Architecture - Rimadesio · Adolf Loos nel celebre Ornamento è delitto 2, scritto ... 2 Ornament and Crime: (original title Ornament und Verbrechen) is a short essay, written by

Architecture

Talking AboutI/IV

P. 3 L’architettura, oltre i formalismi, verso la condivisione. Architecture, beyond formalism and towards community and sharing. A cura di / curated by Rimadesio

P. 11 Architettura: ripartendo dalla storia, si afferma la centralità degli interni rispetto al progetto contemporaneo. Architecture: the legacy of interior design continues today, playing a central role in modern architectural projects. Beppe Finessi intervistato da / interviewed by Marco Romanelli

Index Architecture

3 Architecture

Conoscenza, etica, bene comune, qualità e responsabi-lità: sono i termini che riassumono le argomentazioni fondamentali del trattato De Architectura1, scritto da Marco Vitruvio Pollione, ma mai come oggi capaci di descrivere lo stato dell’architettura e, in particolare, il ruolo dell’architetto. Se infatti non vi è alcun dubbio in merito all’influenza dell’architettura e del design sull’esi-stenza dell’uomo, appare allo stesso tempo evidente come il progetto debba collocarsi maggiormente al centro della vita quotidiana, delle sue dinamiche, dei suoi ritmi e in generale delle consuetudini abitative.

La centralità del progetto rappresenta infatti una vera e propria necessità, non ulteriormente procrastinabile visti i parametri di crescita demografica dei prossimi anni, stimati, con ragionevole certezza, dal rapporto annuale redatto dalle Nazioni Unite: sul pianeta Terra saremo 8 miliardi nel 2023; 8,6 miliardi nel 2030; 9,8 miliardi nel 2050 e 11 miliardi nel 2100. A questi dati occorre poi aggiungere una constatazione ovvero più della metà di tale aumento della popolazione sarà concentrato in nove paesi soltanto: India, Nigeria, Repubblica Democratica del Congo, Pakistan, Etiopia, Tanzania, Stati Uniti, Uganda e Indonesia. L’India, che oggi conta 1 miliardo e 300 milioni di abitanti, pari al 18% della popolazione mondiale, diventerà il paese più popoloso, superando la Cina (1 miliardo e 400 milio-ni), mentre le nazioni europee saranno le uniche al mondo in cui il numero di abitanti si ridurrà tra il 2017 e il 2030, passando da 742 milioni a 739 milioni.

Al di là delle cifre, è fin troppo scontato affer-mare che ci sarà bisogno di progettare o riprogetta-re città, strade, quartieri, case e sistemi di arredo. Ma, in realtà, bisognerà fare molto di più:

L’architettura, oltre i formalismi, verso la condivisione.Architecture, beyond formalism and towards community and sharing.A cura di / curated by Rimadesio

1 De architectura (Sull’architettura) è un trattato in lingua latina scritto da Marco Vitruvio Pollione intorno al 15 a.C. È l’unico testo sull’architettura giunto integro dall’antichità e divenne il fondamento teorico dell’architettura occidentale,dalRinascimentofino allafinedelXIXsecolo.

54 ArchitectureTalking About

L’architettura oggi è tutto questo: un mix di complessità e sintesi, un connubio tra linguaggio e tecnica, tra essere e fare, tra forma e funzione. Ma forse è sempre stato così. Tra le più riuscite defini-zioni di architettura ricordiamo infatti quella di uno dei padri fondatori del Movimento Moderno, diceva Adolf Loos nel celebre Ornamento è delitto2, scritto nel 1908: “Se in un bosco troviamo un tumulo, lungo sei piedi e largo tre, disposto… a forma di piramide, ci facciamo seri e qualcosa dice dentro di noi: qui è sepolto un uomo. Questa è architettura”. In questa frase è riassunto il senso stesso della nozione di archi-tettura: si parte da un luogo ben specifico, in questo caso il bosco, un luogo che ha in sé caratteristiche uniche e irripetibili, un ambiente capace di provocare nell’uomo, che lo vive e lo percorre, emozioni e pensieri diversi da quelli che potrebbe suscitare qualsiasi altro luogo. Poi, tutt’a un tratto, compare l’artificio, il costruito, un tumulo in questo caso, qualcosa che va a interrompere l’equilibrio della natura per innescare un nuovo sistema di relazioni. La presenza dell’opera genera una reazione, provoca uno stato d’animo in chi l’osserva: “ci si fa seri”! L’architettura quindi può, anzi deve, generare un’emozione, la predisposizione a essere partecipi di un’esperienza. Ma non solo. Nella definizione di Loos è esplicita anche l’esperienza del costruire, ovvero la necessità per l’uomo di avvalersi di strumenti e tecniche per dare forma all’architettura, in questo caso una piramide. Un volume con geometrie, regole e dimensioni ben precise, puntualmente riferite al corpo umano (6 piedi × 3 piedi), da sempre metro di confronto per lo spazio (lo riaffermerà con forza Le Corbusier, circa 50 anni più tardi, proponendo il Modulor). La regola quindi si traduce in riconoscibilità: chiunque si trovasse di fronte alla piramide nel bosco comprende-rebbe immediatamente, senza bisogno di essere un architetto, che si tratta di una tomba. La definizione di Loos riassume dunque al meglio i temi che ruotano attorno all’architettura, ma soprattutto mette in evidenza

2 Ornamento e delitto (titolo originale Ornament und Verbrechen) è un breve saggio scritto da Adolf Loos nel 1908. Fu ripubblicato in tedesco in una raccolta del 1962, poi tradotta in italiano nel 1972 da Adelphi con il titolo Parole nel vuoto.

occorrerà immaginare modelli abitativi alternativi o complementari a quelli esistenti, ridefinire dinamiche legate alla vita, al lavoro e allo svago degli abitanti di metropoli sempre più affollate, ridisegnare i flussi di persone e cose in uno spazio sempre più ristretto, regolare l’integrazione tra un costruito in costante evoluzione e l’ambiente naturale sempre più assediato dalla presenza dell’uomo, infine, se possibile, ricucire lo strappo che si è creato tra uomo e natura.

Knowledge, ethics, common good quality and responsability: these are the words that summarize the fundamental theme under discussion in De Architectura1, written by Marco Vitruvio Pollione, and that ring true today, to describe the state of architecture and the role of the architect.

If, indeed there is no doubt about the influence architecture and design have on our lives, at the same time it is clear how the architectural project should be more focussed on daily life, its dynamics, its rhythms and living habits.

The centre of the project represents a real need that can longer be put off, considering the demo-graphic growth forecasts provided by the United Nations annual report: there will be 8 billion inhabit-ants in 2023, 8.6 billion in 2030; 9.8 billion in 2050 and 11 billion in 2100. We need however to add an observation to this statistic – and that is that this increase in the population will be concentrated only in nine countries: India, Nigeria, Repubblica Demo-cratica del Congo, Pakistan, Ethiopia, Tanzania, the United States, Uganda and Indonesia. India, a country that today has 1 billion, 300 million inhabitants (18% of the world’s population), will become the most populated country, overtaking China (1 billion, 400 million), while the European countries will be the only ones in which a reduction will take place: between 2017 and 20130 going from 742 million to 739 million. Going beyond the numbers, it is far too predictable to

1 De architectura (On Architecture) is an essay in Latin by the Roman architect and engineer Marco Vitruvio Pollione written around 30 and 15 BC. It is the only text on architecture to survive from antiquity and is regarded asthefirstbookonarchitectural theory since the Renaissance.


Numerosi sono stati i progetti che hanno saputo colmare una lacuna, ri-cucire una ferita, esprimere un’energia propositiva, trasformando problemi in opportunità: dal londinese Battersea ParkalmilanesePortaNuova,dall’Hafen City sull’area portuale di Amburgo ai progetti che stanno inte-ressando i quartieri periferici parigini. Numerous projects have been able to fillagap,tohealawoundtoexpresspositive energy, transforming prob-lems into opportunities: from Batter-seaParkinLondontoPortaNuovainMilan, from the port area Hafen City in Hamburg to the projects involving surburban Paris neighbourhoods.

Hafen CityBattersea Park High Line Porta Nuova.

affirm the necessity to design or redesign cities, roads, neighbourhoods, houses and furnishing sys-tems. Something more has to be done: it is necessary to imagine alternative or complementary housing models, to redefine the living, working and free-time dynamics of those ever-increasingly crowded urban centres, to redesign the flows of people and objects in limited spaces, to regulate the integration between constantly evolving buildings and the natural environ-ment that is constantly under attack and finally, if possible, to repair the rift that has been created between man and nature.

Today architecture is a hybrid of all these things, a mix of complexity and synthesis, a union between style and technology, between being and doing, between shape and function. But perhaps it has always been that way. One of the most successful definitions of architecture is provided by one of the pioneers of the Modern Movement Adolf Loos, who said in his famous Ornament and Crime2, written in 1908: “If we find a mound of earth in a wood that is six foot by three... in the shape of a pyramid, we take it seriously and something tells us: there is a body buried underneath. This is architecture”.

This sentence sums up the very meaning of architecture: starting from a well defined place, in this case a wood, a place that has unique and extraordi-nary characteristics,and consequently an environment able to stir up unique thoughts and emotions. Then, all of a sudden, out of nowhere, an artifice appears, a construction, in this case a mound of earth, some-thing that disrupts the balance with nature, triggering a new system of connections. Its presence generates a reaction, provokes a certain frame of mind to those who observe it: seriousness! Architecture, therefore, can, indeed, must generate an emotion, create an instinct to participate in an experience. But not only. Loos’ definition also expresses the experience of building, or man’s need to use tools and techniques to give shape to architecture, in this case a pyramid. A volume with clear-cut geometries, rules and dimen-sions, referring precisely to the human body (6 foot by × 3 foot), is always a benchmark for space (Le Corbusier strongly reaffirmed this, with his Modulor, approximately 50 years later). The rule therefore means awareness: whoever was in front of the pyramid in the forest would immediately understand, without needing to be an architect, that it was a tomb. Loos definition is therefore the best summary of the issues that revolve around architecture, but above all high- lights the complex nature of relations and connec-tions between those who build, those who see and those who live architecture.

While the iconic draw of architecture, remains intact, today, more than 100 years after Loosian style

2 Ornament and Crime: (original title Ornament und Verbrechen) is a short essay, written by the modernist architect Adolf Loos in 1908. It was re-published in German in 1962, later translated into Italian in 1972 by Adelph and entitled Parole nel vuoto.


il complesso mondo di relazioni che si instaura tra chi costruisce, chi guarda e chi vive l’architettura.

Pur rimanendo intatto il potere iconico dell’archi-tettura, oggi, trascorsi più di 100 anni dalla Vienna loosiana, dobbiamo constatare che le dinamiche e i processi legati al progetto si sono profondamente modifi-cati, in particolare perchè non coinvolgono più soltanto architetti e interior designer, ma, in maniera sempre crescente, anche i committenti e i realizzatori. Nella vita “fluida” del nuovo millennio, i ruoli spesso si con-fondono, le competenze, pur restando specifiche, si integrano, gli obiettivi vengono condivisi, i processi si trasformano, le tecnologie evolvono rapidamente.

Le grandi aree ex industriali delle città, europee ma non solo, hanno rappresentato e rappresentano in questo senso un potenziale straordinario. A Londra come a Milano, a Parigi come a Berlino, numerosi sono stati i progetti che hanno saputo colmare una lacuna, ricucire una ferita, esprimere un’energia propositiva, trasformando problemi in opportunità: dal londinese Battersea Park al milanese Porta Nuova, dall’Hafen City sull’area portuale di Amburgo ai progetti che stanno interessando i quartieri periferici parigini. Operazioni caratterizzate tutte dalla massi-ma attenzione all’utilizzo delle risorse. Grandi aree dismesse che tornano a essere strategiche nella trasformazione della città, proponendo spazi condivisi e nuovi luoghi di socialità, nei quali coesistono la dimensione pubblica e quella privata. Le ex-zone industriali, arricchite da piazze coperte intese come nuove agorà, si pongono infatti come volano di attrazione e sviluppo. Ma, un occhio progettuale caratterizzato da una visione comunitaria, non si riferisce unicamente ai luoghi urbani, analoga atten-zione può essere rilevata negli ambienti lounge degli hotel, intesi non più come spazi di passaggio verso l’individualità della propria camera, ma come luoghi di relazione, incontro e business, insomma di vita3. Analogamente si potrebbe leggere anche il fenomeno che porta ad abitare gli “esterni” degli edifici come naturale ampliamento degli “interni”, piuttosto che come “altro da sé”.

Ecco allora che, a scala territoriale, i progetti più riusciti degli ultimi anni sono quelli che hanno saputo interpretare l’identità di una città o di un agglomerato urbano, rafforzandola grazie a interventi in grado di esprimere modernità senza per questo prevaricare sullo spirito del luogo: quartieri ed edifici capaci di integrarsi nel tessuto, esprimendo la contempo-raneità senza per questo cancellare il passato.

3 Nato dal sostantivo anglosassone contract,chesignificaletteralmente “contratto-appalto-accordo”, il contract è divenuto in breve tempo uno dei settori trainanti del furniture design. Con il termine contract si intende, in questo contesto, una fornitura completa “chiavi in mano” di un insieme di prodotti esistenti e/o progettati ad hoc in particolare destinati al settore alberghiero.

3 Originating from the Anglo Saxon noun contract, that literally means “contract-tender-agreement”, the wordcontracthasveryquickly become one of the leading sectors in design. In this context it means acomplete“turn-key”provisionof existing products and\or designed ad-hoc and mainly for hotel and hospitality sector.

Vienna, we have to say that the dynamics and the processes connected to projects have changed enormously, mainly because they no longer involve only architects and interior designers, but clients and creators are increasingly more involved. In this “shifting and unstable” lifestyle of the new millennium roles often overlap, skills, while specific, become integrated, objectives are shared, processes are transformed and technologies evolve rapidly.

It is for this reason then that, on a local scale, the most recent successful projects have been those able to interpret the identity of a city or an urban area, enhancing it with interventions expressiing modernity without abusing the spirit of the place: neighbour-hoods and buildings able to integrate into their social and urban fabric, expressing contemporaneity with-out erasing the past.

In London just as in Milan; in Paris just as in Berlin numerous projects have been able to fill a gap, to heal a wound to express positive energy, trans-forming problems into opportunities: from Battersea Park in London to Porta Nuova in Milan, from the port area Hafen City in Hamburg to the projects involving surburban Paris neighbourhoods. All of the projects are characterised by their attention to the use of resources. Vast abandoned areas that are bought back to life and play a strategic role in the transforma-tion of the city, offering shared common spaces and new areas of sociality, in which the public and private aspects co-exist. The former industrial areas, en-riched by covered squares intended as new agoras, they are in fact a driving force of attraction and development. But a vision characterised by a commu-nity vision does not solely refer to urban areas, the same attention can be given to lounge areas in hotels, no longer intended areas but as areas of relationships, meetings and business, life3. Similiarly, one could see the phenomenonof inhabiting the exterior of a build-ing as a natural extension of the interior rather than something stand alone.

A comparable development operation is under-way even within infrastructure. In a world constantly on the move, airports, stations and even bridges and roads become opportunities to redefine an area, re-weave a social or urban fabric, redevelop a piece of a city or give back some lifeblood to a surburb. The highly successful High Line in New York is an excellent model and there are numerous projects nowadays aimed at redeveloping disused railways, skyways or

The large, former industrial areas of cities, and not only European ones, have been, and still are symbols of extraordinary potential.

10Talking About 1

Beppe Finessi Architetto, nasce a Ferrara nel 1966. Professore associato presso il Politecnico di Milano, è stato redattore della rivista Abitare e dal 2010 dirige Inventario. Ha curato mostre e pubblicazioni sull’opera dei grandi maestri del design italiano, tra cui Munari, Mangiarotti, Castiglioni, Magistretti e Mendini, ma anche sui nuovi protagonisti quali Ulian, Iacchetti, Novembre.

Was born in Ferrara in 1966 and is an architect. He is a Senior lecturer at the Polytechnic of Milan and has been the editor of the magazine Abitare. He has been head of Inventario since 2010. He has curated exhibitions and publica-tionsontheworkofgreatMastersinItaliandesign,includingMunari,Mangia-rotti, Castiglioni, Magistretti and Mendini, as well as new players such as Ulian, Iacchetti, Novembre.

Marco RomanelliDesigner e critico, è nato a Trieste nel 1958. E’ stato redattore di Domus e di Abitare. Si ricordano, tra i molti scritti, le monografie su Gio Ponti, Joe Colom-bo, Gino Sarfatti, Ico Parisi, Bruno Munari, Paolo Ulian, Umberto Riva. Come progettista ha lavorato nel campo degli interni e disegnato per alcune delle più importanti aziende italiane tra cui Driade, O luce, Glas e Fiam.

Was born in Trieste in 1958 and is a designer and critic. He has been the editor of the publications Domus and Abitare.Hiswrittenworksincludetheesteemed monographs on Gio Ponti, Joe Colombo, Gino Sarfatti, Ico Parisi, BrunoMunari,PaoloUlian,UmbertoRiva.Hehasworkedasaninteriordesigner for some of the most important Italian brands including Driade, O luce, Glas and Fiam.

Architettura: ripartendo dalla storia, si afferma la centralità degli interni rispetto al progetto contemporaneo. Architecture: the legacy of interior design continues today, playing a central role in modern architectural projects.Beppe Finessi intervistato da / interviewed by Marco Romanelli

A cura di / curated by Marco Romanelli

25.05.17 h18.30

Teatro Rimadesio, Flagship store Milano, Via V. di Modrone 26

I protagonistiContributors

elevated roads and other infrastructures by giving them a new lease of life, new uses, integrating green areas and cycle paths (Milan must find a clear and effective model amongst these examples for its former rail yards, areas that undoubtedly repre-sent an excellent opportunity for any future develop-ment of the city).

The role of planning these urban changes is not only then the prerogative of technicians, architects, town planners and designers, but is shared between the local communities who, more frequently, play an important role in the decision process.

Other evident examples of this awareness can be found in the new forms of social housing or co-housing, in start-up incubators just as in co-working spaces, through to bike sharing on a micro scale.

The architectural project has therefore trans-formed, in the most expert cases, into an opportunity of technological experimentation, redefinition of type and reorganization of the social and urban fabric. Not to mention the new skyscrapers, that are chang-ing the face of our cities, they are designed down to the slightest detail, almost like precious objects. Architects take advantage of their isolated position to transform them into icons, recognizable, both phyically and metaphorically “from afar”.

A similiar devlopment can also be seen within homes. We see the most prestigious furniture in the living space and the kitchen area, that are conceived as self expressive, micro pieces of architecture, able to communicate through full and empty correlations and tricks of light and shade. Leaving aside the com-mon and banal single material, design is enhanced by combinations of of finishes, materials and different colours. Because nowadays the projects reasoning and the formal imagination are similiar, whether we are talking about architecture or interior design. In both cases, the proportional and dimensional balances between volumes, the correlation between natural and artificial light, colours and the evaluation of the perfor-mance of materials all matter and carry their own weight. In one word: the involvement of all the senses in the use of a space or in the use of an object.

At the same time, the reduction of available space in cities and urban areas that is currently underway and will be even more evident in the future – the OECD foresees that in 2030, two thirds of the world’s population will be living in urban centres4 –, has fostered the concentration of buildings and their vertical development.

4 The Oxfordshire Economic Observatory predicts a 70% increase in growth in the building and con- structionmarketfrom2017to2025.

La prima domanda che voglio fare a Beppe Finessi riguarda unadefinizione:inItaliadiciamoarchitetturadegliinterni(quasi a segnare un antagonismo con una ipotetica architettura degli esterni), ma in inglese si dice, più correttamente, inte-rior design. Non dimentichiamo però che per molti anni non ci si è vergognati di usare la parola arredamento. Che cosa è allora, realmente, l’architettura degli interni?

L’architettura degli interni è quella meravigliosa branca del mondo del pro-getto che, più di altre, si prende cura di noi, in tutto per tutto, e del nostro stare bene, quasi del nostro corpo. In fondo non mi interessa tornare all’eti-mologia delle parole, o recuperare vecchie discussioni sulle definizioni, preferisco rimanere su quel momento in cui un progettista comincia ad occu-parsi di noi, delle nostre case, dei nostri luoghi di lavoro. Di spazi ove staremo ore, giorni, anni, a volte vite intere. Stare comodi su una poltrona a teatro, essere a proprio agio al tavolo di un ristorante, sentirsi bene insieme alla nostra famiglia, quindi vicini agli occhi delle persone che abbiamo scelto, ma, ad esempio, schermati agli occhi degli altri. Spazi progettati ad hoc per regalarci contemporaneamente accoglienza e privacy, protezione e riserva- tezza. Credo siano questi alcuni degli aspetti che raccontano al meglio l’ar-chitettura degli interni.

Preso atto di questa complessità, e intensità, di ruolo, come potremmo tratteggiare oggi la figura dell’architetto in interni?

È innanzitutto un progettista generoso, che non si risparmia, perché l’archi-tettura di interni chiede una quantità infinita di tempo e di dedizione, una positiva tensione verso quei numerosissimi dettagli che dovrà affrontare. Fare architettura degli interni significa porsi problemi alla scala 1:100, 1:50, 1:20, 1:10 fino all’1:1, per non dire, in alcuni casi, del 5:1, del 2:1. Vuol dire regalare a piene mani spunti e intuizioni. Vuol dire disegnare, moltissimo! Franco Albini, progettando un interno, faceva centinaia di disegni. Disegni solo per quel luogo e solo per quella committenza. Per capire come entra la luce in una stanza, per capire come si attraversa una porta, come si accende una lampada, come si apre un armadio. Attenzioni che spesso l’architettura alla grande scala non si preoccupa di avere. Insomma l’architetto in interni incarna, soprattutto oggi, un ruolo assai più faticoso e meno riconosciuto di quelli relativi all’architettura “in esterni” e al design. È un persona che trova piacere nello stare con gli artigiani, e grazie a loro riesce a proporre soluzioni puntuali, innovative e uniche, un persona che continua una tradizione attenta alle arti decorative, e persino alle arti visive, la pittura ad esempio, ma che conosce anche il cantiere con i suoi segreti e le sue fatiche.

