastically from Rs 600
crores to Rs 60 crores, which
Ashutosh did not accept kindly.
The subsequent changes in the
script also put the director offand he decided to wash his
hands off the project.
According to a source
associated with the movie, the
producers have now shut down
the pre-production unit of the
movie. They had started a unit
at J.W. Marriot which was going through the photographs and video of aspiring
actors for the role of Buddha. Bu the unit was shut down recently.
It may be recalled that Gowariker had even finalised an international crew
with big names like Karl Walter Lindenlaub (cinematography), Jarrod Linton
(pre-visualisation), David Ward (script-screenplay), David Russell (storyboard
artist), Glenn Boswell (action), April Ferry (costumes), Dileep Singh Rathore (co-
producer and line producer) and Nitin Desai (art) for Buddha. The movie, which
focuses on the life of Prince Siddhartha and his journey to enlightenment, was
scheduled to start by the year end.
Salmans
charitableintentions
Buddha shelved.
8/9/2019 G Plus Issue # 28
16/23
RAKSHABA
NDHANSPE
CIALSALE
RAKS
HABA
NDHA
NSPE
CIAL
SALE
8/9/2019 G Plus Issue # 28
17/23
AUGUST 15, 2010, AUCKLANDWWW. LESS4U.CO.NZ EVENTS18
Salman Khan to host Bigg Boss 4 on COLORS
Kangana Ranaut is
on cloud nine
Le a d i n g
e n t e r t a i n m e n t
channel, COLORS
recently announced
the most Wanted superstarSalman Khan as the seasons
host for its electrifying
reality TV show, Bigg Boss
4, expected to go on air later
this year.
Salman is expected to
take the excitement higher,
even as he goes about with
his spontaneous best, read
bru tal ly hon est and blu nt
manner with the inmates
of the Bigg Boss house!
Housemates, who used to
eagerly await their face timewith the hos t, wil l now pra y
to avoid their face-off time
with h im.
Wit h Sal man s ent ry, the
host will undergo a total
change in his attitude towards
the inmates. In the earlier
seasons of Bigg Boss, the
host acted as the housemates
friend, philosopher and guide
- but now with Salman the
host will become HOSTyle.
Whi le Salman wi ll be a fr ien d
for those who play it clean...he will be seen showing his
hostility towards those who
indulge in manipulation,
back-b iti ng and pol iti cs.
Talking of his association
with Big g Bos s, Sal man
Khan, commented, From
all the reality television
shows I have seen, Bigg Boss
has always intrigued me
the most. It is amazing to
see how people react under
unique circumstances. I am
clear as the shows host that
I will not take any hypocrisy
and politics lightly. For those
who pla y cle an, the y wil l
always find their best friendin me those who dont, be
ready to expect the worst.
Salmans inimitable
style, candid persona and
exceptional sense of humour
are sure to make Bigg Boss
Season-4 memorable.
said, Ashvini Yardi, Head
Programming, COLORS.
K
angana Ranaut
certainly seems to be
going places. After
the success of Once Upon
A Tim e, she is bei ng
flooded with offers, one
of them being Sanjay
Dutts first home
production Rascals.
Reportedly, Sanjay
Dutt and David
Dhawan, who
had seen Once
Upon a Time..
felt that she
would be jus t
apt for the role
in the film
they were
p l a n n i n g .
M o r er e c e n t l y ,
David Dhawan
happened to
spot Kangna at
an awards night
and immediately
expressed a keen
desire to work with
her. Kangna is of
course enjoying this
new high in her career
and is busy giving her nod
to the best of films. Rascals
wil l be Kanga nas seco nd fi lm
wit h A jay aft er Once Upon A
Time in Mumbaai
8/9/2019 G Plus Issue # 28
18/23
1st PRIZE
Sponsored by
G:6A>INIKH=DL
AUCKLAND,WELLINGTON,HAM
ILTON,
CHRISTCHURCH,TAU
RANGA,
NEWPLYMOUTH,ROT
ORUA
TAUPO,DUNEDIN....
TheCCC
In Association With
NOTE: SEMI FINAL Contestant names are
Model may vary
Media SupportSupported by
PAKURANGA
Event Managed by
PlymouthInternational
Hotel &Conference
Centre
N E W Z E A L A N D
LIVE GRAND FINALE ON SAT 25TH SEPTEMBER AT DOROTHY WINSTONE THEATRE
Major Sponsors
KELSTON
THIS AUGUST WATCH
STAR OF NEW ZEALAND ON
EVERY SATURDAY
10.30 AM
8/9/2019 G Plus Issue # 28
19/23
AUGUST 15, 2010, AUCKLANDSTAR TALK20 WWW. LESS4U.CO.NZ
You seem to be on a career
high with four significant
releases this year. Which
one of them are you
particularly looking forward to?