Questa che hai tratteggiato è una dimensione che esiste ancora? Oppure oggi il cosiddetto architetto di interni si limita a scegliere dei colori, a inserire dei mobili in uno spazio più o meno banale, più o meno prefissato? Forte dell’esperienza di analisi che hai compiuto nel 2016 per una mostra straordinaria come “Stanze”,

5

quale è la situazione attuale dell’architettura degli interni

in un paese quale l’Italia che ha una fortissima tradizione in

questo campo?

Fortunatamente un gigante quale Umberto Riva lavora ancora, appassionato

e lucido come sempre, continuando ad offrirci un esempio di coerenza, e di

precisione, oltreché regalarci veri capolavori. Lui, e il suo esempio, hanno

condizionato tutti quelli che si occupano di interni in Italia negli ultimi 30

anni. Dopo di lui c’è stata, e c’è, una generazione, di cui tu stesso fai parte

con Marta Laudani, Manolo De Giorgi, Calvi Merlini Moya e pochi altri,

che, sia pur in modi differenti, ha continuato a praticare questa straordinaria

disciplina, persino nelle fatiche di questi anni. E dopo di voi, ancora, autori

molto diversi, ma sicuramente interessanti come Cherubino Gambardella,

Massimo Curzi, Andrea Marcante e Adelaide Testa di UdA o Elisabetta

Terragni, hanno mostrato altre strade possibili, colte e sperimentali. E poi

avanti, fino all’oggi, ove nonostante tutto, alcuni autori nuovi ci sono, come

Francesco Librizzi, come ACT Romegialli, come Antonino Cardillo.

In interni credo esista una grande forbice iniziale: lavorare

sull’arredofisso,ovverosullaconfigurazionedellospazio,oppure lavorare sull’arredo mobile cioè sull’accessoriamento

dello spazio stesso. Già Le Corbusier sosteneva che l’arredo

fissoappartieneall’architettura,mentrel’arredomobileap-

partienealdesign.Noncredichediarredofisso,diattrezzatureper la casa, si parli oggi sempre meno?

Quello di Le Corbusier è un inquadramento che senz’altro vale ancora oggi.

Ma certo si potrebbe provare, e qualcuno già lo sta facendo, ad arrivare ad

un grado di integrazione tra architettura e arredo ancora maggiore, immagi-

nando che alcuni degli elementi che sono tradizionalmente lasciati nell’ambito

dell’ “arredo mobile” possano cominciare ad essere progettati partendo

invece dall’architettura.

Un’altra questione dell’oggi riguarda il modo in cui gli interni

vengono pubblicati. L’ho definisco il problema della natura

morta: le riviste paiono evitare le visioni d’insieme e l’analisi

dello spazio (guarda caso non vengo più pubblicatele piante!)

e propongono piuttosto delle viste di dettaglio, appunto quel-

le che io chiamo “nature morte”. Come si deve pubblicare un

interno?

Capita raramente di vedere pubblicato un interno come meriterebbe. Con

tutte le piante necessarie, le sezioni, i dettagli, e soprattutto un buon numero

di fotografie che possano testimoniare le tante scelte progettuali, le tante

soluzioni inedite messe in gioco dall’autore. Forse è un problema economi-

co: produrre le giuste immagini costa tempo, ma anche fatica, e poi per

comprendere al meglio un progetto occorre una competenza che oggi non

sempre si trova nelle redazioni. Se pensi che la mitica casa di Viganò venne 4

ThefirstquestionIwanttoaskBeppeFinessiregardsadefinition:weliterallysayInteriorArchitectureinItalian(that seems to signal a hypothetical antagonism with

External Architecture) but in English this is more correctly

called interior design. So what really is interior design?

Interior design is that wonderful branch of design that, more any other one,

takescareofus,ofourwell-beinginanentiresenseoftheword–sobothphysicalandmental.Iam,afterall,notreallyinterestedingoingbacktotheetymology of the words themselves or dwelling on past discussions about

definitions,Iprefertofocusonthatmomentwhenadesignerstartstotakecareofus,ourhomes,ourworkplaces.Spaceswherewespendhours,days,years and at times our entire lives. Being comfortable sitting in a theatre seat,

being at ease in a restaurant, feeling good with our families, close to those we

have chosen to be with but protected from others. Spaces that have been

designedandinspiringlypersonalisedthatmakeusfeelwelcomeandathome,ensuringanynecessaryprivacyandprotection.Ithinkthatthesearesome of the aspects that best describe interior design.

Havingtakingnoteofthiscomplexandintenserole,howcanweoutlinetheprofessionalinteriordesignerfiguretoday?

First and foremost an interior designer is a generous designer, because interi-

ordesignrequiresaninfiniteamountoftimeanddedication,apositiveap-

proach to the many details that he will have to deal with. To be an interior

designer means facing problems regarding scale: 1:100, 1:50, 1:20, 1:10…

through to 1:1, and in some cases 5:1, 2:1. It means giving ideas and intuition

profusely.Itmeansdrawingagreatdeal!FrancoAlbiniwouldmakehundreds of drawings while designing an interior design project. Drawings only for that

place and that particular client. To understand how light enters a space, to

understand how you go through a door, how you turn on a light, how you open

a wardrobe. Considerations that are often not included in architecture on a large

scale. In short the interior designer embodies, particularly today, a role rather

morelaboriousandlessacknowledgedthanthoserolesrelatedto“externalarchitecture”anddesign.Itisapersonwhofindspleasureinworkingwithartisans,andthankstothosecollaborationsisabletoproposeinnovativeandunique solutions, a person who continues a tradition that is attentive to decora-

tiveartsandeventovisualarts,takepaintingforexample,butwhoalsoknowsthebuildingsiteandallitssecretsandthehardworkthatgoesoninit.

Does this professional aspect that you have just outlined still

exist? Or do these so-called interior designers limit

themselves to choosing a colour scheme, and adding furniture

to enhance a predetermined space? What is the current

situationofinteriordesigninacountrylikeItalythathasaprolifictraditioninthisfield?

LuckilyaMastersuchasUmbertoRivacontinuestoworkaspassionatelyand as clear-headed as ever, continuing to offer us a model of coherency and

precisionaswellasgivingusrealmasterpieces.Heandhismodelofworking

7 6 7

pubblicata da Gio Ponti due volte, a poco tempo di distanza, sia vuota che arredata… Oggi si fa fatica ad andare oltre le 6/8 fotografie, mentre magari l’autore ha disegnato 100 dettagli originali e ha impiegato un paio di anni di intenso lavoro per completare il progetto. Qualche tempo fa sono stato un paio di ore a cercare di convincere il direttore editoriale di una delle più grandi case editrici italiane a pubblicare un intero volume dedicato a una casa specifica: un vero capolavoro che avrebbe meritato di essere raccontato con almeno 200 immagini e 50 disegni. Dopo un po’ che peroravo la causa, citando esempi storici luminosi, come la Maison de Verre di Chareau oppure la Villa Mairea di Aalto, questi mi disse: “un libro, tutto un libro solo su una casa??? Ma a chi vuole che interessi!!!”. Ecco, quello che voglio dimostrare è che la “non consi-derazione” del valore degli interni tocca oggi non solo i “giornalisti”, ma persino persone che del progetto dovrebbero sapere tutto!

E come si può insegnare oggi l’architettura degli interni? Che cosa è cambiato nell’offerta formativa rispetto alla situa-zione che hanno vissuto i maestri dell’architettura italiana?

L’insegnamento dell’architettura degli interni risente del problema più gene-rale delle nostre università. Personalmente ho la fortuna di essere al Politec-nico di Milano, alla Scuola del Design, che è un luogo oggettivamente di eccellenza, ma il problema è che, con la riforma di qualche anno fa, ognuno di noi docenti ha la possibilità di stare con gli studenti solo per 3 o 4 mesi, per 12 o 13 lezioni, e poi i corsi finiscono, e non ci sono momenti ulteriori. Se pensiamo all’architettura degli interni che abbiamo appena descritto, con i suoi tempi, il tipo di attenzione, quasi di dedizione che bisogna darle, diventa difficile accompagnare gli allievi in un simile percorso, che dovrebbe essere immersivo, quasi totalizzante, con continue verifiche, ripensamenti, prove, ecc.Tuttoquestoavrebbebisognodimoltimesi,enoi–nellostarecongliallievi–avremmobisognodimoltopiùtempoperincidererealmentesulloropercorso. Se penso a quanto siano state importanti le centinaia di giornate che ho passato con Corrado Levi, mio maestro, o con Angelo Mangiarotti, e ai periodi trascorsi con Sottsass, Mari, Mendini o Munari, ecco se penso alla fortuna che ho avuto, e al tempo che ho potuto (e certamente voluto!) dedica-re a quella parte della mia formazione, mi spiace molto per questa generazione chevienespinta–dalleriformeuniversitarie,maanchedalclimagenerale, eforsepersinodallacrisieconomica–adaverefretta!Laformazionedelprogettista, come il progetto, deve avere tempi lunghi: per trovare se stessi bisogna regalarsi il giusto cammino.

Per chiudere, pensando alla generazione dei “maestri”, ovvero dei progettisti italiani operativi dal secondo dopoguerra, vuoi citare un caso particolare?

Sono tanti gli incontri speciali avuti in molti anni con questi generosi maestri. Nota bene, incontri che spessissimo prendevano vita proprio sul tema degli interni. Ricordo una discussione con quel gigante che era Sottsass, una sera a cena, quando ci ha spiegato che una bella casa non è altro che una finestra con la luce giusta, che illumina un vaso di fiori e guarda un paesaggio a noi caro. Ecco, basta poco, forse pochissimo.

6

haveconditionedallofthosewhohavebeenworkingintheinteriordesignfieldinItalyoverthelast30years.Followinginhisfootstepstherehasbeenand there is a generation, which you too are part of, together with Marta Laudani, Manolo De Giorgi, Calvi Merlini Moya and a few others, who, have continued,topracticethisextraordinarydiscipline,despitethedifficultiesofthese recent years. And after your generation thare are some interesting talentslikeCherubinoGambardella,MassimoCurzi,AndreaMarcanteandeAdelaide Testa from UdA or Elisabetta Terragni, who have outlined other potential paths. And then onwards to current times where against the odds there are some new players such as Francesco Librizzi, ACT Romegialli, and Antonino Cardillo.

Ibelievethatthereisabigdivideininteriors:workingonpermanentdecororratherspacelayoutorworkingonmovablefurnishings meaning accessorising the space itself. Le Corbusier endorsed the idea that permanent decor belonged to the world of architecture while movable furnishings to design.Don’tyouthinkthatwespeakincreasinglylessaboutpermanent decor, home equipment nowadays?

Le Corbusier’s endorsement still has weight today. Certainly you could try, and someone is already doing so, to improve the integration between architecture and design, imagining that some of those elements traditionally considered as “movable furnishings” can start to be designed from an architectural origin.

Nowadays another issue regards the way interiors are published.Idefineitastheproblemofdeadnature:magazinesseem to avoid visions of the whole and the analysis of the space (it is no coincidence that plants are no longer published) and they propose views of detail, and that is precisely what I call “dead nature”. How should interiors be published?

It doesn’t happen very often to see interiors published as they deserve to be. Perhapsitisabudgetissue:producingtherightimagestakestimeandeffortandthenunderstandingaprojectrequiresacertainskillsetthatisnotalwayseasilyfoundineditorialstaffnowadays.JustthinkthatthelegendaryhouseofViganò was published twice by Gio Ponti and was shown empty and fur-nished...Todayitisdifficulttogobeyond6or8photos,butthedesignerhasperhapsdrawn100originaldetailsandtheprojecthastakenagreatdealoftimeandhardwork.Sometimeback,Ispentafewhourstryingtoconvincetheeditor-in-chief of one of the biggest Italian publishing houses to publish an entirevolumededicatedtoonespecifichouse:atruemasterpiecethatdeserved to be dedicated at least 200 pictures and 50 drawings. After some time spent supportingmyidea,andmentioningsomevirtuoushistoricalexampleslikethe Maison de Verre by Chareau or the Villa Mairea by Aalto, they turned round andsaid:“abook,awholebookforjustonehouse?Whoisgoingtobeinterestedinthat??”.Yousee,whatIwantedtohighlightisthatthislackofconsideration,this undervaluation of interiors doesn’t just affect “journalists” but even those peoplewhoshouldknoweverythingabouttheproject!

19 Architecture

Un meccanismo di sviluppo paragonabile è in corso persino per quanto concerne le infrastrutture. In un mondo in perenne movimento, sempre più spesso aeroporti, stazioni, ma anche ponti e strade, diventano occasioni per ridefinire un territorio, riannodare un tessuto, riqualificare un brano di città o restituire linfa vitale a una periferia. La riuscitissima High Line di New York ha fatto scuola e sono numerosi oggi i progetti che mirano al recupero e alla riqualificazione di ferrovie dismesse, di strade sopraelevate o di altre infrastrutture mediante l’inserimento di nuove funzioni, l’integrazione del verde e di piste ciclabili (in questi modelli Milano deve trovare un esempio, chiaro e fattivo, per i progetti di recupero degli ex-scali ferroviari, aree che rappresentano, senza dubbio alcuno, una grande possibilità per lo sviluppo futuro della metropoli lombarda).

Altri esempi evidenti di questo movimento di consapevolezza possono essere trovati nelle nuove forme di social housing o di co-housing, negli incubatori di start up così come negli spazi di co-working, per arrivare alla micro-scala del bike sharing.

In parallelo, la riduzione dello spazio disponibile nelle metropoli, già attualmente ma a maggior ragio-ne in futuro – l’Ocse prevede che nel 2030, due terzi dell’umanità sarà insediata in centri urbani4 –, ha favorito la concentrazione degli edifici e il loro sviluppo verticale. Il progetto architettonico si è così trasfor-mato, nei casi più virtuosi, in un’occasione di sperimen-tazione tecnologica, di ridefinizione tipologica e di riorganizzazione del tessuto. Senza contare che i nuovi grattacieli, che stanno trasformando il volto delle città, vengono oggi disegnati fin nel più piccolo dettaglio, quasi come oggetti preziosi. Gli architetti approfittano infatti del posizionamento isolato di questi grandi oggetti per trasformarli in icone, riconoscibili, sia fisicamente che metaforicamente, “da lontano”.

Si può rilevare come un meccanismo in certo modo analogo si verifichi anche all’interno delle case, con gli arredi più importanti, destinati al living o alla cucina, ormai concepiti come micro-architetture auto-espressive, capaci quindi di parlare attraverso rapporti di pieni e di vuoti, giochi di luci e di ombre. Dimenticando la banale mono-matericità, il design si arricchisce di accostamenti tra finiture, materiali e

Il ruolo della progettazione nel cambiamento della città non è dunque più appannaggio dei soli tecnici, architetti, urbanisti, designer, ma viene realmente condiviso con le comunità locali che, sempre più spesso, si pongono come protagoniste dei processi decisionali.

4 L’Osservatorio di Oxford Economics prevede inoltre una crescita da qui al 2025 del mercato mondiale delle costruzioni, intorno al 70%.

8

What about teaching interior design today? What has changed in the education and training opportunities compared to those of the past masters of Italian Architecture?

Teaching interior design is affected by the more general problem of our universities.PersonallyspeakingIamluckytobeatthePolytechnicofMilan,attheSchoolofDesign,which,objectivelyspeaking,isaplaceofexcellence, but the problem is that with the recent reform, we teachers stay with students only for 3 or 4 months, for 12 or 13 lessons and then the courses finish,andthatisit.Ifwethinkaboutthepreviousdescriptionofinteriordesign, with its timescales, the type of attention or better, dedication, it requires, itbecomesdifficulttoaccompanystudentsalongthispath,whichshould beintensive,almostall-absorbingwithperiodicchecks,reconsiderationsandtests. All this would require months and we would need much more time in ordertoreallyinfluencetheircareerpaths.IfIthinkabouttheimportanceofthose hundreds of days I spent with my master, Corrado Levi, or with Angelo Mangiarotti, and the time spent with Sottsass, Mari, Mendini or Munari, well IthinkhowluckyIhavebeenandaboutthetimeIcould(andcertainlywantedto) dedicate to that part of my education and training, and I feel sorry for this generation who have to rush things through for a number of different reasons including university reforms and the economic crisis. The designer’s educa-tionandtraining,justlikeanyproject,isalongprocess:tofindyourselfyouneedtofindtherightpath.

Towrapupthen,thinkingaboutthegenerationof“Masters”,thatistosaythoseItaliandesignerswhohavebeenworkingsince the Second World War, would you care to quote a par-ticular one?

Over all these years there have been a great number of special encounters with these generous masters. I should say that these encounters often came alive because of interior design. I can remember a discussion with the master Sottass one evening over dinner, when he explained that a beautiful home is nothing more than a window with the right light, that illuminates a vase of flowersandframesapicturethatisdeartous.Thereyouare,itdoesn’ttakemuch, perhaps not a lot at all.


colori differenti. Perché davvero le logiche del progetto e l’immaginario formale sono oggi analo-ghi, sia che si tratti di architettura che di interior. In un caso e nell’altro, naturalmente sempre facendo riferimento alle situazione di ricerca più felici, varranno gli equilibri proporzionali e dimensionali tra i volumi, il rapporto degli artefatti con la luce naturale o artificiale, le valenze cromatiche e la valutazione della resa dei materiali su diversi supporti:

Conseguentemente viene by-passata quella scissione di ruoli che aveva portato, in un recente passato, l’architetto artefice dell’edificio a disinteressar-si degli interni e delle finiture. Al contrario si ripropone oggi, citando gli inizi del Modernismo, un pensiero organicamente unitario capace di guidare le scelte e di definire sia gli aspetti funzionali che quelli estetici fin dalle prime fasi del concept.

Lo spirito del passato lascia spazio a strutture aperte nelle quali “il dentro e il fuori” si compenetrano senza soluzione di continuità, in un’osmosi favorita da scelte di superfici e materiali sempre più performanti anche in ambito outdoor. Ecco allora che è facile ipotizzare, anzi è già possibile verificare, una città in cui non esisteranno più le strade e gli edifici che vi si affacciano, ma piuttosto la compenetrazione di entità, con spazi privati che integrano funzioni pubbliche e ambienti pubblici che ospitano al proprio interno attività private diversificate.

A segnare una significativa, possibile variazione nella visione della progettazione di interni, smaltita la sbornia degli open space5 e dei loft, le tendenze più attuali cercano di recuperare un giusto equilibrio tra sfera pubblica e privata, tra condivisione e privacy, tra omologazione e personalizzazione degli spazi. E questo avviene, al di là della forma e dello stile, soprattutto grazie al lavoro sulla materia, segnato parallelamente dalla riscoperta di materiali del passato e dalla speri-mentazione di nuove futuribili superfici ad alta presta-zione, caratterizzate da texture sofisticate, accosta-menti e rapporti cromatici inediti.

Il mondo del progetto, a qualsiasi scala, vive dunque oggi un momento di ridefinizione delle regole, una fase di passaggio dal formalismo a una maggiore coerenza e consapevolezza della necessità di andare oltre le mode e le tendenze. Architetti e interior desi-gner non possono più prescindere da una conoscenza

in una parola il coinvolgimento di tutti i sensi nella fruizione di uno spazio o nell’utilizzo di un oggetto. Come dicevamo architettura e, scendendo di sca-la, interior design si fondono e le divisioni formali e concettuali fra interno ed esterno si annullano.

5 Il termine open space (letteralmente “spazio aperto”) indicava origina- riamenteunaconfigurazionedispazi di lavoro non frammentati in piccoli ambienti, ma unitari. Questo schema, ampiamente condiviso a partire dalla metà degli anni ‘50, è stato da tempo messo in discussione. Parallelamente però il termine ha trovato un nuovo impiego nell’interior design ad indicare una planimetria in cui le tradizionali suddivisioni funzionali non fossero rispettate.

The spirit of the past leaves room for open structures in which “the inside and the outside” interpenetrate, leaving no solution of continuity, an osmosis of surfaces and materials that are increasingly more performing and include the outdoor sector.

As we said, architecture and interior design merge together and there are no longer formal and con-ceptual divisions between internal spaces and external ones.

Consequently the division of the architect’s role, that had led to them being considered as disinterested in interior design and furnishings has been avoided. On the contrary, today a new organi-cally uniform thought is being proposed again, quoting the beginnings of Modernism, able to guide choices and to define both the functional and aes-thetic aspects from the early concept stages.

That is why it is then easy to hypothesize, in fact it is now possible to verify, a city in which roads and buildings no longer exist, in their place there is an interpenetration, an osmosis of entities, with private spaces that integrate public uses and public areas that host their own, different private activities.

Marking a significant, potential variation on the vision of interior design, following the enthused buzz around open space5 and lofts, the most current trends try to redevelop the right balance between the public and private sectors, between sharing and privacy, between homogenisation and personalization of space. And this happens, regardless of form or style, thanks to research and envelopment on the matter, and at the same time to to the rediscovery of materials from the past and to the experimentation of new feasible high performance surfaces, characterized by sophisticated textures,combinations and innovative colour associations.

The project then, on any scale, is experiencing a redefining of its rules and regulations, a transition phase from formalism to greater consist-ency and awareness of the need of going beyond fads and trends. Architects and interior designers can no longer overlook the importance of a trans-versal and in-depth knowledge of the most innova-tive materials, technologies and systems on the market, as well as the ability to develop economic strategies, manage timing, formulate hypotheses for re-use and transformation.

Also in this sense the role of the architect or designer has changed dramatically.

5 The term open space originally indicatedalay-outofworkspaces that were not fragmented into smaller officesorworkingenvironments. This system, widely used from the midfiftiesonwardshasbeen questioned for a while. At the same time, howver, the term has found a new use in interior design and and indicates a layout in which the traditional subdivisions are no longer conformed to.


trasversale, e allo stesso tempo approfondita, dei materiali, delle tecnologie e dei sistemi più innovativi disponibili sul mercato, così come dalla capacità di sviluppare strategie economiche, di gestire tempisti-che, di formulare ipotesi di riutilizzo e trasformazione. Anche in questa accezione il ruolo dell’architetto, o del progettista più in generale, è profondamente cambiato.

Sebbene l’architetto abbia sempre saputo, seppur con le doverose distinzioni per ogni epoca, mixare al meglio competenze tecniche e talento arti-stico, bisogna rilevare come oggi esistano, e si stiano diffondendo, metodologie progettuali innovative e nuove forme di rappresentazione che possono sostituire, o meglio affiancare, alcune mansioni dell’architetto: facciamo riferimento, ad esempio, al design parametrico o la progettazione generativa che intervengono nelle fasi iniziali del progetto. Per quanto sia chiaro che tali strumenti non potranno sostituirsi all’ideazione, al pensiero, in una parola alla creatività, tuttavia è necessario, sia pur soltanto per poterli sfruttare al meglio, conoscerli.

Si pone quindi, anche per l’architettura, la questione essenziale del sapere e, conseguentemente, dei livelli di formazione, del ruolo delle università, ovvero della capacità della scuola di formare i proget-tisti di domani. Nel tempo i corsi di laurea in archi-tettura e design si sono frammentati in declinazioni e specializzazioni sempre maggiori. Ne è un esem-pio la crescente attenzione al tema della sostenibili- tà e del progettare consapevole e la proliferazione di corsi di studio che approfondiscono le tematiche dell’efficienza energetica, della conoscenza e del rispetto del territorio, della consapevolezza delle conseguenze sull’ambiente di ogni azione compiuta dall’uomo. Nelle migliori facoltà di architettura6, sempre più spazio viene dato all’aspetto green della progettazione, come confermano alcune recenti statistiche sugli atenei: dai piani didattici dell’Univer-sity of Hong Kong a quelli dell’University of Carolina, dai corsi di Architettura Sostenibile della Norwegian University of Science and Technology, al corso di Architettura Ambientale del Politecnico di Milano alle proposte delle numerose università anglosasso-ni come The University of Sheffield o The Sydney School of Architecture, Design and Planning.

Ma la conoscenza non si crea solo a scuola: il progetto architettonico, o quello di un prodotto industriale, coinvolgono oggi moltissimi referenti. È perciò necessario che si inneschi un rapporto virtuoso tra il progettista e una struttura tecnica dotata di una specializzazione cosi sofisticata da essere necessaria-mente interna alle aziende produttrici di materiali, soluzioni o prodotti finiti. Parallelamente questa com-plessità del processo progettuale ha spinto alcuni studi di architettura a dotarsi di competenze interne specifi-

6 Secondo i risultati dell’ultimo QS (Quacquarelli Symonds) World UniversityRankings,2017,nellatopten delle migliori università al mondo: Massachusetts Institute of Technology (MIT); The Bartlett School of Architecture (UCL University College London); Delft University of Technology Netherlands; University of California,Berkeley (UCB); ETH Zurich (Swiss Federal Institute of Technology), Manchester School of Architecture; Harvard University United States; University of Cambridge; National University of Singapore (NUS); University of Hong Kong (HKU).

È necessario che si inneschi un rapporto virtuoso tra il progettista e una struttura tecnica dotata di una specializzazione così sofisticata da essere necessaria-mente interna alle aziende produttrici di materiali, soluzioni o prodotti finiti.It is therefore necessary that a virtuous relationship between the designer and a technical support team equipped with such sophisticated specialization neces-sary to be inside the actual companies producing materials, solutions or finished products.

I grandi studi hanno saputo dare vita a team di lavoro paralleli, sovente dedicati all’interior design, attraverso il trasferimento di un metodo, nato in ambito architetturale, nel progetto degli interni e del prodotto. Thebigfirmshavebeenabletocreateparallelworkteams,oftendedicatedto interior design, through the trans-ferral of a method, coming from the architecturalfield,interiordesignorproduct design.


che su tecnologie di progettazione innovative, model-lazione, materiali, tecnologie sostenibili, senza per altro scardinare l’idea che il sapere possa risiedere anche altrove, ad esempio nelle botteghe artigiane, presso i trasformatori di materiali, con i quali lo studio deve tenere aperto un dialogo costante e costruttivo. Da Aecom a Gensler da Nikken Sekkei a Hok o ancora da OMA di Rem Koolhas a Foster + Partners, da Zaha Hadid Architects a Renzo Piano Building Workshop, i grandi studi hanno saputo dare vita a team di lavoro paralleli, sovente dedicati all’interior design, attraverso il trasferimento di un metodo, nato in ambito architetturale, nel progetto degli interni e del prodotto. Tuttavia, anche nella condizione attuale di un “sistema architettura” globalizzato che ha trasformato gli studi in entità evolute (sono oltre 50 le società di progettazione al mondo con più di 200 professionisti, 20 quelle con più di 500 persone, 5 superano ampiamente i 1000 dipendenti7), contraddi-stinte dalla presenza di competenze differenti, si assiste a un fenomeno non prevedibile fino a poco tempo fa ovvero la collaborazione di progettisti dislocati in continenti diversi, che dialogano in tempo reale su piattaforme progettuali comuni.

Ecco allora che, proprio nell’epoca della specializzazione assoluta e della iper-segmentazio-ne delle conoscenze, vogliamo credere che all’ar-chitetto rimarrà l’arduo quanto stimolante compito di guardare oltre. Ci auguriamo, per concludere, che il progettista possa, in un futuro ormai prossi-mo, esprimere non solo la capacità di dare la forma corretta, per citare la celebre sentenza rogersiana, tanto al cucchiaio quanto alla città, ma anche guidare e alimentare trasformazioni e processi di sviluppo capaci di influenzare positivamente la vita dell’uomo sul pianeta.

Le esperienze e le professionalità più diverse si integrano dunque oggi nel progetto d’architettura, ma non è ancora sufficiente infatti tale progetto sarà chiamato a confrontarsi sempre più spesso anche con altre espressioni della creatività: dalle arti figurative alla musica, dalle scienze sociali alla psicologia.

7 Società di progettazione al mondo con più di 1000 dipendenti: Aecom USA, 1.370 architetti; Gensler USA, 1.346; IBI Group Canada,1.129;NikkenSekkeiJapan, 1.109; Aedas, China/UK, 1.078.

However, it is clear that such tools are no substi-tute for ideation and creativity but it is necessary to know them even if only to make the most of them.

So then, also for architecture the essential question of knowledge arises and therefore, levels of training, the role of universities, or rather the ability of educational institutions to educate and train the designers of the future come under discus-sion. Degree courses in Architecture and Design have, over time, become fragmented into declina-tions and broken down into specializations. An example of this is the growing attention to sustaina-bility and the ability to design consciously and the wide range of courses that analyse energy efficien-cy, awareness and respect of the territory and the awareness of the impact human actions have on the environment. In the best architecture faculties6, increasing importance is given to green buildings and their design as some recent University statistics confirm: from the University of Hong Kong to the University of Carolina, from the course on Sustaina-ble Architecture at the Norwegian University of Science and Technology, to the course on Envirno-mental Architecture at the Polytechnic of Milan to the offerings from the numerous Anglo Saxon universities such as The University of Sheffield or The Sydney School of Architecture, Design and Planning.

But knowledge is not created only at school: nowadays the architectural project or the industrial product project involve a great number of profes-sionals. It is therefore necessary that a virtuous relationship between the designer and a technical support team equipped with such sophisticated specialization necessary to be inside the actual companies producing materials, solutions or finished products. At the same time this complexity has made some architecture firms acquire in-house skills and know-how on innovative design technologies, modelling, materials, sustainable technologies, without however, undermining the fact that knowl-edge can be found elsewhere, for example in artisan

Although the architect has always known, albeit with the necessary distinctions for every era, how to combine in the best possible way their tech-nical skills with artistic talent, it must be said that today there are new innovative design methods and new forms of representation that are able to substitute or flank some of the architects tasks: for example parametric design or generative design at the initial phases of a project.

6 According to the latest QS (Quac quarelli Symonds) World University Rankings,2017,thetop10universities in the world include: Massachusetts Institute of Technology (MIT); The Bartlett School of Architecture (UCL University College London); Delft University of Technology Netherlands; University of California, Berkeley (UCB); ETH Zurich (Swiss Federal Institute of Technology), Manchester School of Architecture; Harvard University United States; University of Cambridge; National University of Singapore (NUS); University of Hong Kong (HKU).


Proprio nell’epoca della specializzazione assoluta e della iper-segmentazione delle conoscenze, vogliamo credere che all’architetto rimarrà l’arduo quanto stimolante compito di guardare oltre. (...) guidare e alimentare trasformazioni e processi di sviluppo capaci di influenzare positivamente la vita dell’uomo sul pianeta.Precisely in the age of unlimited specialization and hyper segmentation of know-how, we want to believe that the challenging but stimulating task of looking beyond will be left to the architect. (...) drive and stoke transformations and processes of development capable to positively influ-ence our lives.

Il progetto d’architettura, sarà chiamato a confrontarsi sempre più spesso anche con altre espressioni della creatività: dalleartifigurativeallamusica,dallescienze sociali alla psicologia.The architecture project will have to measure itself increasingly more against other expressions of creativity: from thefigurativeartstomusic,fromsocialscience to psychology.

workshops, in material transformation laboratories, with whom the firm must have an open and construc-tive working relationship. From Aecom to Gensler from Nikken Sekkei to Hok or from OMA founded by Rem Koolhas to Foster + Partners, from Zaha Hadid Architects to Renzo Piano Building Workshop, the big firms have been able to create parallel work teams, often dedicated to interior design, through the trans-ferral of a method, coming from the architectural field, interior design or product design. However, even in the current condition of a globalised “archi-tecture system” that has transformed the firms into progressive and fully developed ones (there are over 50 companies in the world with more than 200 professionals, 20 with 500 resources, 5 exceed 1000 employees7), distinguished by the presence of differ-ent skill-sets, there is a phenomenon that is the collaboration of designers located in different conti-nents who dialogue in real time on a common plat-form. The most diverse experiences and professionals are now integrated within an architectural project, but it is not yet enough as this project will have to measure itself increasingly more against other expres-sions of creativity: from the figurative arts to music, from social science to psychology.

That is why, then, precisely in the age of unlimit-ed specialization and hyper segmentation of know-how, we want to believe that the challenging but stimulating task of looking beyond will be left to the architect. In conclusion, we hope that the designer can, in the near future, not only express the ability to give the correct form, but also drive and stoke transforma-tions and processes of development capable to positively influence our lives.

7Architecturalfirmswithover1,000 employees: Aecom USA, 1,370 architects employed; Gensler USA, 1,346; IBIGroupCanada,1,129;Nikken SekkeiJapan,1,109;Aedas,China/ UK, 1,078.

Questo progetto è stato reso possibile grazie al lavoro di:This project is made possible thanks to the work of:

Concept: Paolo MojoliCurated by: Marco RomanelliGraphic design: JumaTranslation: Samantha CrowleyFilms and print: OptimaPrinted in Italy January 2018

Rimadesio spaVia Furlanelli 96 – 20833 Giussano (Mb), Italytel +39 0362 3171 – fax +39 0362 317317www.rimadesio.it – [email protected]

Ecology

Talking AboutII/IV

P. 3 Nuovi modelli di sviluppo. Dalla rivoluzione industriale al rinascimento dell'ecologia. New growth paths. From the industrial Revolution to the ecological Renaissance. A cura di / curated by Rimadesio

P. 11 Ecologia: etimologia e storia di una parola daidiversisignificatierisvolti. Ecology: the etymology and history of a word from different meanings and implications. Marco Belpoliti intervistato da / interviewed by Stefano Salis

Index Ecology

3 Ecology

Tra le città invisibili di Italo Calvino, c’è anche Leonia1, una città che ogni giorno rifà se stessa: produce, ac-cumula e getta via. Il risultato è che “ogni anno la città s’espande, e gli immondezzai devono arretrare più lontano; l’imponenza del gettito aumenta e le cataste s’innalzano, si stratificano, si dispiegano su un perimetro più vasto. [...] E’ una fortezza di rimasugli indistruttibili che circonda Leonia, la sovrasta da ogni lato come un acrocoro di montagne. [...] Più ne cresce l’altezza, più incombe il pericolo delle frane: basta che un baratto-lo, un vecchio pneumatico, un fiasco spagliato rotoli dalla parte di Leonia e una valanga di scarpe spaiate, calendari d’anni trascorsi, fiori secchi sommergerà la città nel proprio passato che invano tentava di respin-gere, mescolato con quello delle altre città limitrofe, finalmente monde: un cataclisma spianerà la sordida catena montuosa, cancellerà ogni traccia della metro-poli sempre vestita a nuovo”. Una città-simbolo di un mondo che Calvino estremizza, per metterne in luce gli elementi contraddittori e potenzialmente catastro-fici. Ma non si tratta solo di una lugubre profezia: il 20 dicembre 2015 a Shenzhen, nella Cina Meridionale, una collina di rifiuti alta 100 metri è franata sotto la pioggia battente, travolgendo decine di costruzioni e seppellendo almeno 85 persone. La collina esisteva da appena due anni ed era in continua ascesa: vi veniva-no impilati i detriti prodotti dal boom dell’edilizia. Italo Calvino scrisse di Leonia nel 1972, ovvero negli anni in cui la preoccupazione per le conseguenze del nostro modello di sviluppo economico e di consumo iniziava a farsi largo, anche tra il grande pubblico, por-tando alla ribalta, trasformandola, la nozione stessa di ecologia. Lo scienziato Ernst Haeckel ha coniato

Nuovi modelli di sviluppo. Dalla rivoluzione industriale al rinascimento dell'ecologia.New growth paths. From the industrial Revolution to the ecological Renaissance.A cura di / curated by Rimadesio

1 Leonia fa parte del romanzo di Italo Calvino Le città invisibili, pubblicato da Einaudi nel 1972.

54 EcologyTalking About

il termine nel 1866, definendola come “la scienza dell’in-sieme dei rapporti degli organismi col mondo esteriore”.

L’idea che il “mondo esteriore” possa essere trasformato su grande scala dall’intervento dell’uomo non è così recente. Nel 1695 il naturalista John Woos-dward Williamson sostenne che il disboscamento e la coltivazione a opera dei coloni in Nord America aveva permesso di migliorare la qualità dell’aria. Nei decenni a seguire divenne una credenza comune che gli inverni meno severi e le estati più miti fossero il frutto benefico della deforestazione. La concezione medie-vale del mondo animale e della natura, come qualcosa di misterioso e altro da noi, dominato da forze magi-che o religiose, irrazionali e incontrollabili, aveva lasciato il posto alla convinzione che il genere umano potesse, grazie alla scienza e alla tecnica, dominare, disporre e trasformare a proprio piacimento l’ambien-te circostante, e che questo fosse a beneficio delle “magnifiche sorti e progressive” dell’uomo. Fu solo nel XX secolo che il giudizio circa l’impatto della specie umana cominciò a cambiare di segno, fino ad alimentare il timore che l’ecosistema potesse risultarne irrimediabilmente sconvolto, senza un punto di ritorno.

Nei decenni successivi, nonostante il dibattito sull’ef-fettivo nesso di causalità, crebbero in diverse discipline i riscontri empirici delle conseguenze dell’impatto sull’ambiente, a tal punto da alimentare il sospetto che l’impronta dell’uomo stesse diventando così profonda da sfidare le forze della natura nello scandire il funzio-namento del pianeta. Nel 2000 il premio Nobel per la chimica Paul Crutzen e il biologo Eugene F. Stoermer proposero alla comunità scientifica di adottare il termine Antropocene2: l’impatto dell’uomo era stato così forte da avere segnato l’inizio di una vera e propria epoca geologica, distinta dall’Olocene. Sedici anni più tardi un gruppo internazionale di scienziati del British Geological Survey, è arrivato a datarne l’inizio alla metà del XX secolo sulla base di un’ampia gamma di marcatori antropici e di variazioni funzionali del siste-ma Terra presenti nelle registrazioni stratigrafiche. L’ufficializzazione dell’Antropocene come nuova era geologica è ora al vaglio dell’Unione Internazionale delle Scienze Geologiche, ma a prescindere dall’esito, l’idea che l’intervento umano abbia potuto cambiare

2 Antropocene è un termine coniato negli anni ottanta dal biologo Eugene Stoermer. Fu adottato dal Premio Nobel per la chimica Paul Crutzen nel libro Benvenuti nell'Antropocene. L'uomo ha cambiato il clima, la Terra entra in una nuova era, Mondadori, 2005.

Nel 1938 l’ingegnere Guy Stewart Callendar analizzò il contestuale innalzamento delle temperature e della concentrazione di biossido di carbonio nell’aria, avanzando l’ipotesi che alla base di questa correla-zione ci fosse un nesso causale. Fu una delle prime “registrazioni” delle trasformazioni dell’ambiente.

Leonia1 is one of Italo Calvino’s invisible cities, it is a city that refashions itself every day: it produces, accumulates and discards. The result is that “each year the city expands, andthe street cleaners have to fall farther back.The bulk of the outflow increases and the piles rise higher, become stratified, extend over a wider pe-rimeter. [...] A fortress of indestructible leftovers surround Leonia dominating it on every side, like a chain of mountains. [...] The greater its height grows, the more the danger of a landslide looms: a tin can, an old tyre, an unravelled wine flask, if it rolls towards Leonia, is enough to bring with it an avalanche of unmatched shoes, calendars from bygone years, withered flowers, submerging the city in its own past which it had tried in vain to reject, mingling with the past of the neighbouring cities, finally clean. A cat-aclysm will flatten the sordid mountain range, can-celling every trace of the metropolis always dressed in new clothes”. It is almost a model or symbol city that Calvino takes to extremes in order to reveal the potential contradictory and catastrophic elements. But it is not just a grim prophecy: on the 20th of December 2015 in Shenzhen, in Southern China, a 100 metre hill-like pile of rubbish collapsed under heavy rain, devastating tens of buildings and burying at least 85 people. That hill-like pile had been there for two years and it was forever getting bigger: the debris produced by the building boom were heaped up there. Italo Calvino wrote about Leonia in 1972,

1 Leonia is part of Italo Calvino's novel Invisible Cities, published by Einaudi in 1972.

6Talking About

La rincorsa all’industrializzazione, o “grande accelerazione”, ha messo in crisi la sostenibilità del modello economico nato con la rivoluzione industriale. The pursuit of industrialization or the “great acceleration” has jeopardized the sustainability of the post-industrial revolution economic model.

Oggi 7.3 miliardi di persone consu-mano circa 14 miliardi di tonnellate equivalenti di petrolio. / Today, 7.3 billion people consume about 14 billion tonnes of oil equivalent.

14in the years when the concern for the consequences that our model of economic and consumer devel-opment began to shift, even amongst the general public, overturning and transforming the very no-tion of ecology. The scientist Ernst Haeckel coined the word in 1866, defining it as “the study of the relationship of organisms with their environment”.

The idea that the “outside world” or the envi-ronment can be transformed on a large scale by man is not such a recent one. In 1695 the English naturalist John Woodward Williamson, claimed that deforestation and cultivation by colonists in North America led to an improvement in air quality. With time, it was common belief that the milder winters and the cooler summers were some of the benefits of deforestation. The medieval idea of the animal world and of nature, as something mysterious, some-thing different to us, dominated by irrational and uncontrollable magical or religious forces, gave way to the insight that mankind could, with the help of science and technology, dominate, command and transform to its liking its surroundings and that this was for the good of the “extraordinary and progres-sive fate” of man.

It was only in the 20th century that the judg-ment on the impact of mankind began to change direction, stoking the fear that the ecosystem could be irreparably disturbed reaching a point of no return. In 1938 the engineer Guy Stewart Callendar analysed the concurrent rise in temperature and the concentration of carbon dioxide in the air, hypothe-sizing a connection between the causes. It was one of the first “registrations” on environmental change. In the following decades, despite the debates on the connection between causes, the empirical findings on the environmental impact of man developed to such an extent as to fuel the suspicion that this impact was becoming disruptive, so much so as to challenge the forces of nature. In 2000 the Nobel prize winner of Chemistry Paul Crutzen, and the biologist Eugene F. Stoermer, put forward the idea of adopting the word Antropocene2: to describe a new geological era, separate to the Holocene era, in which human actions had drastic effects on the environment. The endorsement of Antropocene as a new geological era is now under close examination by the International Union of Geological Sciences, and regardless of the outcome, the idea that mankind has been able to irreparably change the climate, the evolution of the species and even the geological eras has been a scientific and political breakthrough. The processes of decolonization and industrialization of the so-called third world countries acceler-ated and highlighted the growth limits of industrial civilisation. As the Indian writer Amitav Ghosh affirms,

2 Anthropocene is a term coined in the 1980s by biologist Eugene Stoermer, was adopted by the Nobel Prize in Chemistry Paul Crutzen in the book Welcome to Anthropocene. Man has changed the climate, Earth enters a new era, Mondadori, 2005.


3 Global Trends in Renewable Energy Investment 2017, was published on April 6th by UN Environment, the Frankfurt School-UNEP Collaborating Centre, and Bloomberg New Energy Finance.

paradoxically the geopolitical predominance of a handful of European powers, based on the exploita-tion of natural resources for the benefit of a small share of the planet’s inhabitants, has delayed the advent of a climate crisis. Pursuing industrialization or the “Great Acceleration”, undermined the sustain-ability of the post industrial revolution economic model, and that now risks to drag with it it’s promise of growth. The growing global energy requirement has intensified with the increase in population growth: today 7.3 billion people consume approximately the equivalent of 14 billion tonnes of petroleum. According to the forecasts in the BP Energy Outlook 2017, the global GDP will double by 2015, for 25% as a consequence of the increase in world population growth (+1.5 billion), for 75% for economic growth. The demand for energy will increase by 30%. To keep the Earth in its balanced state, the amount of absorbed energy must be balanced by an equal amount of energy emitted from the Earth’s surface and from the atmosphere as radiation. If you don’t want to give up the level of well-being achieved by the numerically speaking minority of the world’s population and you want others to aspire to reach that level of well-being, the only way to make growth more sustainable is to find a new model based on clean, renewable energy sources and at the same time endorse a lifestyle that requires less resource consumption.