I would say that the year started on
a very promising note with the success
of Housefull. I now have Yash Raj
Films Lafangey Parindey up for release,
besides Break Ke Baad opposite Imran
Khan and Khelein Hum Jee Jaan Se
opposite Abhishek Bachchan. The
interestingly feature of all these films are
that they all belong to different genres
and each of them has unique role for me.
I am glad that I am being offered different
roles and getting an opportunity to work
with the best of directors.
Tell us about your role in Lafangey
Parindey.I play a blind girl by the name of
Pinky Palkar who is confident, ambitious
and a fighter to the core. She knows what
she wants and where she is heading for
despite her handicap. I could well relate
to the character because thats the way I
am made. Like Pinky, I dont give up on
things easily and pursue my goals to the
very end.
Reportedly the role was a tough
challenge and you had extensive
workshops before you started
shooting for the film.
It is true that the role of Pinky Palkar
was not particularly easy. I play a blind
girl and doing all the stunts being blind
was not easy. I would often close my eyes,
practice them and later try them once
again with my eyes open. Nevertheless,
the fact that I came from a sports
background made things fairly easier for
me. My demeanor can be lady-like but
the moment I put on my track pants and
T shirt, I can be as good as the boys
on the field with a ball. My knowledge
of skating and Bharat Natyam, came
in handy, in the way I could pick up
the nuances of the character. Also, the
entire group of five boys and girls had to
be alert about the fact that I was playing
a blind girl. One wrong move could mar
the movie. So we had intense work shops
with blind people before we took on the
movie.
You have attempted stunts in your
last film too. How different was
this experience?
Earlier in Chandni Chowk To China,
I trained in martial arts for the role. I
did enjoy the stunts at that time too. But
somewhere there is a child in everybody.
There are days when you want to go one
step beyond your perceive limit and take
up the challenge, which is what I did in
Lafangey Parindey.
You have also been training inscuba diving and paragliding. Is it
for the same movie?
No it was merely to get out of the
phobia of creepy crawly creatures that I
decided to train in scuba diving. Now that
I am a certified diver, I have overcome all
such fears. Likewise, I had fear of heights
so I decided to take up paragliding. It
was a wonderful experience.
How was the bonding with co- star
Neil Nitin Mukesh?
I think I have discovered a friend for
life in Neil. He is a wonderful human
being and the bonding we share has come
across wonderfully on screen. We got
along really well during the shoot. There
was an accident scene, where I neededa different kind of make-up and Neil
was trained in it so he told the director,
Pradeep Sarkar that he would do my
make-up, which he did. On another day
when I was doing an action sequence
which needed a lot of cable work, he
choreographed the entire act. So I think
he was there for me all the time.
Do you find it easier to bond with
co-stars with whom you share a
certain relationship?
I dont know about that but I try and
concentrate on my work irrespective of
how far I am close to my co-star. At the
end of the day, we are professionals and
have to do our work.
It is rumoured that Salman Khan
and John Abraham are keen on
working with you.
I dont know why people assume
things and draw conclusions prematurely.
At times we actors do listen to scripts
which dont necessarily work out all the
time. I am indeed doing a film with John
Abraham which will be directed by Rohit
Dhawan but yes, I am dying to work with
Salman.
Do you go by your gut instinct when
it comes to choosing roles?
Not really. I am an actor and I need
to be convinced about the character I am
playing. It is important for me that I enjoythe process and also be part of projects
with the best of directors. Tomorrow I
should not have doubts whether I have
chosen the right film. Fortunately, most
of my films except Chandni Chow To
China have done well. This is my eighth
film and I would not know whether it will
be a box-office success. But I do want
people to stand up and acknowledge my
talent. I think the process has already
started after Love Aaj Kal. That is what
Adi (Chopra) said when he offered me
this role. I feel that if I am indeed getting
great opportunities, it means that I am
doing good work.