Energy sources are defined renewable and clean in comparison to fossil fuels (eg gas, petroleum and coal): they are considered renewable as they are inexhaustible and clean as they do not release polluting substances into the air. In order to use the sun, the wind and water as energy sources, technol-ogy research and development are required which would lead to their use on a large scale at competi-tive costs of production.

Between 2015 and 2016 the capacity of installed renewable energy increased by 14%, from 127.5 to 138.5 GW, making up 55,3% of the increase in the global energy production capacity. If, in 2011, the renewable sources covered 6.9% of electricity production, in 2015 this percentage rose to10.3% and in 2016 to 11.3%, thus hindering 1.7 gigatonnes of carbon dioxide being released in the atmosphere. In recent years it’s production has been stable despite an increase in energy consumption, set

According to the report Global Trends in Renewable Energy Investment 2017 3, drawn up by the UNEP, the resources allocated to renewables in 2016 covered 58% of the total investments in the energy sector.

irrimediabilmente il clima, l’evoluzione delle specie e addirittura le ere geologiche è stata scientificamente e politicamente dirompente.

I processi di decolonizzazione e di industrializza-zione dei paesi del cosiddetto terzo mondo hanno accelerato e reso evidenti i limiti di crescita della civiltà industriale. Come sostiene lo scrittore indiano Amitav Ghosh, paradossalmente il predominio geopolitico di una manciata di potenze europee sul resto del mondo, basato sullo sfruttamento delle risorse naturali a benefi-cio di una piccola porzione degli abitanti del pianeta, ha ritardato l’avvento della crisi climatica. La rincorsa all’industrializzazione, o “grande accelerazione”, ha messo in crisi la sostenibilità del modello economico nato con la rivoluzione industriale, e che ora, inseguito da tutti, rischia di trascinare con sé la promessa di crescita e sviluppo che lo sosteneva. Il crescente fabbisogno di energia a livello globale è intensificato dall'aumento della popolazione: oggi 7.3 miliardi di persone consumano circa 14 miliardi di tonnellate equivalenti di petrolio. Secondo le proiezioni conte-nute nell’Energy Outlook 2017 della BP, entro il 2035 il PIL globale raddoppierà per il 25% come conseguen-za dell’aumento della popolazione mondiale (+1.5 miliardi di unità), per il 75% per la crescita economica. La domanda di energia crescerà del 30%.

Se non si vuole rinunciare al livello di benessere raggiunto da fasce numericamente minoritarie di abitanti del pianeta e impedire che gli altri possano aspirarvi, l’unico modo per rendere sostenibile il trend di crescita è trovare contemporaneamente un nuovo modello basato su fonti di energia rinnovabili e pulite e uno stile di vita che richieda un minore consumo di risorse.

Le fonti di energia sono definibili rinnovabili e pulite in contrapposizione ai combustibili fossili (ad es. gas, petrolio e carbone): rinnovabili in quanto inesauribili e pulite perché non rilasciano nell’ambiente sostanze inquinanti. La possibilità che il sole, il vento e l’acqua siano utilizzati come fonti di energia, richiede la ricerca e lo sviluppo di tecnologie che ne consen-tano l’impiego su larga scala, con costi di produzione competitivi. Secondo il rapporto Global Trends in Renewable Energy Investment 2017 3, curato dall’UNEP, le risorse destinate alle energie rinnovabili nel 2016 hanno coperto ben il 58% del totale di investimenti nel settore energetico. Tra il 2015 e il 2016 la capacità installata di energia rinnovabile è aumentata del 14%

Per mantenere la Terra nel suo stato di equilibrio, l’energia assorbita deve essere bilanciata da un’uguale quantità di energia emessa verso lo spazio dalla superficie terrestre e dall’atmosfera sotto forma di radiazione.

3 Global Trends in Renewable Energy Investment 2017, è stato pubblicato dall'UN Environment, the Frankfurt School-UNEP Collaborating Centre, e Bloomberg New Energy Finance.

10Talking About 1

Ecologia: etimologia e storia di una parola daidiversisignificatierisvolti.Ecology: the etymology and history of a word from different meanings and implications. Marco Belpoliti intervistato da / interviewed by Stefano Salis


Marco Belpoliti Nato a Reggio Emilia nel 1954, insegna alla Università di Bergamo. Ha pubblicato numerosi libri, tra cui, recentemente con Guanda, Primo Levi di fronte e di profilo e La prova. Ha curato il Meridiano delle opere narrative di Gianni Celati e, per Einaudi, le Opere complete di Primo Levi. Collabora con diversi giornali e riviste, tra cui la Repubblica, e cura, con altri, Riga (Marcos y Marcos) e doppiozero.com.

Was born in Reggio Emilia in 1954 and teaches at the University of Berga-mo. He has published numerous books including the recent Primo Levi di fronte e di profilo and La prova. He edited il Meridiano on the narrative works of Gianni Celati and le Opere complete di Primo Levi, released by Einaudi. He collaborates with a number of newspapers including la Repub-blica, and is part of the editorial team of Riga (Marcos y Marcos) and dop-piozero.com.

Stefano SalisSardodiSant’Antioco,ènatonel1970.Espertodigraficaeditoriale,bibliofi-lia, letteratura e design. Giornalista per il Sole 24 Ore, scrive tutte le settimane sul Domenicale di copertine, di mostre o di personaggi nella rubrica Mirabi-lia. È inoltre il responsabile della sezione Commenti & Inchieste.

Was born on the Sardinian island of Sant’Antioco in 1970. He is an expert in graphic design, bibliophily, literature and design. He is a journalist for the newspaper il Sole 24 Ore, and every week contributes to its Sunday edition with articles on cover stories, exhibitions, personalities and celebrities, in the section Mirabilia. Moreover, he manages the section Commenti & Inchieste.

06.07.17 h18.30



against an annual average rate of +2,2%, as regis-tered in the preceding decade. All this in light of shrinking investments in renewable by 23% be-tween 2015 and 2016, shown by the reduction in production costs. According to Erik Solheim, a senior manager for UNEP, “Clean technologies have never been so economical: for investors this means a real opportunity to obtain more with less. This is exactly the type of situation in which the interests of people coincide with profit making which allows you to hope for a better world for everyone”. Today solar, wind, water, geothermal and biomass power are considered mainstream and marketable at competitive prices.

Then there are sources which offer huge potential and are to this day still undergoing testing. The most appealing is probably marine energy, that refers to the use of energy carried by oceans taking advantage of tides, currents,ocean waves, salinity and even ocean temperature differences. The poten-tial of waves alone, in theory, is huge: according to a group of scientists in 2010 it was estimated to be 32 PW per year, meaning almost double the amount of energy produced in 2008. The tides, caused by gravitational forces that are produced by the move-ment of the Earth, the Moon and the Sun, consist of an excursion between the highest and the lowest sea level, which can then be used to produce electricity through turbines. The tides have the advantage that they are regular and predictable.

The energy produced will be enough to power 175,000 homes. The first phase of the project (Phase 1A) was completed in August 2017 with the deploy-ment of 4 turbines, setting a world record for a month-ly production capacity of 700 MWh. In November 2009 the world’s first osmotic plant was opened in Tofte, Norway on the Oslofjord inlet. The prototype is by Statkraft, one of Norway’s leading grid companies and it is aiming to produce renewable energy from the physical interaction of salt water and freshwater.

If these clean and renewable sources are a reality, creating a sustainable economic model that allows an ever-growing number of people to aspire to affluence, means thinking about entire flows and complex and interdependent processes, in which only fuel able to integrate with environments and

MeyGen4 is the largest tidal stream project in the world. It was presented in 2007, with the aim to develop a tidal stream project of up to 398 MW, through the use of 269 subsea turbines in an offshore site in the Orkney strait in Scotland.

4 MeyGen (full name MeyGen tidal energy project) is the worlds largest tidal energy plant which is currently in construction. The project uses four 1.5 MW turbines with 16 m rotor diameter turbines submerged on the seabed.The project is owned and run by Tidal Power Scotland Limited and Scottish Enterprise.

3

La parola ecologia è oggi assai sfuggente. L’idea preconcetta che ce ne siamo fatti nel tempo ci ha probabilmente portati lontanodaunsignificatorealeeinvecedaresignificatoalleparoleè in fondo il motivo principale di questi incontri. Ecco perché è interessante discuterne con un letterato come Marco Belpoliti. Cominciamo quindi dalla basi: come è nata la parola ecologia? Cosahasignificatoneltempo?Esoprattuttodovevuolearrivare?

È evidente che noi viviamo di parole, senza le parole non avremmo le cose. La parola ecologia non esisteva prima del 1866, fu usata inizialmente da Ernst Haeckel, discepolo di Darwin in Germania. Il suo etimo, comune ad economia, deriva da oikos ovvero il focolare domestico. Ma, prima di entrare realmente in circolazione, le parole restarono lì a lungo, solo con il tempo cominciamo a muoversi, lentamente: così è stato anche per la parola ecologia che ha impiegato circa 30 anni ad affermarsi. E comunque l’ambito iniziale di applica-zione è stata la biologia, in particolare lo studio delle interrelazioni tra organismi viventi.

Ad un certo punto però la parola ecologia diviene “bandiera” e si mescola con i concetti di tutela e di protezione ambientale. Una confusione che ci fa deviare dalla corretta percezione di que-sto termine: ecologia in verità non è soltanto tutela dell’ambiente?

Procediamo per gradi: nel 1935 nasce un’altra “parola valigia” che è “eco-sistema”. Ricorderete tutti, per capirci, il ciclo delle sostanze nutritive come compariva a scuola su tutti i sussidiari. Ma intanto un evento fondamentale si preparava: 16 luglio 1945, nel deserto nel New Mexico, viene fatta esplodere la prima bomba atomica: una prova per il Giappone. Paradossalmente saranno proprio gli scienziati nucleari a inventare contemporaneamente la bomba e “l’ambientalismo”. Poi i biologi proseguiranno l’opera spostandosi dal loro campopiùspecifico,peranalizzare,adesempio,glieffettidelleradiazioninucleari. Rachel Carson con il suo libro Primavera silenziosa del 1962, tradotto in Italia da Feltrinelli già nel 1963, denuncia una “primavera silenzio-sa”: gli uccelli non cantavano più!

Come ha fatto questa linea di pensiero, che senz’altro parte “debole”, a incunearsi nel nostro pensiero? A diventare un’istanza politica? Insomma, da una serie di premonizioni, il tema si faimprovvisamente urgente, prende la strada del “salviamo il pianeta!”.

Sicuramente è successo qualcosa di così potente da rovesciare l’antichissima tradizione ebraico/cristiana. Pensiamo all’idea di sacralizzazione dell’uomo secondo cui, già nell’ebraismo, ma soprattutto con il Cristianesimo, Dio ha dato all’essere umano il dominio della natura (a questo proposito non dimenti-chiamochelafiguradiSanFrancesco,conilCantico dei Cantici, è una assolutaeccezione).Doposecoli,quest’ideavainfineincrisi:l’ambientalismosegna, in certo senso, un ritorno a quel mondo pagano che era stato allontanato dal centro del pensiero. Di qui, da questa stessa “possibilità” di pensiero, emerge l’ecologia come fatto politico.

5

Hai studiato a lungo Primo Levi, forse la trasposizione che egli compiedelconcettodiomeostasisuunpianofilosoficoemoralepuò essere funzionale al nostro discorso?

Il tuo accenno fa riferimento a un testo emblematico, anche se secondario, di Primo Levi, Il Brutto Potere. In esso Levi parla proprio dell’omeostasi come modello di equilibrio o almeno come tentativo di rimettere in equilibrio le cose. Dice Levi: “Il disagio che pesa su di noi in questi anni nasce da qui: non perce-piamo più forze di richiamo, omeostasi, retroazioni. Il mondo ci sembra avanzare verso una qualche rovina e ci limitiamo a sperare che l’avanzata sia lenta”. Questo è l’ottimismo di Levi… speriamo che l’avanzata sia lenta! Non dimentichiamoci d’altronde che Levi, tecnico-scienziato prima che letterato, era sopravvissuto all’esperienza di Auschwitz dove aveva avuto modo di osservare l’uso che i nazisti avevano fatto della scienza e della tecnologia, in particolare per i forni crema-tori. Un uso sistematico, organizzato, progettato, vorrei dire industriale.

Quindi dobbiamo essere in qualche modo consapevoli che la strada che abbiamo intrapreso è sbagliata, ma non sappiamo quale possibilità ci siano di tornare indietro o almeno di fermarci, perché sperare in un “disastro lento” mi sembra un po’ poco?

Nel 1961, Edward Lorenz, un giovane matematico-metereologo, scoprì “l’effetto farfalla” (il battito delle ali di una farfalla in Cina può causare un tifone dall’altra parte del mondo): la vita degli organismi è cioè interconnessa e prevale il disordine sull’ordine. Noi cerchiamo, attraverso la scienza e la tecno-logia, di dare una forma a questa complessità, a questo caos, di descriverlo. Dare una forma è fondamentale: abbiamo bisogno di dare forma alle cose, ai pensieri (le parole sono in fondo la forma dei pensieri). Michel Serres diceva che ci sono rare isole di ordine in un grande disordine. L’ecologia è allora una metafo-ra per cercare di tenere in ordine questa porzione dell’universo in cui ci troviamo a vivere. La domanda diventa cosa vogliamo fare di questo pianeta? E, notate bene, pensare alla Terra in termini di “un pianeta” è già un’affermazione scon-volgente. Finché gli astronauti non hanno visto il nostro mondo “da fuori” non abbiamo posseduto questo concetto: di colpo il nostro pianeta ci è sembrato più piccolo, più fragile e molto più problematico.

Ma allora, nel percorso di “riempimento” della parola ecologia, a che punto siamo arrivati? C’è stata un’indubbia presa di coscienza,maforsenonèancorasufficiente.Quantopuòfarein proposito ognuno di noi?

Laparoladicuidiscutere,inquestocaso,èsenz’altroresponsabilità.Unfiloso-fo ebreo, Hans Jonas, tra gli anni ‘60 e gli anni ‘70, ha rimesso fortemente in giocoquestotema.CosìcomehafattolafilosofiapoliticadiHannahArendt. La responsabilità di cui si parla è senz’altro quella personale, ma le responsabi-lità personali poi si sommano e allora diventano grandi numeri e i grandi numeri spostano le cose…. Quello che è ormai chiaro è che l’uomo non è più padrone di questo pianeta: si confronta con la natura rispetto alla quale ha delle precise responsabilità, responsabilità maggiori rispetto agli altri mammiferi. In questa accezione infatti l’ecologia viaggia all’unisono con i diritti degli animali. Recentemente poi si è cominciato a parlare anche dei diritti dei vegetali, 4

The word ecology is rather ambiguous in today’s terms. The preconceived idea we have has evolved with time and has taken us away from a true meaning of the word. Fundamentally, the main reason for these encounters is to give a meaning to this word. That is why it is interesting to discuss this idea with a literary man such as Marco Belpoliti. Let’s start at the very beginning: Where does the word come from? What meanings has it acquired in time? And above, all what is its future?

It is undeniable that words are vital, without words we wouldn’t have things. The word ecology didn’t exist before 1866, it was initially used by Ernst Haeckel, a believer and devotee of Darwin in Germany. It derives from oikos, that is to say household, home, or a place to live. But before words really begin to circulate, to become mainstream, is a slow process: and that is how it was with the word ecology, which took about 30 years to really take hold. It began to be applied in the field of biology with particular reference to the study of interrelationships between living organisms.

At a certain point, however, the word becomes an “emblem” and gets put together with concepts connected to environmental protection. This confusion leads us to stray away from the correct sense of the word: is ecology, in actual fact, nothing more than the protection of the environment?

Let’s take things a step at a time: in 1935 another word that acts as an “umbrella” appears: “ecosystem”. To be clear, everyone remembers the food chain as it appeared in primary school textbooks right? But, in the meantime, a key event was looming: 16 July 1945, in the Jornada del Muerto desert in New Mexi-co,thefirstatomicbombwasdetonated:anexperimenttargetedwithJapaninmind. Paradoxically, nuclear scientists will invent the bomb and at the same time “environmentalism”. Then biologists will continue developing the word,movingintotheirspecificfieldtoanalyseforexampletheeffectsofnuclear radiation. Rachel Carson, in her book Silent Spring released in1962, (the Italian version was released by Feltrinelli in 1963), reports a “silent spring” in which the birds no longer sang!

How did this line of thought, that undoubtedly has a weak start, get wedged in our thoughts? How did it pick up political aspira-tions? In short, from a series of premonitions the issue suddenly takes a turn and becomes “let’s save the planet!”.

Surely something powerful happened, as the ancient Jewish/Christian tradition was overturned. Think about the idea of the sacralization of man, that in Judaism, but above all with Christianity, God has given man the dominion of nature (onthisnotelet’snotforgetthatthefigureofSaintFranciswithhisCanticleoftheCreaturesisanexception).Aftercenturies,thisidea,finallyfadesout: in a certain sense environmentalism signals a return to the banished pagan world. From here ecology emerges as a political reality.

7

delle povere erbe, anche quelle al bordo del marciapiede, che, forse, “pensano”, hanno sensazioni, elaborano strategie. Ma, di conseguenza, la nostra responsa-bilità personale, le nostre piccole responsabilità personali quotidiane sono aumentate moltissimo. Per fare un esempio letterario possiamo ad esempio ricordare il racconto di Calvino sulla poubell, la pattumiera, dove andavano a finireifoglidicartaappallottolatidelle“cosechenonvenivano”,perchépersino scrivere, e non solo vivere, è una dissipazione.

Ma noi siamo centrati sul “consumo”, siamo nati nella cultura del consumo e dell’idea che, più si ha, più si può disperdere, ponendo questa dispersione come simbolo di avvenuta ricchezza. Secondote,finoachepuntoquestopensieropuòessereportatoavanti?finoachepuòessereconsideratovincenteepuò,tragica-mente, costituire un modello per quelli che non ci sono ancora e che voglio arrivare dove noi siamo arrivati.

Il problema del consumo è certamente centrale: consumo dell’energia, consu-mo del suolo, del cibo, degli oggetti. Persino il fenomeno del vintage credo nasca da qui: un ri-uso, un ri-nascimento, un ri-fare, un ri-cominciare. Interessante questa particella “ri”: dovremmo smetterla di sentirci in colpa se non creiamo niente di nuovo. Basta con questo mito della novità, dell’ultima cosa. Il primo consumo che oggi facciamo è quello delle parole, delle idee, delle immagini, senza cui non ci sarebbe nemmeno il consumo delle cose. Tutto sta nella nostra testa: noi viviamo di immagini, cioè di immaginazioni, di fantasie, di sogni. E per fortuna, altrimenti non sarebbero esistiti quegli uomini, sia pur ambivalenti, che sono partiti con le caravelle verso il nuovo mondo. Ecco, forse dovremmo ricominciare a partire verso mondi nuovi. Il mito del nuovo è dominante, è senz’altro centrale alla contemporaneità: si consumano continuamente le cose. E’ un meccanismo che fa parte dell’essere umano. Calvino e Levi ve lo direbbero: l’uomo è questa cosa qui, ma consumando contemporaneamente consuma anche se stesso.

E allora, l’ultima domanda che ti faccio è questa: viviamo in un mondo di produzione e se è vero che la novità è un feticcioche ci attira irresistibilmente, è anche una caratteristica dell’essere umano. Come si fa a non perdere questa qualità che ci appartiene da sempre del produrre, dell’inventare, del progredire, ma stando attenti a quell’equilibrio che, ogni volta che facciamo qualcosa, intacchiamo?

La produzione è la base dell’esistenza: l’uomo ha prodotto se stesso, come ci hanno spiegato molto bene i paleontologi. Gli uomini, in Africa da dove veniamo, si sono alzati dalla posizione di quadrupede perché le erbe impedivano loro di vedere le belve che li cacciavano, impedivano di “guardare alto”, ma, come direbbe Bataille, guardando alto gli uomini hanno cominciato a guardare il cielo. Quindi l’uomo è un homo faber:èinevitabile,finoal limite dell’autodistruzione.

6

You have studied Primo Levi at length, perhaps the transposition he makes about the concept of homeostasis on a philosophical and moral level can be of interest to our discussion?

You refer to an emblematic but secondary text by Primo Levi, Il Brutto Potere. In which Levi talks about homoeostasis as a model of equilibrium or at least an attempt to restore balance. Levi says: “The discomfort that weighs upon us in these years derives from this: we no longer perceive any efforts of reprimands, homeostasis or retrospective actions. The world seems to progress towards destruc-tion and we only hope that (that) progress is slow”. This is Levi’s optimism… let’s hope that that progress is slow! We mustn’t forget after all that Levi, a chemist firstandonlylaterawriter,wasanAuschwitzsurvivorwherehewasabletoobservefirst-handtheusetheNazismadeofscienceandtechnology,withparticu-lar reference to the crematoriums. A methodical, organized, planned and almost industrial use I would say.

So we should be aware that the path we have gone down is wrong, but we do not know if there is any possibility to turn back or at least cease doing certain things, because hoping for a “slow disaster” is a bit belittling?

In 1961, Edward Lorenz, a young mathematician and meteorologist, discovered the“butterflyeffect”(thebeatingofabutterfly’swingsinChinacaninfluencea typhoon on the other side of the world or the concept that small causes can have larger effects): the life of organisms is therefore interconnected and chaos prevails. Through science and technology we try to give shape to this chaos, to try and describe it. It is essential to give it a form: we need to give form to things, to thoughts (words are, after all, the form of thoughts). The French philosopher Michel Serres once said that there are rare islands of order in a sea of chaos Ecology, then, is a metaphor to keep in order this part of the universe we live in. The question then is what do we actually want to do with this planet? And, I should point out, thinking of the Earth in terms of a planet is a staggering success. It was only when astronauts saw our world “from the outside” did we take possession of this concept: all of a sudden our planet seemed smaller, more fragile and more problematic.

So in this path of developing the word ecology, what point have we got to? There is undoubtedly greater awareness but perhaps it still falls short. With regards to this how much can the single individual do?

In this case the word under discussion is responsibility. In the 60’s and 70’s, a Jewish philosopher Hans Jonas, really took this issue into account. Just as the political philosopher Hannah Arendt did. Responsibility is, without doubt, on a personal scale, but if you put together all of that responsibility you come up with some big numbers, and big numbers have the power to change things…. What is clear, is that man is no longer the master of this planet: we measure ourselvesagainstnaturetowardswhichwehaveaclearlydefinedresponsibility,a greater responsibility than other mammals have. In this sense ecology is as one with animal rights. Recently there has been talk of the rights of plants, those poor herbs and grasses, even those ones lining our pavements, which,

19 Ecology

passando da 127,5 a 138,5 GW e arrivando così a costituire ben il 55,3% dell’aumento della capacità di produzione energetica globale. Se nel 2011 le rinno-vabili coprivano il 6,9% della produzione di elettricità, nel 2015 si è saliti al 10,3% e nel 2016 a 11.3%, impe-dendo così l’emissione nell’atmosfera di 1,7 gigaton-nellate di anidride carbonica. Negli ultimi anni la produ-zione di anidride carbonica si è mantenuta costante nonostante l’aumento nei consumi di energia, contro il tasso medio annuo del +2,2%, registrato nel decen-nio precedente. Tutto questo è avvenuto in presenza di una contrazione degli investimenti nelle rinnovabili del 23% tra il 2015 e il 2016, a testimoniare l’abbatti-mento nei costi di produzione. Secondo Erik Solheim, direttore esecutivo dell’UNEP, “Le tecnologie pulite non sono mai state così economiche: per gli investi-tori ciò rappresenta una reale opportunità di ottenere di più con meno. Questo è esattamente il tipo di situa-zione in cui gli interessi del profitto e quelli delle persone coincidono, il che consente di sperare in un mondo migliore per tutti”. L’energia fotovoltaica, l’energia eolica, l’energia idrica, l’energia geotermica e l’energia da biomasse sono oggi realtà mainstream, commercia-bili a costi competitivi.

che coprono i tre quarti della superficie terrestre, sfruttando le maree, le correnti marine, il moto ondo-so, la differenza di salinità in prossimità delle foci dei fiumi (energia osmotica) o addirittura la differenza di temperatura tra la superficie marina e le profondità oceaniche (energia talassotermica). Il potenziale teorico del solo moto ondoso è immenso: secondo quanto stimato nel 2010 da un gruppo di scienziati diretto da Mørk, si tratterebbe di 32 PW annui, ovvero quasi il doppio dell’energia elettrica prodotta nel 2008. Le maree, causate dalle forze gravitazionali prodotte dal movimento relativo della Terra, della Luna e del Sole, consistono in un’escursione fra il massimo e il minimo livello del mare, che può essere sfruttato per produrre energia elettrica attraverso delle turbine. Le maree hanno il vantaggio di essere regolari e prevedibili. MeyGen4 è il più grande progetto mondiale di sfrutta-mento delle maree. Presentato nel 2007, si pone l’obbiettivo di produrre 398 MW di potenza installata, attraverso 269 turbine sottomarine nello stretto delle Orcadi, in Scozia. L’energia prodotta coprirà il fabbiso-gno di 175.000 abitazioni. Nell’agosto del 2017, con la posa della quarta turbina, è stata completata la fase 1A del progetto, stabilendo il record mondiale con una

Esistono poi fonti dagli enormi potenziali, tuttora in fase di sperimentazione. Quella più suggestiva è probabilmente l’energia marina, ovvero la possibilità di utilizzare come fonte di energia gli oceani,

4 MeyGen (nome completo MeyGen tidal energy project) è la più grande pianta di energia a marea mondiale che è attualmente in costruzione. Il progetto utilizza quattro turbine da 1,5 megawatt con turbine di diametro del rotore da 16 metri sommerse sul fondo marino. Il progetto è di proprietà e gestito da Tidal Power Scotland Limited e Scottish Enterprise.

8

perhaps, are able to “think”, to feel and draw up strategies. But as a conse-quence, our personal responsibility, our daily personal small scale one has increased staggeringly. A literary example of this could be Calvino’s tale about poubell, or rather rubbish, where even those screwed up pieces of paper with “ideas that didn’t materialise”, because even writing, and not only living, is a waste.

We are, however, focussed on “consumption”, we were born into a society of consumption and we have the idea that the more you have, the more you waste, and we acknowledge this waste, as a symbol of wealth. In your opinion how long can this line of thought continue? Until it can be considered successful and can, sadly, be a model for those who are yet to come and who want to get to where we are?

The problem of consumption is certainly key: consumption of energy, land, food, objects. I believe that even the phenomenon of vintage originates from this: are-use,are-birth,are-make,are-start.Thisprefix“re”isratherinteresting:we have to stop these feelings of guilt we have if we do not create anything new. This myth of novelty, the latest thing? Bin it. Nowadays the things we consume most are words, ideas, images, without which there would not even be consumption. It is all in our head: we live on images, that is to say, on imagi-nation, fantasies, dreams. Thankfully so, otherwise those men, even if their reasons were bivalent, who set off with caravels towards new worlds would never have existed. There’s an idea, maybe we should set off again for new worlds. The myth of novelty is dominant and certainly central to contempora-neity: this constant consumption of things. It is in our DNA. Calvino and Levi would say: man is this thing here, but consumed at the same time results in the consumption of one’s own self.

And so the last question I ask is this: we live in a world of produc-tion and if it is true that change and innovation are obsessive attractions, it is also true that they are human traits. How can we keep these qualities that have always been part of human nature- in producing, in inventing and in progressing bearing in mind that balance that, every time we do something we unwittingly undermine and impair?

Production is at the basis of existence: man produced himself, as palaeontolo-gists have so well explained. Our predecessors in Africa, rose up from the four legged position because the long grasses prevented them from seeing the beasts they hunted, prevented them from “looking up”, but as Bataille would say, looking up man began to look at the sky. Therefore man is homo faber: it is unavoidable, through to the limit of self destruction.


produzione mensile di 700 MWh. Nel novembre del 2009 è stata inaugurata la prima centrale osmotica del mondo, sul fiordo di Oslo. Si tratta di un prototipo della Statkraft, società norvegese leader nel settore dell’energia, che ha lo scopo spianare la strada a un futuro impiego industriale.

Se le fonti di energia rinnovabile e pulita sono una realtà, costruire un modello economico sostenibile, che permetta a un numero sempre crescente di esseri umani di perseguire e aspirare al benessere, significa pensare a interi flussi e processi complessi e interdipen-denti, di cui le tecnologie di produzione di energia sono solo il carburante, in grado di integrarsi, senza distruggerli, con gli ambienti e i processi circostanti. La pubblicazione ONU “World Urbanization Prospects 2014” prevede che entro il 2050 il 66% della popola-zione mondiale risiederà in aree urbane, contro il 30% del 1950 e il 54% del 2014. Ricostruire un equili-brio tra l’uomo e il pianeta e rendere sostenibile la nostra presenza sulla terra, non può dunque prescin-dere da un focus sull’ambiente artificiale per antono-masia: la città. È possibile pensare e progettare sistemi artificiali e complessi, quali le città, o perfino le megalopoli, a impatto zero?

Le città generano fino al 70% delle emissioni globali di anidride carbonica, usano grandi quantità d’acqua e producono montagne di rifiuti. Tutti i processi artificiali, ovvero frutto dell’opera dell’uomo, sono stati pensati, sin dagli albori della rivoluzione industriale, come processi basati su un modello lineare di consumo: si estrag-gono delle materie prime, le si trasformano combi-nandole con l’energia e il lavoro, si cede il prodotto a una successiva fase di lavorazione fino ad arrivare all’utilizzatore finale, che lo getta quando non serve più ai suoi scopi. Leonia e le nostre città funzionano allo stesso modo: si nutrono di prodotti che arrivano dall’esterno (cibo, cemento, acqua...), che vengono utilizzati e poi rigettati verso discariche e inceneritori. I sistemi naturali hanno un funzionamento diverso, circolare, in cui non ci sono rifiuti perché attraverso i cicli di nascita, decomposizione e rinascita, i nutrienti fluiscono perpetuamente in cicli rigenerativi. I sistemi artificiali possono essere ridisegnati come sistemi circolari? Col primo volume di Towards circular econo-my del 2012, la Ellen MacArthur Foundation, ha iniziato a proporre alle imprese delle strategie di business vincenti per una transizione accelerata verso un’eco-nomia circolare, in cui diminuiscano gli sprechi di risorse

Come scrive l'architetto William McDonough su LeScienze di settembre 2017, “il modo in cui ripenseranno e riprogetteranno il paesaggio urbano influenzerà il futuro della vita stessa”. Natural systems work differently, in a circular way,

where there is no waste because the cycles of birth and decomposition mean that the nutrients constantly flow in regenerative cycles.

processes is being used. The UN publication “World Urbanization Prospects 2014” forecasts that by 2050 66% of the world’s population will live in urban areas, compared to 30% in 1950 and 54% in 2014. Rebuilding a balance between man and the planet cannot help but focus on that artificial envi-ronment par excellence: the city. Is it feasible to think about and to subsequently design complex artificial systems, cities or even megalopolis that have a low environmental impact? As the architect, William McDonough, in LeScienze the September 2017 issue, writes, “the way they will reconsider and redesign the urban landscape will affect the future of life itself”. Cities generate up to 70% of the global carbon dioxide emissions, using large amounts of water and producing mountains of waste and rubbish. All artificial processes, that is to say, the work of man, have been conceived since the dawn of the industrial revolution, as processes based on a model of consumption: first there is the extraction of raw materials, these are then transformed with workmanship and energy, the product then goes onto another phase, ending its journey with the end-user, who discard it when it is no longer of use. Leonia and our cities work in exactly the same way: they are developed by products that come from external sources (food, cement, water...), that are used and then discarded.

Can artificial systems be redesigned as circular systems? With its first volume released in 2012 Towards circular economy, the Ellen MacArthur Foundation, started to propose winning business strategies to companies aimed at accelerating the shift towards a circular economy, in which the wastage of resources in the transformation and circulation processes is reduced, product-life is lengthened and any discards are recycled as raw materials for other processes. Cities play a funda-mental role: they are centres of innovation, creativity and produce wealth. Moreover, they are complex systems in which flows of goods, people and servic-es, processes triggered by different causes and for diverse functions, inevitably intersect and affect one another in a growing entanglement and with in-creasing complexity. The city, then, is the best disposed social environment for fostering a circular economy and a re-birth of ecology.


nei processi di trasformazione e circolazione, aumenti la durata dei prodotti e gli scarti diventino materia prima per altri processi. Le città possono, in questo senso, giocare un ruolo fondamentale: sono infatti centri di innovazione, di creatività e di produzione di ricchezza. Sono inoltre sistemi complessi in cui flussi di beni, persone e servizi, nonché processi innescati da origini diverse e per le funzioni più disparate, inevitabilmente si intersecano e si influenzano l’un l’altro in un groviglio crescente e una complessità sempre maggiore. In quest’ottica la città è il milieu più favorevole all’economia circolare e a un ri-nascimento dell’ecologia.

I flussi di materiali che nutrono la città circolare, vengono reintegrati nella biosfera se si tratta di flussi biologici, oppure sono destinati a essere rivalorizzati, nel caso di flussi tecnici. A Vancouver le 200.000 tonnellate di rifiuti organici raccolti ogni anno vengo-no utilizzate per produrre metano e ammendanti utilizzati come fertilizzanti per i terreni agricoli. A Oslo si interviene, ancora prima, sull’energia dissipata lungo i flussi: il sobborgo di Sanvika ha grandi scam-biatori di calore lungo le condutture fognarie che permettono di catturare il calore e utilizzarlo per riscaldare le case, o rinfrescarle, a seconda della stagione. A Stoccolma il biogas prodotto dal tratta-mento delle acque reflue fa circolare il 36% degli autobus cittadini. In un’acciaieria bresciana, da ottobre 2016, il calore prodotto dal forno elettrico non viene più disperso, ma utilizzato per scaldare 2.500 abita-zioni. In natura non esistono rifiuti, al termine del ciclo di vita gli organismi diventano nutrienti. Anche nelle città i rifiuti possono essere trasformati in linfa per nuovi utilizzi. Secondo le parole dell’ingegnere Michael Webber, professore presso l’Università di Austin, “messa in maniera molto semplice i rifiuti sono quello che abbiamo quando è finita l’immaginazione”. Kalunborg Symbiosis è un parco industriale in Dani-marca, in cui le aziende coordinano i flussi di energia, acqua e materiali. I prodotti secondari e i rifiuti di un qualunque processo, dalle acque reflue al calore di recupero, fino all’etanolo, diventano materiali da utilizzare per un altro processo, connessi tra di loro da tubazioni, cavi e condutture che trasportano avanti e indietro vapori, gas, elettricità e acqua.

Nella città circolare anche l’urbanistica ha un ruolo importante: viene meno la necessità di una divisione spaziale delle attività e delle abitazioni dettata dalla preoccupazione per lavorazioni nocive per la salute o inquinanti, e così i luoghi di lavoro e i centri per la trasformazione dei rifiuti in energia possono sorgere all’interno di quartieri residenziali, al fianco di scuole, edifici pubblici e negozi di alimentari. I quartieri si trasformerebbero allora in veri e propri organismi che vivono in simbiosi con le zone limitrofe.

Ricostruire un equilibrio tra l’uomo e il pianeta e rendere so-stenibile la nostra presenza sulla terra, non può prescindere da un focus sull’ambiente artificiale per antonomasia: la città. Rebuilding a balance between man and the planet and making our presence sustainable on earth, can not ignore a focus on the artificial environment, namely the city.

2050

66%

2014

54%

1950

30%

Incremento della percentuale della popolazione mondiale che risiede nelle aree urbane. / Increase in the proportion of the world’s population living in urban areas.


Ci sarebbe anche meno necessità di spostarsi, ridu-cendo così l’energia necessaria per la circolazione e il tempo sprecato per muoversi. Gli architetti possono già oggi progettare edifici a impatto zero e energetica-mente indipendenti, utilizzando materiali eco-sostenibili e destinati a durare, organizzando le dimensioni, la struttura, l’orientamento e gli interni in modo da sfruttare al massimo la luce solare e la ventilazione naturale. Gli edifici delle città circolari, racconta William McDonough5, “funzionano come gli alberi: catturano carbonio, producono ossigeno, distillano acqua, offrono un habitat a migliaia di specie e sfrut-tano la fonte solare per le proprie esigenze termiche e elettriche”.

Una narrazione in grado di disegnare la transizione a un nuovo ambiente artificiale, affinchè Leonia possa essere custodita nei libri, come monito della città che avrebbe potuto essere, ma che abbiamo deciso di costruire diversamente.

Accanto alla tecnologia e alla progettazione, sarà necessaria anche una narrazione capace di raccontare i nuovi stili di vita delle città circolari, di immaginarne e descriverne gli spazi, le architet-ture, gli oggetti, gli arredi; di creare modelli di consumo e di relazioni, modalità di movimento e stili desiderabili e appaganti.

5 William McDonough è un designer americano, consulente, autore e leader di pensiero. Tra le sue tante attività (o "inoltre" nel caso usassi "in addition"), McDonough è il coautore di Cradle to Cradle con Michael Braungart, ha rimaneggiato The Way We Make Things, North Point Press Publisher, 2003 e The Upcycle: Beyond Sustainability – Designing for Abundance, North Point Press Publisher, 2013.

The flows of material that enhance the circular city are reintegrated in the biosphere (biological flows) or are revalued (technical flows). In Vancouver the 200,000 tonnes of organic waste collected every year are used to produce methane and soil condi-tioners used as fertiliser for farmland. In Oslo things happen at an even earlier stage, on the dissipated energy along the flows: the suburb of Sandvika has heat pumps running along its sewers that capture heat and, depending on the season, use it to heat or cool homes. In Stockholm the biogas produced by sewage water runs 36% of the city’s buses. A steelwork factory based in Brescia has been using the heat from its industrial electric oven to heat 2,500 homes since October 2016. In the natural world rubbish doesn’t exist, at the end of the life cycle the organisms become nutrients. In cities, too, the rubbish can be transformed and recycled.

Kalunborg Symbiosis is an industrial park in Denmark where companies co-ordinate the energy, water and material flows. The secondary products and the waste from any process (eg wastewater, ethanol) are transformed into materials for other processes. A connection of tubes, cables and conductors that bring steam, gas, electricity and water back and forth.

In the circular city urban planning plays an important role: there is no longer the need to divide activities and housing dictated by concerns for pollutants and health hazardous production sites: so workplaces and centers for processing waste into energy may rise up in residential neighbourhoods, next to schools, public buildings and delicatessens. The neighbourhoods would be real organisms living in harmony with others. There would also be less need to move, therefore reducing the energy required and the time wasted in doing so. Today archi-tects are able to design buildings that have a low environmental impact and are independent from an energy point of view, using eco sustainable, long-lasting materials, organizing the size, the struc-ture, the positioning and the interiors so as to take full advantage of natural sunlight and ventilation. The buildings in a circular city, says William McDonough5, “work rather like trees: they capture carbon, produce oxygen, distil water, offer a habitat to thousands of species and use solar power for their own electrical and thermal requirements”. In addition to technology and design, a narrative is

According to the Engineer Michael Webber, Professor at the University of Austin “in simple words rubbish is what we have when our creativity and imagination have run out”.

5 William McDonough is an American designer, advisor, author, and thought leader. Between his many activities, is the co-author with Michael Braungart of Cradle to Cradle: Remaking the Way We Make Things, North Point Press Publisher, 2003, and The Upcycle: Beyond Sustainability Designing for Abundance, North Point Press Publisher, 2013.


Le città possono giocare un ruolo fondamentale: sono centri di innovazione, di creatività e di produzione di ricchezza. (...) In quest’ottica la città è il milieu più favorevole all’economia circolare e a un ri-nascimento dell’ecologia.Cities can play a key role: they are centers of innovation, creativity and wealth creation. (...) In this sense, the city is the most favorable milieu for circular economy and a re-emergence of ecology.

also needed in order to story-tell the new lifestyles in circular cities, to imagine them and describe their spaces, the architecture, the objects, the furniture, to create models of consumption and relations, ways of movement and attractive and fulfilling lifestyles; a story able to outline the transition to a new artificial environment, so that Leonis can be kept away in books, as a warning to remind us of a city that could have been, but that we have decided to build differently.

Michael Webber, professore e inge-gnere dell'Università di Austin. Michael Webber, professor and engi-neer at the University of Austin.




Technology

Talking AboutIII/IV

P. 3 L’innovazione esponenziale: immaginare il presente. Exponential innovation: imagining the present. A cura di / curated by Rimadesio

P. 11 Tecnologia: tra i settori tecnologici in grande sviluppo, la robotica avrà di certo il più forte impatto sulla vita quotidiana. Technology: Out of all the cutting-edge developments in technology, robotics will certainly have the greatest impact on our everyday lives. Angelo Cangelosi intervistato da / interviewed by Matteo Pirola

Index Technology

3 Technology

“Ho la sensazione che il mondo là fuori mi stia chiaman-do. Sussurrandomi che c’è qualcosa di più”, confida Dolores Abernathy, premurosa figlia di un rancher nel selvaggio west del secolo XIX. Dolores è anche un androide stampato in 3d e dotato di intelligenza artificia-le. Lei e i suoi colleghi sono le “inconsapevoli” attra-zioni di Westworld1, parco divertimenti dove tutto è concesso, all’insegna di un’autentica esperienza western. “Viviamo già in una realtà di intelligenza artifi-ciale” riflette Lisa Joy, co-creatrice della serie TV Westworld (2016) “è solo che non vediamo dei robot, vediamo degli smartphone. Pensiamo ‘Beh è un piccolo passo’. Ma se lo guardiamo nel suo insieme, ci rendiamo conto che ci stiamo muovendo verso una realtà in cui le nostre vite e i nostri pensieri sono caricati in rete. Stiamo già vivendo in una realtà di intelligenza artificiale”. Intelligenza artificiale (AI) e coscienza artificiale (AC), additive manufacturing (AM), internet delle cose (IoT) e internet del tutto (IoE), sono solo alcune delle frontiere tecnologiche che la serie tv mette in scena, combinandole, in un orizzonte temporale ancorato nel presente. Sembrano appar-tenere a un’altra epoca le tecnologie della pellicola originale, annus domini 1973. Scritta e diretta da Michael Crichton metteva in scena in un futuro prossi-mo (1983) dei robot umanoidi simili a D-3BO di Star Wars, 1977 o a Terminator, 1984.Come genere letterario la fantascienza è nata nel XIX secolo in Inghilterra, dove lo sviluppo tecnologico che trainava la galoppante rivoluzione industriale aveva innescato una serie di profonde trasformazioni sociali, suscitando sentimenti ambivalenti, di speranza e di paura, e dato vita a un ricco immaginario sui

L’innovazione esponenziale: immaginare il presente. Exponential innovation: imagining the present.A cura di / curated by Rimadesio

1 Westworld è una serie tv di fantascienza. La prima stagione è stata trasmessa dalla HBO negli Stati Uniti nel 2016.

54 TechnologyTalking About

possibili esiti delle scoperte scientifiche e delle applica-zioni tecnologiche. Nel primo romanzo fantascien- tifico, concepito nel 1816 dalla diciottenne Mary Shelley, il protagonista è un giovane studente di medicina che, traumatizzato dalla scomparsa della madre, conce-pisce l’idea di creare l’essere perfetto, possente e intoccabile da qualsiasi malattia. Frankestein assembla una creatura cucendo pezzi di cadaveri, e la rianima con la corrente elettrica. Erano anni in cui proliferava il traffico di cadaveri alimentato dalle richieste delle scuole mediche per praticare la dissezione e in cui gli studi pionieristici sulla corrente elettrica (Hans Christian Ørsted, 1820 Michael Faraday, 1821 André-Marie Ampère, 1826 Georg Ohm, 1827) stavano preparando le basi per l’invenzione dei motori elettrici e la seconda rivoluzione industriale. Il romanzo Jurassic Park, firmato da Michael Crichton nel 1990, immaginava che lo sviluppo dell’ingegneria genetica avrebbe permesso di riportare in vita i colossi della preistoria utilizzando il DNA fossilizzato dei dinosauri. Il 30 luglio 2003 una squadra di scien-ziati francesi e spagnoli ha riportato in vita per qualche minuto il bucardo, una capra selvatica dei Pirenei estinta tre anni prima. Nel 2012 a San Francisco è stato varato il progetto Revive&Restore con l’obbiettivo di far ricomparire animali estinti impiantandone gli embrioni nella specie geneticamente più simile. In Jurassic Park la lettura del codice genetico estratto dalle zanzare era effettuata dai supercomputer, capaci di ridurre il tempo dell’operazione da due anni a una manciata di minuti. Quando il romanzo è stato scritto il Progetto Genoma Umano2 era agli albori. Ha richiesto l’investimento di 2.7 miliardi di dollari ed è stato portato a termine nel giugno 2003. Già nel 2015 il genoma poteva essere sequenziato in qualche ora, al costo di 1.000 dollari.