By Sharmishta T
u seem to be on a career was not easy. I would often close my eyes, the nuances of the character. Also, the
wa
w
P
m
w
w
c
h
D
c
c
c
h
DEEPIKA PADUKONE
I have discovered a friend for life in NeilI have discovered a friend for life in NeilHer Bollywood debut, Om Shanti Om, proved to be a smashing success and madeDeepika Padukone an overnight box-office sensation. Her subsequent string of successesfurther consolidated her position but none of them matched up to the success of herfirst film. The ambitious model-turned-actress has a line-up of promising releases this
year starting with Lafangey Parindey. She talks about this and more.
8/9/2019 G Plus Issue # 28
20/23
Genre: Musical Comedy
ProductionHouse: Purple Post LimitedRun Length: 120 mins
Language: Fiji Hindi (English Sub titles)
Locations: Auckland, Napier, Fiji Islands.
Cast: TBA
Crew: New Zealand /Fiji
Story and Script Development: Jan - March 2009
Script treatment March 09
Location Scouting March 09
Shooting Schedule: April /May 09
(tentative) 15 days in Auckland, 5 Days in
Fiji
Release Date: AUg/Sept 2009
Script/Screenplay Monti Issar
Producer: Monti Issar, Sridhar Kallidai,
RonellDirector: Nirang Desai/ Monti Issar
Production Controller: Bali Virk
Sound Andy Schurr
Continuity Mac
DOP/ Camera: A. N. Baig
Associate Producers: Binesh
Music: TBD
Lyrics: TBD
Choreographer: TBD
Dialog Translation: Thakur Ranjit Singh
Production: New Zealand
Post: Purple Post
Lights/ Gaffers TBA
Cranes/ Dolly The Dolly Shop, Auckland
Tag Line : They came, they saw, they freaked out!!
FIRST Feature Film in FIJI HINDI Language
For the first time ever, a theatrical feature film tobe shot and produced in New Zealand and Fiji
From the industry professionals of Bollywood and NewZealand comes a landmark film
to be shot in picturesque locations in Auckland, Napierand Fiji.
is a remarkable and original storyof four talented musicians from a poor village in Fiji.From rustic ragas to modern sagas, their transitionevolves from their determination to participate in aninternational event of music and dance in New Zealand.
Emotional roller-coaster rides of trend setting music,comical interludes, emotional breakdowns and desperatesituations - a performance of a lifetime that will winfriends and foes.
We intend to make a quality, commercially successfulfeature film thats entertaining, emotional and funny- something we can all be proud of.
We have a great team and hope to involve more talentedpeople in the project.
8/9/2019 G Plus Issue # 28
21/23
AUGUST 15, 2010, AUCKLANDWWW. LESS4U.CO.NZ
Roopa aur Aap, an organization that has
been supporting community events and
festivals since the past six years, is all set
to present a programme Jodi Number One, whichfocuses on the importance of relationships. Jodi
number One will not only have Jodis of h usbands
and wives and boy friends and girl friends, but
wil l also include brothers and sisters, friends
and/or partners. The highlight of the programme
wil l however be a section tit led, how well you
know your Jodi, which will have a sequence of
questions and answers for either partners.
The programme commences on Thursday, 5th
August 2010 on Triangle TV at 8 p.m. and the
number one Jodi will receive a surprise gift from
the sponsors. Jodi Number One is launching on
Thursday 5th August, 2010 on Triangle TV at 8pm.
The series will feature 13 episodes of entertainmentand those who are keen on participating in the
programme can contact Roopa.
Roopa aur Aap would like to take this
opportunity to thank its sponsors Car Clearance
Centre, Moshim Discount House, Kaysons
Fashion, Global Visa and others, for their
support.
In addition, Roopa aur Aap has also introduced
a new service that offers video shooting of
weddi ngs or any auspicious occas ion s. Ple ase
contact Roopa for further queries on 021-665609
or email [email protected]
New Zealand Red Cross today announced that it would support an internationalemergency appeal to help people living in miserable conditions after theextensive flash floods in Pakistan.
Calling for donations, New Zealand Red Cross International Operations Manager
Andrew McKie said, The funds will help Pakistan Red Crescent Society branchesand volunteers to deliver food, health services, tents, tarpaulins, and water andrelief items including hygiene kits and cooking equipment.
New Zealand Red Cross is making a contribution of $13,000 to the operation,which wil l help 25,000 families for nine months. Many families have been forcedfrom their homes and have been left with no means of support. They are living inmiserable conditions. This appeal will help the Red Cross deliver more food, waterand shelter materials, said Mr. McKie.
One hundred percent of funds donated to the Pakistan floods through NewZealand Red Cross will go to the international emergency appeal. New Zealand RedCross urges supporters to donate cash, not goods, so that the right relief items canbe sent to people in need as quickly as possible.