La comparsa del communicator in Star Trek nel 1966 ha ispirato l’invenzione del telefono cellulare. Martin Cooper, a capo di un team di ricerca di Motorola, ne elaborò un prototipo in 90 giorni, che venne presentato alla stampa a New York, il 3 aprile del 1973. Il primo cellulare fu commercializzato nel 1983, al costo di 3,995 dollari (9,300 a prezzi correnti). La tecnologia alimenta speranze e preoccupazioni, fa da motore per la creatività umana, che a sua volta accompagna e traccia il futuro, generando un corto-circuito. Si assottigliano i confini tra presente e futuro, tra immaginazione e realtà: è la fantascienza stessa a ispirare e guidare l’evoluzione tecnologica.

2 Progetto Genoma Umano è un programma di ricerca internazionale conscopodimappareeidentificare il genoma di un essere umano.

Stiamo quindi assistendo a un cortocircuito: le fron-tiere temporali immaginate dalla fantascienza sono violate in un lasso temporale sempre più breve.

“I have the feeling that the world outside is calling me. Whispering that there is something more”, confides Dolores Abernathy, the caring, archetypal rancher’s daughter in the American Wild west of the 19th century. Dolores is also a 3d printed android and equipped with artificial intelligence. She and her colleagues have become the “unwitting” attractions of Westworld1, an amusement park where nothing is off-limits in keeping with the spirit of an authentic western experience. “We are already experiencing a situation of artificial intelligence” reflects Lisa Joy, co-creator of the television series Westworld (2016) “it is just that we don’t see robots, we see smartphones. We think ‘well, that is a small step’. But if we look at it as a whole, we realize we are moving towards a world in which our lives and our thoughts are loaded onto the web. We are already living and experiencing artificial intelligence”. Artificial Intelligence (AI) and artificial consciousness (AC), additive manufacturing (AM), the internet of things (IoT) and the internet of everything (IoE), are just some of the technological frontiers that the television series enacts, combining them in a present time frame. The technologies of the original film, annus domini 1973, seem to belong to another era. It was written and directed by Michael Crichton and showed humanoid robots, similar to D-3BO in Star Wars, in 1977 or to Terminator, in 1984, in the near future (1983).

Science fiction came about as a literary genre in England in the 19th century, where the technological

1 Westworldisasciencefiction television series. Season 1 was shown in the USA in 2016 by HBO.


Si assottigliano i confini tra presente e futuro, tra immagi-nazione e realtà: è la fantascienza stessa a ispirare e guidare lo sviluppo tecnologico. (...) Velocità e durata sono concetti relativi: l’informatica ci ha portati in un’altra dimensione. The boundaries between the present and the future, between imagination and reality are worn thin: it is science fiction itself that inspires and drives techno-logical development. (...) Speed and duration are relative concepts: Information Technology has taken us to another dimension.

development that was driving the rampant industrial revolution triggered a series of profound social transformations, arousing feelings of both hope and fear, a rich imagination was brought to life, focussing on the possible outcomes of scientific discoveries and technological applications. In the first science fiction novel, written by the eighteen year old Mary Shelley in 1816, the main character is a young medical stu-dent who, traumatized by his mother’s death, conceives the idea of creating the perfect, strong and untoucha-ble being. Frankenstein creates his creature by sewing together different parts of corpses and brings him to life with electricity. At that time there was widespread trafficking of corpses fuelled by medical schools and their need to practice dissection and at the same time groundbreaking studies on electric current (Hans Christian Ørsted, 1820 Michael Faraday, 1821 André- Marie Ampère, 1826 Georg Ohm, 1827) were laying the groundwork for the invention of electric motors and the second industrial revolution.

The novel, Jurassic Park, written by Michael Crichton in 1990, imagined that the development of genetic engineering would have allowed to bring prehistoric giants back to life using the fossilized DNA of dinosaurs. On the 30th of July 2003 a team of French and Spanish scientists succeeded in bringing the bucardo (a recently extinct Spanish mountain wild goat) back to life for just a few minutes. In 2012, in San Francisco, the project Revive&Restore was launched with the aim to rescue extinct animals by implanting their embryos in the most genetically suitable species. In Jurassic Park the genetic code extracted from mosquitoes was read by super computers, able to reduce the length of a two-year operation down to just a few minutes. When the novel was written the Human Genome Project2 was in its early days. It required a 2,7 billion dollar invest-ment and was declared complete in 2003. By 2015 the human genome could be sequenced in a few hours at the cost of 1,000 dollars. We are therefore witnessing a short-circuit: the time frontiers imagined by science fiction are broken down and the periods of time are becoming increasingly short.

The appearance of the communicator in Star Trek in 1966 inspired the invention of the mobile phone. Martin Cooper, head of a research team for Motorola, developed a prototype in 90 days that was then presented to the press in New York, on the 3rd of April in 1973. The first mobile phone was marketed in 1983, at $3,995 ($9,300 in today’s prices). Technology fuels both hope and concern, it is the engine for human creativity, which in turn accompanies and traces the future: generating a short-circuit. The boundaries between the present and the future, between imagina-tion and reality, are worn thin: it is in fact science

2 Human Genome Project was an international research program whose goal was the complete mapping and understanding of all the genes of human beings.


A ciò va aggiunto che la rete informatica con-nette ormai ogni punto del pianeta e rende ancora più epidemica la diffusione delle invenzioni: sia perché possono diffondersi in tempo reale, sia perché è sempre maggiore il numero di persone che, venendone a conoscenza, possono contribuire a migliorarle. D’altro canto le tecnologie emergenti conoscono un elevato tasso di miglioramento quando escono dalla fase prototipale e iniziano a essere applicate. Prima di James Watt le macchine a vapore sfruttavano circa l’1% dell’energia liberata dalla combustione del vapore. Tra il 1765 e il 1776 Watt triplicò queste prestazioni. Dal primo modello con 4,4 kW, Watt costruì nel 1781 un modello a 7,5 kW. Nel 1876 fu prodotta una macchina a vapore da 1.000 kW, nel 1900 da 2.200 kW. Tuttavia, mano a mano che la tecno-logia diventa matura, sforzi sempre più intensi portano a risultati sempre più modesti: vengono raggiunti i limiti fisici del miglioramento. La differenza è data dalla misura del ritmo del miglioramento e dalla sua durata nel tempo. Lo storico Ian Morris ha scritto: “anche se alla rivoluzione [del vapore] ci vollero parec-chi decenni per svilupparsi [...] fu ugualmente la trasformazione più grande e veloce nell’intera storia del mondo”.

Velocità e durata sono concetti relativi: l’infor-matica ci ha portati in un’altra dimensione. Nel 1965 Gordon Moore3, cofondatore di Intel, osservò che il numero di trasnsistor contenuti in un circuito inte-grato era raddoppiato ogni anno. Erano solo dieci i componenti del primo chip, assemblato nel 1958. Azzardò che nel breve periodo il tasso di incremento sarebbe rimasto costante. La legge di Moore ha retto per più di 50 anni: il numero di transistor contenuti in un chip è raddoppiato ogni 18 mesi. Nel giugno 2017 IBM, Samsung e Globalfoundries hanno annunciato un nuovo processo industriale che consentirà di sviluppare chip contenenti 30 miliardi di transistor. La velocità e l’efficienza energetica dei supercomputer, la velocità di download, l’efficienza degli hard drive, e tante altre innovazioni in campo digitale e informatico, seguono la legge di Moore. Nel 1996 il governo americano ha sviluppato ACSI Red: costato 55 mln di dollari, occupava una superficie di 200 metri quadrati e consumava 800kW l’ora. E’ stato il primo super-computer a oltrepassare la velocità di 1,8 teraflop. Nel 2006 è nato un altro computer dotato della stessa velocità, costava 500 dollari, occupava una superficie di gran lunga inferiore al metro quadro e consumava

Il tema basilare è sicuramente quello della velocità: nello sviluppo delle tecnologie innanzitutto, ma anche nella loro diffusione in settori e contesti geografici diversi.

3 “I circuiti integrati porteranno a tali meraviglie come i personal computer – o perlomeno a terminali connessi a un computer centrale – controlli automatici per le automobili, e attrezzature portatili per comunicare. L’orologio elettrico da polso necessita solo di un display per essere fattibile” Gordon E. Moore, Cramming more components, Electronics, Volume 38, Number 8, April 19, 1965.

3 “Integrated circuits will lead to such wonders as home computer – or at least terminals connected to a central computer – automatic controls for automobiles, and personal portable communications equipment. The electronic wrist-watch needs only a display to be feasible today.” Gordon E. Moore, Cramming more components, Electronics, Volume 38, Number 8, April 19, 1965.

fiction itself that inspires and drives the technological evolution. Speed is undoubtedly key: first of all in the development of technologies but also in their diffusion and use in different sectors and geographical areas.

On the other hand, emerging technologies have a high improvement rate after the prototype phase and when they start to be applied. Before James Watt came about, steam engines harnessed approximately 1% of the energy released by steam combustion. Between 1765 and 1776 Watt enhanced this perfor-mance three-fold. From the first 4,4 kW model, Watt went on to build a 7,5 kW model in 1781. In 1876 a 1.000 kW steam engine was produced, in 1900 a 2.200 kW one. Gradually, however, as technology reaches a certain maturity, increasingly intense efforts can lead to increasingly modest results: the physical levels of improvement have been reached. The difference is given by the rhythm and rate of improvement and by its duration. The historian Ian Morris wrote: “even if the (steam) revolution took several decades to develop, it was, in any case, the biggest and fastest transformation in the entire history of the world”.

Speed and duration are relative concepts: information technology has taken us to a new dimension. In 1965 Gordon Moore3, the co-founder of Intel, observed that the number of transistors contained within an integrated circuit increased two-fold every year: there were only ten components in the first chip that was assembled in 1958. He ven-tured that in the short-term their rate of growth would have been steady. Moore’s Law proved to be accurate for over 50 years: the number of transis- ters in a chip doubled every 18 months. In June 2017 IBM, Samsung and Globalfoundries announced a new industrial process that would allow for the development of chips containing 30 billion transis-tors. The speed and energy efficiency of the super-computers, the speed of downloading, the efficiency of the hard drive, and other numerous innovations in the digital and information technology fields reflect Moore’s Law. In 1996 the American government devel-oped ACSI Red: it cost 55 million dollars, took up a surface area of 200 square meters and consumed

Added to the fact that the web already connects every corner of the earth and makes the sharing of any invention even more rampant: because they can spread in practically almost no time at all and there is an increasing number of people who, getting to know about them, can help to enhance and improve them.

10Talking About 1

Angelo Cangelosi

Nato a Alcamo nel 1967, è professore di Artificial Intelligence and Cognition

nonché direttore del Centre for Robotics and Neural Systems presso la

Plymouth University (UK). Ha pubblicato recentemente per MIT Press,

con Matt Schlesinger, Developmental Robotics: From Babies to Robots.

Dal 2014 segue il progetto THRIVE(USAirForceOfficeofScienceandResearch).

Was born in Alcamo in 1967, and is Professor of Artificial Intelligence and Cognition and the Director of the Centre for Robotics and Neural Systems

at Plymouth University (UK). His latest book Developmental Robotics: From Babies to Robots (co-authored with Matt Schlesinger under MIT press) was

released in 2015. He has also been the Principal Investigator for the THRIVE

project(USAirForceOfficeofScienceandResearch)since2014.

Matteo Pirola

Nato a Cernusco sul Naviglio nel 1975, è architetto, PhD. Insegna architettura

degli Interni e Storia del Design al Politecnico di Milano. Critico

e curatore, svolge attività di ricerca sulla contemporaneità di arte, design

e architettura.

Was born in Cernusco sul Naviglio in1975. He is an architect and teaches

Interior Design and the History of Design at the Polytechnic of Milan.

He is a critic and curator, carrying out research activities on the contempo-

raneity of art, design and architecture.

Tecnologia: tra i settori tecnologici in grande sviluppo, la robotica avrà di certo il più forte impatto sulla vita quotidiana. Technology: Out of all the cutting-edge developments in technology, robotics will certainly have the greatest impact on our everyday lives.Angelo Cangelosi intervistato da / interviewed by Matteo Pirola


28.09.17 h18.30

Teatro Rimadesio,

Flagship store Milano,

Via V. di Modrone 26

I protagonisti

Contributors

800 kW an hour. It was the first supercomputer to exceed 1.8 teraflops in speed. In 2006, however, a new computer was built able to perform at the same speed: it cost 500 dollars, took up much less than a square meter in space and used 200 W an hour. It was the play station 3.

Sustainability of exponential growth over time sure enough takes on a whole new meaning. When it comes to steam engines, airplane speed, the pro-duction of electricity, the weight of automobiles, the physical limits are tangible. The digital world and information technology present us instead with a different set of problems. The limitations are much more relative: “They concern the number of electrons per second that can be made to pass through a channel in an integrated circuit, or how fast the rays of light can pass through a fiber optic cable”. Bryn-jolfsson and McAfee, researchers at the MIT and the authors of The Second Machine Age4 (2014), observe that the exponential speed leads us to ideas of such magnitude that they seem abstract, or rather “in an era in which what arrived first is no longer a particu-larly reliable guide for what will follow: science fiction continues to become reality”. Human beings are not the only ones who exchange information: machines “chat” increasingly more. The M2M devices (machine to machine), they literally communicate between devices, and not by users, using any communication channel represented 34% of all internet connected devices in 2016. The remaining 66% was made up of personal computers, tablets, desk tops, televisions and smartphones. According to CISCO, they forecast that, by 2021, the number of M2M devices, including cars, industrial robots, medical equipment and fitness sensors will, at 51%, overtake the traditional online devices. The neologism Internet of Things was used for the first time in 1999 to describe objects able to the react to their surroundings, collecting and transmitting data, drawing on and using information. The objects communicate between themselves and with their surroundings by means of chips and sensors. Today, the physical world can be (almost) entirely digitalized, and this itself is one the most important innovations to have taken place over recent years. Digitalizing means transforming a physical phenomenon into the language of computers, in a sequence of numbers

Growth takes place at an unprecedented expo-nential rate and prolonged over time puts us in front of things, that in terms of size and mag-nitude go beyond our ability of understanding. Terms of scale we are actually “not equipped for”.

4 Erik Brynjolfsson, Andrew

McAfee, The Second Machine Age: Work, Progress, and Prosperity in a Time of Brilliant Technologies,

W. W. Norton & Co Inc, New

York, 2014.

Checosasignifica“tecnologiarobotica”?Tuttinoiabbiamogià,senzasaperlo,un robot in casa, anzi, chi avesse l’aspirapolvere Rumba, ne possiederebbe due perché il “robot” che veramente possiedono tutti è la lavatrice (e forse alcuni di voi avranno addirittura la Fuzzy Logic che prevede dei veri e propri sensoripensanti).Uscendodall’ambientedomestico,laroboticapiùsofisti-cata esiste oggi nelle fabbriche, ove i robot lavorano all’interno di gabbie di sicurezza, o nei laboratori medici, il Super Da Vinci ad esempio, comandato dal medico con un joy stick. In Giappone vi sono già robot che consigliano i clienti nei negozi di telefonia ed è persino possibile comprare un robot, che si chiama Pepper, e portarselo a casa, con un esborso iniziale di 3000 dollari e quindi una bolletta “telefonica” mensile. Detto questo, per ora tuttavia i robot lavorano e vivono in ambienti controllati (per fare un esempio comprensibile: il Rumba non può scendere le scale!) e si limitano ad azioni semplici e ripetitive. Persino Pepper esegue consegne limitate, che, benpresto,arriverannoadannoiarciequindifiniremoper“spegnerlo”. Nonesistonoancoramacchineautonome,mainvececisonogiàrobotdefiniti“compagni sociali”. Esamineremo proprio questi robot di tipo “umanoide” o “sociale”. Possiamo dividerli in gruppi: i companion robot per gli anziani, quellicheimparanoaparlarecomeunbambino,quellichehannofiducia in noi e viceversa (pensiamo al robot che, ogni giorno alle 11, deve dare una medicina salvavita ad un nostro anziano genitore). Il primo esempio è il “robot di compagnia”. Abbiamo intervistato più di 150 persone over 60 per capire che cosa si aspettassero da un robot. Innanzitutto dai questionari è apparso evidente che gli anziani accettano ormai l’idea di essere aiutati da un robot (a condizione che non sia inteso come sostitutivo degli affetti principali). Da questo progetto sono derivati Coro, Doro e Oro, tre robot, di cui il primo si muove all’esterno dell’abitazione, il secondo funge da un portinaio, il terzo è un robot maggiordomo. Essi sono in grado di interagire: per esempio Coro acquista un medicinale che consegna a Doro che, a sua volta, lo consegna a Oro che lo somministra all’anziano. La seconda problematica di cui ci stiamo occupando prevede di insegnare il linguaggio ai robot in una dinamica simile a quella dell’ap-prendimentodeibambini.“IntelligenzaArtificiale”infattinonsignificainsegnare al robot a parlare sulla base di una lista di vocaboli pre-acquisiti, maasecondadellalinguaspecificadelcontestoincuiilrobotsitrova. Il robot-bambino, chiamato iCub, arriva a riconoscere le parole, ma anche alcune azioni (tirare la palla, spostarla a sinistra o a destra). Si tratta specificatamentedidevelopmental robotics (“robotica dello sviluppo”), disciplina che prevede un apprendimento per imitazione, dall’interazione con le persone. Questi baby-robot hanno, per esempio, imparato a contare partendo dall’uso delle dita, come farebbe appunto un bambino. Un terzo esempioriguardalafiducia:unavoltacostruitounrobot,bisognacapirecome,inbaseallaTeoriadellaMente,imparareafidarsidiluieviceversa.Daidatiraccoltirisultaevidentechemifideròmoltodipiùdiunrobotche si comporta in “modo sociale”, ad esempio comunicando anche con lo sguardo.

Tocca a me trasportare queste ricerche così coinvolgentinell’ambito dell’architettura e del design. La prima domanda che vorrei porti riguarda la forma: ci hai parlato di robot “bambini”, ma perché questi “oggetti” devono avere una forma umana?Forseperchédobbiamoinstaurareconessi“una

5

relazione” e ciò è più facile se hanno sembianze conosciute, chepermettetonodicreareempatia?

Estenderei al comportamento la tua osservazione sulla forma: se dovessi essereoperatodauncomputerforsemifidereidipiùdiunrobotnonuma-noide, ma se si trattasse invece di un “compagno sociale” con lui desidererei comunicare anche con lo sguardo. Se invece avessi a che fare con un robot automobile in teoria non vorrei che fosse dotato di occhi, ma facciamo un esempio pratico: devo attraversare la strada, una macchina si avvicina, allora cerco lo sguardo dell’autista (Teoria della Mente) per capire se mi ha visto o meno, se l’automobile però fosse guidata da un robot come potrei regolar-mi?Nonmipotròbasaresugliocchi,cidovràalloraessere,comunque,unqualche strumento di joint attention. Quindi, persino in questi robot, esisterà probabilmente una proiezione dei nostri cues sociali, come per esempio il nodding, cioè l’abitudine a muovere la testa per manifestare comprensione.

Comepossiamoriconoscereun’unitàroboticaminima?Infondoil cellulare che tutti abbiamo in tasca è un robot! La voce di Siri o di Cortana deve necessariamente simulare unavoceumana?RicordiamoiduerobotdiStar Wars: quello umanoide, C-3PO, parlava come gli umani, mentre quello non umanoide, C1-P8, emetteva segnali per noi incomprensibili.

Abbiamo detto che siamo abituati a cercare gli occhi della persona con cui parliamo, ma un’altra caratteristica umana è la cosiddetta agency ovvero la capacità di agire mediante libere scelte. Esiste in psicologia un celebre espe-rimento in cui si chiede al soggetto di osservare due “triangoli” che si muo-vono, uno dietro l’altro, alla stessa velocità: la reazione più comune postula che un triangolo “insegua” l’altro con atteggiamento aggressivo. Ecco, anche nella robotica bisogna prendere in considerazioni aspetti psicologici di questo tipo.

Quindi saremmo in grado di riconoscere anche un software comerobot?Alloraioprogettistapotreiinserirloinuntavolo,in una sedia, in un qualsiasi oggetto che conseguentemente diventerebbe capace di interagire come me tramite un sinte-tizzatorevocale?

Stai citando quella che noi chiamiamo “ergonomia comportamentale”. Facciamo nuovamente un esempio: sto guidando e il navigatore mi ha detto di andare a sinistra, ma io invece giro a destra, è accettabile che riceva un segnale,adesempiounavibrazionedelvolante,chemiavverte?Sitrattadiun caso di mapping tra strategie sociali e forme non umanoidi.

Parliamoalloradiintelligenza?Checosaè,perunricercatore,l’intelligenza e che rapporto c’è tra essa e la cosiddetta IntelligenzaArtificiale?

Limitiamociadaffrontarel’IntelligenzaArtificiale.Finoapochiannifasignificavacheavevoistruitoilmiocomputer,peresempio,agiocareascacchi4

Whatdoesrobotictechnologymean?Everyone,withoutrealizingit,alreadyhas a robot in their homes, actually, whoever has the hoover Rumba, does in fact own two, because the “robot” that everyone owns is the washing machine (perhaps some of us even have Fuzzy Logic providing real thinking sensors). Leaving the domestic environment, the most sophisticated robotic technology is to be found in factories and manufacturing plants, where robots work within safety cages or in medical laboratories, take the Da Vinci robot, for example, that a surgeon can command by using a joy stick. In Japan there are robots that advise clients in mobile phone stores and where it is even possible to buy a robot, called Pepper, at a base price of 3,000 dollars and then a monthly “telephone” fee. Having said that, for now, however, robots live and work in controlled environments (a clear example of this is the fact that Rumba can-not go down the stairs!) and they are limited to simple and repetitive actions. Even Pepper carries out limited orders but, we will get fed up with them soon enough and end up “turning them off”. Autonomous machines, as yet, donotexist,therearehoweveralreadyrobotsthataredefinedas“social companions”. We will analyse the “humanoid “or “social” types. We can divide them into groups: companion robots for elderly people, those robots that learn to speak, those that trust us and viceversa (think about the robot that gives our elderlyparentlife-savingmedicineeverydayat11.00).Thefirstexample is the companion robot. We interviewed over 150 people over 60 years old in order to understand their expectations from a robot. First of all, it was clear from the questionnaires that elderly people have already come to terms with the idea (provided that it is not intended as a substitute for their dear ones). This project gave rise to Coro, Doro and Oro:theyarethreerobots,thefirstisable move outside the domestic environment, the second is a porter, and the third is a butler. They are able to interact: for example Coro purchases a medi-cine which she hands over to Doro which is then dosed and given to Oro. The second problem we are tackling is trying to teach the robot language in a similarwaytochild’swayoflearning.“ArtificialIntelligence”infactdoesnot mean teaching the robot to pronounce a list of words that have been already learnt,butusethespecificlanguageofthesituationinwhichtherobotislocated. The child robot-called iCub, is able to recognise words and carry out a number of actions (throw a ball, move it from left to right). This is called developmental robotics, a discipline that focusses on learning by imitation through solid interaction with humans. These baby-robots, for example, have learnttocountusingtheirfingers,justasachildwoulddo.Athirdexampleregards trust: once a robot is created, it is imperative to understand, based on the Theory of Mind, and to learn to trust it and vice versa. Data collected shows that trust is greater if the robot behaves in a “social manner”, commu-nicating with its eyes for example.

It is my task now to move this fascinating research into theworldofarchitectureanddesign.ThefirstquestionI would like to ask you is about form: you talked about “child”robots,butwhydotheyhavetohaveahumanform?Is it perhaps because we have to build a “relationship” with them, and this easier to do if they have familiar, com-fortingfeatures?

I would extend your observation on form to behaviour: if I had to be operated on by a computer, I would trust a non-humanoid robot much more with

7

usando le strategie di Kasparov: grandi risultati, ma nessuna sorpresa. Oggi invece il mio programma insegna al computer a giocare a scacchi guardando innumerevolipartite.Lanuovaintelligenzaartificialeèdunquequelladei“sistemi che apprendono”. Ma, rassicuratevi, la nostra generazione non arri-verà a vedere robot con intelligenze “umane”.

Poniamo ora una questione etica, con una domanda che sta diventando classica: un robot alla guida deve decidere se andare a impattare contro un gruppo di tre bambini oppure di cinque anziani.Cheopzionesceglierà?Qualegrupposacrificherà?

Il problema non è posto correttamente in quanto si tratta di scelte non del robot, ma della società. Come già si fa nella ricerca, quando sarà il momento verràcreatoungruppocompostodaidestinataridiquellospecificorobot(per esempio gli anziani), da legislatori, da rappresentanti delle case di produ-zione e delle assicurazioni. Sarà questo gruppo a elaborare norme condivise.

Ma se invece parlassimo di leggi, sono ancora valide le leggi di Asimov?Cisonodeilimitiallasperimentazione?ElonMusk, il discusso imprenditore sud-africano, sostiene che sa-ranno i robot a scatenare la terza guerra mondiale. Non mi pareun’ipotesicosìfantascientificavistoilfrequenteutilizzodeidronineiconflittiarmati.

Per ogni esperimento che intendiamo intraprendere siamo tenuti a interrogare un “comitato etico”, esattamente come se si trattasse di un nuovo farmaco. Gli scienziati inglesi sono stati capaci in questo campo di proiettarsi molto in avanti, per esempio autorizzando la sperimentazione delle automobili senza pilota in autostrada. Questo atteggiamento sarebbe bene fosse considerato, a livello legislativo, anche in Italia e ben prima che le nuove tecnologie venga-no brevettate e siano disponibili.

La memoria umana è limitata e soprattutto selettiva, ricordiamo una cosa successa trenta anni fa non come è realmente avvenuta, ma come le emozioni ci permettono di ricordarla. Il robot invece ricorderà tutto con estrema precisione e, se il dato non si deteriorerà, rimarrà per sempre. Come possia-morapportarciconquestasituazione?

La memoria umana si è evoluta in modo tale da conservare e recuperare solo quanto è necessario al nostro adattamento e quindi alla nostra sopravvivenza. I robot invece hanno due tipi di memoria. La prima è assimilabile alla scatola nera degli aeroplani, ove viene registrato tutto ciò che accade. La seconda, checoncernel’IntelligenzaArtificiale,permettealrobotdiestrarre,daquellaenorme massa di dati, solo le informazioni che ci interessano, dando luogo di fatto ad una “memoria personalizzata”.

6

that task, but if I wanted a “social companion”, I want someone I can have eye contact with. If I had to deal with a car robot, in theory, I would prefer that it didn’t have eyes, let’s outline this with a practical example: I have tocrosstheroad,acargetsclosersoItrytofindasignofeyecontactwiththe driver (Theory of Mind) in order to understand whether or not he has seenme.IfthatsamecarisdrivenbyarobothowwouldIbeabletofigurehimout?Iwouldnotbeabletorelyonhiseyes,sotherehastobe,how-ever, some type of joint attention. So, even in these types of robots, there will probably be a transferral of our social cues, like nodding for example, moving the head as a sign of understanding.

Howcanwerecognizearoboticunit?Afterall,everyonehas a mobile phone in their pocket and that is a robot! Does the voice of Siri of Cortana necessarily have to simulate ahumanone?Letusnotforgetthetworobotsfeaturedin Star Wars: the humanoid one, C-3PO, spoke like a human, while the non-humanoid one C1-P8, emanated unintelligible signals.

We have said that we are used to making eye contact with the person we are speaking to, but another human characteristic is something called agency, meaning the ability to react by making free choices and decisions. In psychol-ogy there is a well known experiment that involves asking the subject under observation to observe two “triangles” that are moving, one behind the other, at the same speed: the most common reaction postulates that one triangle chases the other one in an aggressive state. So you see, we must take into consideration these psychological aspects even in robotics.

So we will be able to identify and acknowledge software as arobot?I,asadesigner,couldinsertitintoatable,achairanyobject that, by its use, will be able to interact through means ofaspeechsynthesizer?

That is what we call “Behavioral Ergonomics”. Let’s have another example: I am driving and my GPS navigation device tells me to go left, but I go right, Is it reasonable that I receive a sign, for example a vibration on the steering wheeltotellmeIhadtakenthewrongturn?Thisisacaseofmapping between social strategies and non-humanoid forms.

Shallwetalkaboutintelligencethen?Foraresearcherwhatis intelligence and what is the connection between intelligence andso-calledArtificialIntelligence?

LetsjustfocusfirstlyonArtificialIntelligence.Untilrecentlythissimplymeant instructing my computer to play chess using Kasparov’s strategies: great results but with no real surprises. Today, it is my programme that teaches the computer to play chess by looking at innumerable number of games. NewArtificialIntelligenceisthereforethatof“systemswhichareableto learn”. But rest assured, our generation will not live to see robots with human intelligence.

19 Technology

200 W l’ora: la play station 3. Si tratta di una crescita a ritmi esponenziali senza precedenti. Il suo protrarsi nel tempo ci pone di fronte a ordini di grandezza che vanno al di là della nostra capacità di comprensione, per i quali non siamo attrezzati. La sostenibilità nel tempo di una crescita esponenziale assume infatti una connotazione diversa rispetto alla nostra esperienza. Quando si tratta di macchine a vapore, di velocità degli aerei, di produzione di energia elettrica, di peso delle automobili, i limiti fisici sono tangibili. Il digitale e l’informatica ci confrontano invece con problemi di ordine diverso. Le limitazioni sono molto più relative: “Riguardano la quantità di elettroni al secondo che possono essere fatti passare in un canale inciso in un circuito integrato, o quanto velocemente i raggi di luce possono passare lungo un cavo a fibre ottiche”. Brynjolfsson e McAfee, ricercatori del MIT e autori del testo The Second Machine Age4 (2014), osservano che

Gli esseri umani non sono gli unici a scambiare informazioni: le macchine “chiacchierano” sempre di più. I dispositivi M2M (machine to machine), che producono un traffico generato dalle apparecchiatu-re stesse e non dagli utenti, nel 2016 hanno rappre-sentato il 34% dei dispositivi connessi a internet. Il restante 66% era costituito da personal computer, tablet, pc, televisioni, smartphone. Secondo le previ-sioni della CISCO il sorpasso avverrà nel 2021, quando il 51% dei dispositivi online sarà di tipo M2M: automobili, robot industriali, oggetti della domotica, attrezzature mediche, sensori per il fitness, reti di smista- mento dell’energia e così via. Il neologismo Internet delle Cose è stato utilizzato per la prima volta nel 1999, per descrivere gli oggetti che sono in grado di intera-gire con la realtà circostante raccogliendo e trasmet-tendo dati, estraendo e utilizzando informazioni. Attraverso chip e sensori, gli oggetti interagiscono tra loro e con la realtà circostante. Oggi il mondo fisico può essere (quasi) interamente digitalizzato, e questo è una delle innovazioni più importanti degli ultimi anni. Digitalizzare significa trasformare un fenomeno fisico nel linguaggio nativo dei computer, in una sequenza di numeri espressi in formato binario o, detto in altre parole, in informazioni che possono essere archiviate, modificate e riprodotte. L’implicazione economica è enorme: l’informazione digitale ha un costo marginale

la velocità esponenziale e protratta nel tempo ci portano a ordini di grandezza talmente elevati da risultare astratti, o meglio, “in un’epoca in cui quello che è arrivato prima non è più una guida particolarmente affidabile per quanto arriverà in seguito: la fantascienza continua a diventare realtà”.

4 Erik Brynjolfsson, Andrew McAfee, The Second Machine Age: Work, Progress, and Prosperity in a Time of Brilliant Technologies, W. W. Norton & Co Inc, New York, 2014 – Edito in Italia da: Feltrinelli Editore.

8

Let’s highlight an ethical issue with a question, that has become an evergreen. A robot at the wheel of a vehicle must decide whether to crash into a group of three children or a group of fiveelderlypeople.Whatgroupdoesitchoose?Whowillbesacrificed?

The question has not been posed correctly because it is not about the robot’s choicebutaboutsociety’s.Asisalreadythecaseintheresearchfield,whentherighttimehascome,agroupmadeupofthosebeneficiariesofthespecificrobot (for example the elderly), legislators, representatives of production houses and insurance companies will be created... This will be the group that works out the common rules.

And if we talk about laws, are the three laws of Asimov still validtoday?Arethereanylimitstotrialsandtesting?ElonMusk, the controversial South-African entrepreneur, believes that robots will trigger the third world war. That no longer seemssuchascience-fictionideaconsideringthefrequentuseofdronesinarmedconflict.

Every experiment we intend to undertake is subject to an “ethics committee”, justasifitwereanewdrug.Britishscientists,inthisfield,arewell-ahead,think of their testing of driver-less cars on the highway. It would be good to consider this, at a legislative level, also in Italy and well before new technol-ogies are patented and available.

The human memory is limited and above all, it is selective, we remember something that happened thirty years ago not as it really happened but as our emotions allow us to remember it. Robots, instead, will remember everything with extreme preci-sion and if the data doesn’t get damaged that memory will be permanent.Howcanwerelatetothissituation?

The human memory has evolved in such a way that it is able to store and recover only what is necessary to our adjustment and habituation and conse-quently to our survival. Robots, on the other hand, have two types of memory. Thefirstissimilartotheblackboxinairplanes,whereanythingthathappensisregistered.Thesecond,thatconcernsArtificialIntelligence,allowsthero-bot to extract, from its huge mass of data stored within, only the information that is of interest, an almost “personalised memory”.


di riproduzione prossimo alla zero e non si esaurisce quando viene utilizzata, anzi, il suo valore aumenta all’aumentare degli utenti che la utilizzano. I dati sono prodotti in tempo reale e su vasta scala da sensori, dispositivi audio e video, network, file di registro, appli-cazioni transazionali, internet e social media.

Il 90% dei dati esistenti nel 2013 è stato creato nei due anni precedenti e continuano a espandersi non solo per volume, ma anche per varietà e velocità. La necessità di analizzare ed elaborare masse di dati eterogenei in tempi sempre più brevi sta trainando lo sviluppo di tecniche di analisi che prendono il nome di Big Data5. Potenzialmente tali dati possono essere elaborati e utilizzati in tempo reale, per fare scelte e prendere decisioni, ma il volume e la velocità sempre crescenti con cui vengono prodotti necessitano nuove tecnologie di stoccaggio (come la base di dati distribuita, detta blockchain) e lo sviluppo di tecnologie che consentano di sfruttare la potenza di calcolo delle macchine per svolgere operazioni sempre più com-plesse, operazioni che fino a qualche anno fa si pensava che potessero essere svolte solo dall’intelligenza umana. In The new division of labour, scritto nel recente 2014, gli autori Frank Levy e Richard Murnane hanno preconizzato un mercato del lavoro in cui le competenze professionali richieste ai lavoratori sarebbero da rinvenire nei limiti dei computer. Questi ultimi sarebbe-ro stati in grado di svolgere ogni sorta di operazione simbolica, dalla matematica alla logica, al linguaggio, e quindi avrebbero potuto sostituire qualsiasi attività umana descrivibile con algoritmi.

L’esempio portato dagli autori è quello della guida nel traffico: “L’autista di camion possiede lo schema per riconoscere quanto ha davanti. Articolare questa conoscenza e inserirla in un programma informatico per tutte le situazioni [...] è un compito al momento enormemente difficile. I computer non possono sostituire facilmente gli esseri umani”. Nel 2004 fallì il Grand Challenge, sfida aperta a veicoli totalmente autonomi promossa dalla DARPA, agenzia per i progetti avanzati del Dipartimento della Difesa degli Stati Uniti. L’obbiettivo era il completamento nel più breve tempo possibile di un percorso di 200 km nel deserto californiano. L’auto che andò più lontano completò a malapena il 5% del percorso, prima di uscire di strada in un tornante. Poco dopo, il 9 ottobre 2010, Google ha annunciato il suo successo su 140.000 miglia di asfalto: “le nostre macchine automatizzate utilizzano

Sarebbe invece stata salvaguardata la capacità, esclusivamente umana, di esaminare le informazioni raccolte attraverso i sensi e di riconoscere modelli, o pattern.

5 I dati non strutturati o sensibili al fattore tempo o così grandi da non potere essere processati con i sistemi di database relazionali, richiedono tecniche di analisi diverse, chiamate Big Data.

The need to analyse and process tonnes of heter-ogeneous data in increasingly shorter time scales is driving the development of analysis techniques that go under the name of Big Data4.

expressed in a binary format, or in other words into information that can be archived, modified and re-used. The economic implication is huge: digital information has a marginal cost of reproduction that is next to nothing, and it doesn’t run out when used, indeed its value increases with the increase of users who use it. Data is produced, in real time and on a large scale, from sensors, audio and video devices, networks, transactional applications, log files, internet and social media.

Ninety percent of the data that was available in 2013 had been created in the two years leading up to it. This data, after all, continues to increase, not only in volume but also in type and in speed.

Potentially such information can be processed and used in real time in order to make choices and take decisions, but the ever increasing volumes and speed with which this data is produces mean that new storage technologies are required (like blockchain) and the development of technologies that make it possible to take full advantage of the computing power of the machines to perform ever increasingly complex operations. In The new division of labour, written in 2014, the authors Frank Levy and Richard Murnane predict- ed a labour market in which the professional skills required would be found only within the limits of computers and information technology. The former are, in fact, able to perform all sorts of symbolic operations, from mathematics to logic, through to language, and therefore can already replace any human activity that can be described using algorithms. The exclusively human ability to examine the infor-mation and to recognize models or patterns would be preserved. The example that is usually given is that of driving in traffic: “A truck driver has a windscreen and so is able to recognise what is ahead. Articulating this knowledge and inserting it into an IT program for every situation [...] is an extremely difficult task at the moment. Computers cannot substitute human beings so easily”. In 2004 the Grand Challenge failed. This was a challenge open to completely autonomous vehicles, sponsored by the DARPA, the US Defense Advanced Research projects Agency. The aim was to complete, in the shortest time possible, a 200 kilome-ter track in the Californian desert. The car that went the furthest covered just 5% of the track and then went off the road on a tight bend. Shortly afterwards, on the 9th of October 2010, Google announced its success

4 Data that is unstructured or time sensitive or simply very large cannot be processed by relational database engines. This type of data requires a different processing approach called Big Data.

22

videocamere, sensori radar e un telemetro radar per ‘vedere’ il traffico, così come le mappe dettagliate. Tutto questo è reso possibile dai nostri centri di elaborazione dati, che processano enormi quantità di dati raccolti dalle nostre macchine mentre mappano il terreno”.

La conversione di dati di origine e contenuto eterogeneo in un linguaggio standard, quello binario, permette di mettere in relazione informazioni appar-tenenti a ambiti diversi con una velocità inaspettata. Le tecnologie digitali accoppiate al ritmo esponenziale del miglioramento delle tecnologie informatiche consentono di sviluppare e ricombinare simultaneamente tra loro le innovazioni nei settori più disparati: i nuovi materiali, la produzione additiva, il sequenziamento del DNA, la nanotecnologia, le energie rinnovabili, la robotica avanzata e l’informatica quantistica. Secondo Klaus Schwab, fondatore del World Economic Forum, “sono la combinazione di queste nuove tecnologie e la loro interazione attraverso domini fisici, digitali e biolo-gici che rendono la quarta rivoluzione industriale diversa dalle rivoluzioni precedenti”. Dapprima ci furono il vapore e la meccanizzazione del lavoro svolto con l’energia umana o animale, poi venne l’elettricità, la catena di montaggio e la nascita della produzione di massa. La terza era dell’industria è giunta con l’avvento dei computer e l’automazione, quando i robot inizia-rono a sostituire gli esseri umani in catena di montag-gio. Ora stiamo entrando nella quarta rivoluzione industriale, in cui i computer e l’automazione si uniran-no in modo nuovo, con i robot controllati da sistemi di intelligenza artificiale6 in grado di apprendere e operare senza l’intervento dell’uomo.

Il limite più forte al pieno dispiegamento delle forze della tecnologia è in realtà costituito dalla velocità con cui sapremo cambiare le nostre abitudini, intuire e mettere a frutto le potenzialità delle innova-zioni in maniera sistemica, concepire nuovi modi di disegnare i processi, organizzare il lavoro e combinare le informazioni. Ad esempio, solo lo 0,5% dei dati disponibili è oggi utilizzato nei processi decisionali. D’altronde va ricordato come la sostituzione delle macchine a vapore con i motori elettrici non portò subito a un miglioramento immediato della produttività. Lo storico Paul David ha notato che i tecnici e i manager del tempo si limitarono a sostituire le tecno-logie, senza mutare la planimetria e l’organizzazione delle fabbriche. Fu solo la successiva generazione a sfruttare appieno le potenzialità dei motori elettrici. Il vapore richiedeva un’unica fonte di energia e che i macchinari necessitanti maggiore potenza fossero posizionati più vicini alla fonte di energia. Con l’elettricità viceversa ogni macchina può essere alimentata da un singolo motore: il layout delle fabbriche cominciò a essere disegnato in base al flusso di lavoro e dei materiali.

6Intelligenzaartificiale:èunabranchia dell’informaticachesiprefiggelo scopo di creare macchine intelligenti, ovvero dotate delle caratteristiche considerate esclusive degli esseri umani.

M2M

Ora stiamo entrando nella quarta rivoluzione industriale, in cui i computer e l’automazione si uniranno in un modo nuovo, con i robot controllati da sistemi di intelligenza artificiale in grado di apprendere e operare senza l’intervento dell’uomo. We are now entering the fourth industrial revolution, in which computers and automation will work innovatively together, where robots twill be controlled through sys-tems of Artificial Intelligence able to assimilate and operate without any human intervention.

Machine to machine: è un termine che può essere utilizzato per descrivere qualsiasi tecnologia che permette alle macchine o ai dispositivi elettronici di comunicare autonomamente.Machine to machine: is a broad label that can be used to describe any tech-nology that enables automated wired or wireless communication between mechanical or electronic devices.


Per tornare al presente, a livello globale si stanno moltiplicando i progetti per favorire e guidare il salto di qualità che ci permetterà di sfruttare le potenzialità delle nuove tecnologie. Il Advanced Manufacturing Partnership degli Stati Uniti, il progetto Industrie 4.07 adottato dal governo tedesco, il piano strategico Made in China 2025 sono esempi di strategie nazionali finalizzate a stimolare e indirizzare l’applicazione delle innovazioni tecnologiche, a determinare gli esiti della quarta rivoluzione industriale.

Nel marzo 2017, al CeBIT di Hannover – la più importante fiera IT – il Giappone ha presentato al mondo il programma governativo Society 5.0, che si propone di guidare la trasformazione delle strutture sociali che accompagnerà la nuova rivoluzione delle macchine. Anche se non possiamo ancora tratteggiare con esattezza gli esiti di questa trasfor-mazione, sicuramente, per utilizzare le parole di McAfee e Brynjolfsson, essa “sarà caratterizzata da innumerevoli esempi di intelligenza delle macchine e da miliardi di cervelli interconnessi che lavoreranno insieme”. I frutti di questo lavoro dipenderanno dalla nostra capacità di immaginare e costruire il futuro-pre-sente che ci attende.