For more information, you can log on to:http://www.redcross.org.nz/cms_display.php?st=1&sn=43&pg=513Donations can be made online at www.redcross.org.nz or by phoning 0800 RED
CROSS (0800 733 276).For inquiries contact New Zealand Red Cross communications advisor Rosemarie
North on (04) 495 0137 or 027 296 9687.
New community FM radio is all set for a promising launch in MountRoskill area. The radio will basically cater to audiences of various Indiancommunities, mainly the Gujarati audiences. Those interested in presenting
radio programmes in their own language are requested to send a mail to [email protected]. Religious organisations are also welcome with their programmes.
Ace Talent is organising a Bollywood dance
competition for intermediate schools in
Auc kla nd on 16t h Oct obe r at Doroth y
Winst on The atre at 7 p.m . The nam e of the
show is DESI INTERMEDIA- DA Dance OFF.This is the first ever dance competition for kids.
It is the brainchild of Azhar Adam a dancer,
choreographer, model, and now an actor with
Pump up-The Mandali, who felt that there was
a genuine need for a platform to showcase young
talent in New Zealand.
The major prizes for the winners are $1,000
for the first prize, $500 for the second and $250
for the third winner, besides 10 other prizes. If
you r school wishes to enrol l any of its talented
kids in the competition, please feel free to contact
Ada m Ali on 027 4414488,09256 1964 or e-mai l
New local television is ready for a launch in the Indian market onInternet TV platform. To catch up watch TELSTRACLEAR free onbro adband on www .zi ln.co.nz. You can als o g et more informatio n on
this on the above mentioned web-site.
Labour Associate Ethnic Affairs spokesperson, Dr Ashraf Choudhary says theGovernment must take into account the financial struggle migrant and refugeefamilies will face if it introduces changes in the interest-free student loan
scheme.Labour introduced interest-free loans in 2005 to give more Kiwis the opportunity
for higher learning. After promising to keep the scheme in place, Prime MinisterJohn Key is now hinting at a back-track, Ashraf Choudhary said.
Many skills and qualifications gained in migrant countries of origin are nottransferable in New Zealand, and therefore it is vital new migrants undertake studyhere to achieve qualifications that are recognized, he added.
Earlier this week John Key spoke to students at Victoria University aboutstudent loan debt, and suggested that the interest-free student loan scheme doesnteconomically stack up, Dr Choudhary said. If National is toying with the idea ofbringing back interest it must seriously look at the deterrent impact that will have onmigrant and refugees gaining an education which is beneficial to their family, futuresecurity and to New Zealand, he revealed..
According to Dr Choudhary, student loans already create long-term impacts onthe financial security of families, such as buying a home and saving for retirement.Women also take twice as long on average to repay their loans, particularly whenthey take time out of the paid workforce to have children, he said.
Contact: Ashraf Choudhary 021 799 573.
JODI NO 1INTERNATIONAL RED CROSS LAUNCHESAPPEAL FOR PAKISTAN FLOODS
NEW COMMUNITY RADIO TO BELAUNCHED IN MOUNT ROSKILL AREA.
INTERMEDIATE
DANCE
COMPETITION
NEW LOCAL TELEVISION TO BE LAUNCHED SHORTLY
Migrants loan needs must be considered
NEW ZEALAND DIARY22
8/9/2019 G Plus Issue # 28
22/23
AUGUST 15, 2010, AUCKLAND STAR CLASSIFIED 23WWW. LESS4U.CO.NZ
learnculinarysecretsfromtheprofessionals...
Level4, 75KarangahapeRoadPhone:006493750050Fax:006493750035
[email protected] www.nzstt.ac.nzTollFree: 0800843697
83HendersonValley Road,Henderson,AucklandEmail: [email protected]
TollFree: 0800843697
Live n
NewZ
ela
i
andSt
dy...
u
Work
...
NationalDiploma in TourismManagement-Level 5NationalDiplomainBusiness-Level5DiplomainTravel,Tourism& Business-Level5
NationalCertificate in Hospitality(ProfessionalCookery) Level4
TheNewZealand Schoolof Travel,TourismandBusiness(NZSTT)
TheAucklandSchoolofTechnology(AST)
(Spousecangetwork visaaspercurrentNZISPolicy)
NZQAAccredited Courses
Are You ThinkingAbout Career In New Zealand?
8/9/2019 G Plus Issue # 28
23/23