Ma la portata delle trasformazioni che ci attendono sarà molto più grande e trascenderà l’ambito industriale. Le aziende della Sylicon Valley, quali Uber, Airbnb, Linkedin, Facebook, Amazon, Google, Netflix, Twitter hanno già creato una cesura cambiando, per sempre e potenzialmente ovunque, il modo di viaggiare, di spostarsi, di fare acquisti, di cercare lavoro, di comunicare, di fruire dei contenuti multimediali e così via.

7 Zukunftsprojekt Industrie 4.0 (I40) è un’iniziativa strategica nazionale del governo tedesco. L’iniziativa si basa sulla strategia High Tech 2020 del governo tedesco e sarà portata avanti per 10-15 anni. L’iniziativa è stata lanciatanel2011conunfinanziamento di 200 milioni di euro.

on 140,000 miles of tarmac: “our automated cars use video cameras, radar sensors and a telemeter radar in order to “see” traffic, just as our detailed maps do. All of this is made possible by our data processing centres that process huge amounts of data from our cars while they are mapping the terrain”.

The conversion of data, that is miscellaneous in origin and content, into a standard language, the binary one, means that information from different fields, can, at a surprisingly fast rate, be connected. Digital technologies coupled with the exponential rate of improvement in information technologies allow for the simultaneous development and recombination of innovations in different sectors: new materials, additive manufacturing, DNA sequencing, nanotech-nology, renewable energies, advanced robotics and quantum information technology. According to Klaus Schwab, founder of the World Economic Forum,

First there was the steam and the mechanization of work carried out by humans or animals, then, there was electricity, the assembly line process and mass production. The third industrial era came later with the advent of computers and automation, when robots began replacing human beings in the assembly line. Now we are entering into the fourth industrial revolution, in which computers and automation will blend innovatively together, where robots will be controlled through systems of Artificial Intelligence6, able to assimilate and operate without any human intervention.

The biggest limit to the full deployment of technology’s potential is actually the speed with which we change our habits, intuitively and system-atically exploit the potential of innovations and conceive new ways of designing processes, organ-ize work and combine information. For example, only 0.5% of the available data is used today in deci-sional processes. It should, after all, be remembered that the transition from steam engines to electric motors didn’t bring about an immediate improve-ment in production. The historian Paul David noted that technicians and managers at that time limited themselves to replacing technologies, without chang-ing, for example, the layout and the organisation of the factories. It was only the next generation who were able to fully exploit the potential of electric engines. Steam required only one source of energy and machinery that required greater power was

“the combination of these new technologies and their interaction through physical, digital and biological domains make the industrial revolution different to the previous ones”.

6Artificialintelligenceisanareaof computer science that emphasizes the creation of intelligent machines that work and react like humans.

26Talking About

Society 5.0: un programma governativo si propone di guidare la trasformazione delle strutture sociali che accompagnerà la nuova rivoluzione delle macchine. Society 5.0: is a government program set up to guide the transformation of social structures that will accompany the new revolution of machines. Presentato dal Giappone lo scorso

marzo 2017, al CeBIT di Hannover –lapiùimportantefieraICT.Presnted by Japan in March 2017, at the CeBIT in Hannover – the most important IT trade fair.

5.0

positioned closer to the energy source. On the other hand, with electricity, every machine can be pow-ered by a single engine, therefore, the layout of facto-ries and manufacturing plants started to be de-signed on the basis of work flows and materials.

Getting back to the present, on a global scale the number of projects that favour and drive the breakthrough that will allow us to exploit the poten-tial of new technologies has grown. The US Ad-vanced Manufacturing Partnership, the Industrie 4.07 a project adopted by the German government, the strategic plan Made in China 2025 are examples of national strategies aimed at stimulating and direct-ing the application of technological innovations, to determine the outcomes of the fourth industrial revolution. But the range of transformation will be much greater and will go well beyond the industrial scope. The companies based in Silicon Valley includ-ing Uber, Airbnb, Linkedin, Facebook, Amazon, Google, Netflix, Twitter have already created a “break” with the past by changing, potentially everywhere and for good, our way of travelling, of moving, of buying, of looking for jobs, of communicating, of using multimedia content and so on.

In March 2017, at the CeBIT in Hannover – the most important IT trade fair – Japan presented its government programme Society 5.0 with the intention to lead the transformation of social struc-tures that will accompany the new revolution of machines. Even if we are not yet able to accurately outline the results of this transformation, to use the words of McAfee and Brynjolfsson, it will surely “be characterized by numerous examples of intelli-gence of machines and by billions of brains that will be interconnected and work together”.

The outcome will depend on our ability to imagine and build the future-present that awaits us.

7 Zukunftsprojekt Industrie 4.0 (I40) is a national strategic initiative from the German government. It is pursued over a 10-15-year period and is based on the German government’s High Tech 2020 Strategy. The initiative was launched in 2011, allocating € 200 million in funding.




Style

Talking AboutIV/IV

P. 3 L’evoluzione dello stile: la ricerca, il progetto, l’esperienza culturale. The evolution of style: the research, the design, the cultural experience. A cura di / curated by Rimadesio

P. 11 Stile: oltre il lusso, lo stile. A partire dalla moda, riscoperta e valorizzazione di un termine ambivalente. Style: Beyond luxury there is style. Starting from fashion, a path of rediscovery, reevaluation and appreciation of a rather ambiguous term. Luca Solca intervistato da / interviewed by Michele Lupi

Index Style

3 Style

“Una parola altamente impegnativa”1: così Gio Ponti, che per tutta la sua lunghissima esistenza lavorativa ne fece una continua, magnifica ossessione, definiva lo “stile”. Era il 1941: sono passati quasi 80 anni e chi oggi ha raggiunto quella medesima età viene defi- nito “ancora giovane”; eppure, dal punto di vista della storia del design, gli anni ‘40 sono un’altra era: quei decenni densissimi sono volati, fanno parte ormai della storia celebrata nei manuali. Tutto questo per notare che “impegnativa” suona come un ele-gante eufemismo, dato che sul tema è in corso da sempre un dibattito, ora eclatante, ora sotterraneo, comunque mai giunto a soluzione definitiva. Quella sullo stile è, con ogni probabilità, la vexata quaestio per eccellenza, la genitrice di una considerevole parte delle diatribe in cui si sono cimentati artisti, architetti, critici, teorici, filosofi, finanche politici nell’affrontare ciò che riguarda le arti e l’estetica, la definizione di bellezza, della sua percezione e di come essa influenza l’umana quotidianità. Da Vitruvio a Gottfried Semper, e nel Novecento, per rimanere in Italia, dai filosofi idealisti e post idealisti a quanti fecero loro da contraltare, come Dino Formaggio, fino agli architetti, Ettore Sottsass in primis, infinito è l’elenco di quanti si sono lambiccati a definire, per dirla con la Treccani, il “complesso dei caratteri specifici, rispondenti a un particolare tipo estetico, di un abito, un mobile, un oggetto e sim.”. Dove quel “sim(ili)” prefigura orizzonti di cosmica vertigine. Vocabolo difficile dunque “stile”, perché incoercibi-le e plastico, capace di attraversare le epoche e segnarle, per poi andarsene. La sua elasticità gli ha permesso di forgiare, con eguale

L’evoluzione dello stile: la ricerca, il progetto, l’esperienza culturale.The evolution of style: the research, the design, the cultural experience.A cura di / curated by Rimadesio

1 “Sotto l’egida d’una parola altamente impegnativa, ‘Stile’, si inizia una indicazione di opere d’architettura e d’arredamento, e anche di disegni, e di opere di pittura e di scultura”. Così Gio Ponti, nel gennaio 1941, presentava il primo numero di “Lo Stile nella casa e nell’arredamento”, il mensile “di idee, di vita, d’avvenire, e soprattutto d’arte” da lui creato edirettofinoal1947.

54 StyleTalking About

entusiasmo, le più diverse etichette: così eccolo giovane e frizzante aderire allo Jugendstil con quel tono floreale e avantgarde, profumato di Art Nouveau e di Arts&Crafts; per poi, pochi anni dopo, asciugarsi e, sempre all’avanguardia, trasfor-marsi nel geometrico, ortogonale, ascetico De Stijl. Per poi ancora, in ambito novecentesco, comparire in tandem con “moderno”, una sorta di locomotiva che ha trascinato infinità di vagoni dalle mille fogge e destinazioni.

Tuttavia un tratto comune sembra esserci dalla notte dei tempi a oggi: per il vasaio greco e per Prassitele, per l’architetto della cattedrale gotica e per lo scalpellino nella remota pieve, per il genio rinascimentale e per l’imbratta tele, per il virtuoso barocco della sgorbia e per il falegname di paese,

Lo stile è quindi legato ai molti aspetti dello scorrere del tempo, ne è espressione, benché in ogni epoca ne possano convivere diversi. La ricerca di uno stile rappresenta infatti la proposta di una interpretazione per un dato periodo storico, la migliore si spera, ma non è sempre così automatico. E inoltre lo stile deve anche “andare oltre il momen-to” sia per eccellere hic et nunc che per sopravvivere cioè durare: una questione fondamentale.

Parlando di produzione, lo stile ne è il DNA, quel particolare genoma i cui cromosomi si sono formati e sviluppati sia grazie a processi condivisi con altre aziende, sia sperimentando percorsi autonomi e originali. È un patrimonio genetico che, come qualsi-asi altro, deve comunque continuare a progredire nel tempo, pena l’estinzione. C’è un che di darwinia-no in questo dialogo tra originalità ed evoluzione: due vocaboli anch’essi “impegnativi” che in forma di attributo – originale ed evoluto – conferiscono a ogni stile la sua “magia” o, se vogliamo, scomodando con i doverosi distinguo Walter Benjamin, l’aura2. Cambiare senza mutare: non è “gattopardismo”, ma per l’industria è avere costantemente coscienza di sé e dei proprio obiettivi, sapere essere nel tempo, avere una visione precisa, duplice e contemporanea: lo sguardo nel domani, i piedi nella propria storia. Formula semplice a parole, ma che nei fatti richiede quotidiana attenzione.

2 ÈstatoilfilosofotedescoWalter Benjaminarifletteresull’aura,intesa come unicità dell’opera d’arte, e sulla sua scomparsa dovuta alla diffusione della riproduzione meccanica che dell’opera stessa si può avere grazie allafotografia.Nelsuocelebresaggio “L’opera d’arte nell’epoca della suariproducibilitàtecnica”,Nuovo Politecnico, Einaudi 1966.

creare uno stile – o anche solo imitarlo – è stato, più o meno consciamente, qualcosa di profonda-mente legato alla propria identità come autore ed esecutore, qualcosa che aveva a che fare con il raccontarsi agli altri, con la costruzione del presente a propria futura memoria.

Gio Ponti described style as a “a highly demanding word1”. And he should know as it was his continuous, magnificent obsession throughout his entire working life.

It was 1941: almost 80 years have gone by since then and those who have reached the same number in age, today are still called “young”; and yet considering the history of design, the forties are another era: those intensely dense decades flew by, they are part of a history celebrated in manuals. This is just to highlight that “demanding” sounds rather like an elegant euphemism, given that this subject has always been up for debate, at times blatant and conspicuous at others hidden and underground, depending on the period and therefore, as yet, has not given any definitive answers. Style is most proba-bly the vexata quaestio par excellence, generating discussions and disputes in which artists, architects, critics, theorists, philosophers even politicians took part in – lets say from Periclean Athens times, but can actually be traced back even further – discussing everything that related to the arts and aesthetics, the definition of beauty, its perception and how it influences daily life. From Vitruvio to Gottfried Semper, and in the twentieth century everybody did – in Italy idealist and post idealist philosophers such as Croce and his brilliant counterparts such as Dino Formaggio, and architects such as Ettore Sottsass in primis, the list of those who wished to define what Treccani describes as “the complex of specific natures

1 “Under the aegis of an extremely demanding word, ‘Style’, begins an indication of architectural works and furnishings, as well as drawings, paintings and sculptures”. That is how Gio Ponti, in January 1941, presentedthefirstissueof Lo Stile nella casa e nell’arredamento, the monthly publication “on ideas, on life, on the future and above all on art”. The publication that he created andmanageduntil1947.


Parlando di impresa, lo stile ne è insomma il DNA, il genoma i cui cromosomi si sono formati grazie a processi in parte condivisi con altre aziende, in parte sperimentando percorsi autonomi e originali. Speaking of companies, style is partoftheirDNA,thatsomethingthat has been tried and developed thanks to processes shared with other companies as well as experimenting individual and original paths.

Originalità ed evoluzione. Cambiare senza mutare. Originality and evolution. Changing without trans-forming.

and ways, responding to a particular aesthetic type, a piece of clothing, a piece of furniture, an object and similar”, is endless. As is the concept of “similar”. So “style” really is a difficult word, because it is uncontainable and malleable, able to go through time, leave its imprint and then take leave. Its mallea-bility has allowed it to forge the most diverse labels with equal enthusiasm: so, to give just two examples – here it is young and lively, endorsing the liberty style with that floral and avantgarde tone, fragrant of Art Nouveau and Arts&Crafts; then some years later, it dries out and while still being young and avantgarde transforms itself into geometric, orthogonal austere De Stijl. In the twentieth century it has appeared in tandem with “modern” a sort of locomotive that has dragged numerous wagons of all shapes and sizes to thousands of destinations.

However, there seems to be a common feature from the dawn of time until today. For the Greek pottery workshop artisan and for Praxiteles, for the architect of the Gothic cathedral and for the stone-mason of a remote parish church, for the Renaissance genius and for his smeared canvas, for the baroque virtuoso’s gouging and for a local town carpenter, the idea of creating a style – or even imitating one – has been and still is, something that is deeply connected to identity, something that has to do with telling their story to others, building the present and the imprint it will leave for the future.

Style is therefore connected to the many aspects of time passing because in every era different ones can co-exist. The search for a particular style and its statement is in fact the interpretation of a certain historical period- the best interpretation is hoped for but that has not always been the case. And moreover, style must go beyond that moment in time to excel hic et nunc (here and now) and to last: that is an essen-tial point. Speaking of production, style, well, its part of their DNA, that particular that has been formed and developed thanks to processes shared with other companies, as well as experimenting individual and original paths. It is a genetic patrimony that, just as any other, must continue to progress to avoid any risk of extinction. There is something Darwinian in this discussion between originality and evolution: these two words are also “demanding” and as qualifying adjectives – original and advanced – give each style their own magic or wanting to bring the distin-guished Walter Benjamin2 into the discussion, aura. Changing without transforming: it is not “superficiality”, but for industry it means constantly being aware of its objectives, knowing how to be modern with a dual and contemporary vision: with an eye to the future and its feet deeply rooted in its history. It seems a simple formula but actually requires daily attention.

2 TheGermanphilosopherWalter Benjaminreflectedontheauraof a work of art being devalued by mechanical reproduction, such as photography in his famous essay The Work of Art in the Age of Mechanical Reproduction,Nuovo Politecnico, Einaudi 1966.


E questo in ogni campo. Basta guardare per esempio ai diversi ed emblematici casi del mondo delle quattro ruote; se unico rimane quello della Porsche che dal 1931 produce in sostanza la stessa auto, limandone la linea e aggiornandola di continuo nella parte nascosta (tecnico-meccanica), da medi-tare è quello di Audi che, da storica produttrice nota per le sue vetture affidabili quanto esteticamente “anonime”, ha saputo evolvere sia tecnicamente a livelli di assoluta eccellenza (vedi l’identificazione con l’innovazione delle 4 ruote motrici) sia esteticamente, ridefinendo i suoi “limiti” estetici per tradurli in una raffinata affermazione di understatement; operazione questa che le ha permesso in modo lungimirante di cogliere e soprattutto di colmare un “vuoto” di mercato nella fascia alta del panorama automobili-stico. Emblematico è poi il caso di Alfa Romeo3, da sempre marchio corsaiolo per antonomasia, che riafferma la propria natura sportiva ritornando alla Formula1: un chiaro, allettante messaggio per gli estimatori del brand, un modo per fidelizzare gli storici e insieme cercare nuovi adepti. Tutto questo mentre l’intero settore automobilistico si trova ad affrontare un cambio epocale determinato dalla progressiva diffusione della propulsione elettrica.

Una questione tecnologica che sta impegnan-do già da tempo i grandi marchi dell’auto a ridefinire i codici stilistici sia del disegno delle carrozzerie, sia del complesso sistema di simbologie e di linguaggi che regolano i processi di comunicazione.

Ma non solo. La probabile applicazione su larga scala della guida assistita, oggi in fase di sperimen-tazione avanzata, (così come, lo si accenna soltanto, al concetto di smart city, totalmente interconnessa) avrà diverse conseguenze sulla natura stessa del veicolo, così come lo abbiamo finora conosciuto: dalla riduzione inevitabile delle velocità e dunque della componente sportiva dei veicoli, alla forma e funzione stessa degli abitacoli, sempre meno auto stricto sensu e sempre più estensione del salotto e dell’ufficio. Considerata la velocità dell’evoluzione tecnologica appare fin da ora fondamentale per le grandi case definire le necessarie strategie: come reinventarsi, con quale stile continuare a essere leader.

L’affermazione – orgogliosa – delle proprie radici e di una lucida visione dell’oggi subito domani, cioè di uno stile “attivo” (che impronta di sé il tempo, ne è padrone, non lo subisce) è la base su cui si fondano i brand più rilevanti – non importa se grandi o piccoli.

3 È stata annunciata a dicembre direttamente da Sergio Marchionne la partnership tra Alfa Romeo e il team elvetico di Formula Uno Sauber che di fatto sancisce il ritorno del marchio automobilistico alle competi- zioni dopo oltre 30 anni.

3 Sergio Marchionne announced the partnership between Alfa Romeo and the Swiss Formula One team Sauber in December, formalising the return of the automotive brand to car racing after over 30 years.

The proud statement of their own roots and a clear vision of today that immediately becomes tomorrow, or rather an “active” style (that have the imprint of time, are able to master it and manage any contrasts or unforeseen events) is the basis on which the most important brands, regardless of their size, are found-ed. And this is true in every sector. Just look at the different, classic examples in the automotive industry; Porsche is the only one who has produced what substantially is the same car since 1931, perfecting its line and continuously updating its technical mechan-ics. Audi is a case study to reflect on. The historic manufacturer, known for its reliable yet aesthetically anonymous cars, knew how to develop and evolve technically (think about its innovation as a four wheel drive) and aesthetically (redefining its aesthetic “limits” and transforming them into refined understatement) speaking at an outstanding level: an operation that has enabled the brand to be visionary and to capture and above all to bridge a gap at the high-end of the automotive sector.

All of this against a backdrop of an automotive industry trying to rise up to the epoch-making challenges of the progressive popularity of electrically driven vehicles. A technological issue the big car brands have long been working on, redefining the stylistic codes of the car body design as well as the complex system of symbols and language that regulate the processes of communication. But that is not all. The probable use of assisted driving on a large scale, which is now in the advanced testing phase, (just like the concept of dealing with smart cities that are totally interconnected) will have a number of consequences on the nature of the vehicle itself as we know it: from the inevitable reduction in speed and therefore to the sportslike aspect of the car, to the shape and function of their insides, increasingly less car-like and increasingly more similar to an extension of our living spaces or offices. Considering the speed of the technological evolution, it is essential to define the necessary strategies: how to reinvent yourself and with what style you continue to be the leader.

There are similar examples to be found in fashion, offering a wide range of extremely varied examples and stories. If the great founders of some

Another classic example is Alfa Romeo3, that has always been a racing brand par excellence, and has reconfirmed its sporting style by returning to Formula 1: a clear, appealing message for the brand’s loyal appraisers, a way to enhance the loyalty of the older followers as well as to find new ones.

10Talking About 1

Luca Solca NatoaMilanonel1963,economistadiformazione,operacomeanalistanel settore della moda ed è attualmente head of Exane, Luxury Goods Company,BNPParisbas.ScrivesulsitoThe Business of Fashion.

WasborninMilanin1963andhasasolidacademicbackgroundasan Economist and Analyst. He works as an analyst in the fashion sector and is currently head of head of Exane,LuxuryGoodsCompany,BNPParibas. He regularly contributes to the website The Business of Fashion.

Michele LupiNasceaMilanonel1965,nel1994èaNewYorkcomecorrispondenteperlaRizzoli. Dal 1999 fa parte della squadra di GQ Italia.Nel2003fondaRolling Stone Italia. Tra il 2006 e il 2011 è direttore responsabile di GQ Italia. Nel2014diventadirettoredelletestateIcon e Flair.Nel2015lancialarivistaIcon Design.

WasborninMilanin1965andbecametheNewYorkcorrespondentforRizzoli in 1994. In 1999 he became part of the GQ Italia team. In 2003 he started up Rolling Stone Italia. From 2006 to 2011 he was the editor-in-chief of GQ Italia. In 2014 he became the senior manager ofthe publications Icon e Flair. In 2015 he launched the magazine Icon Design.

Stile: oltre il lusso, lo stile. A partire dalla moda, riscoperta e valorizzazione di un termine ambivalente. Style: Beyond luxury there is style. Starting from fashion, a path of rediscovery, reevaluation and appreciation of a rather ambiguous term.Luca Solca intervistato da / interviewed by Michele Lupi


26.10.17h18.30



of the iconic brands of the fifties are no longer with us, and if their vision seems not to have left any trace in the collections of new designers, they do however remain a strong point of reference for the public. Here too, the sophisticated strategies necessary to preserve style are stimulated and sped up by technological innovation. In this sector they are represented by the popularity of digital technologies. On-line shopping is in fact transforming the distribution system making the showrooms functional places that are necessary for enhancing the value of the brand, places where you live “the experience” of style, while the more physical process of buying is carried out in more comfortable surroundings and in handier ways. An extraordinary example is that of Steve Jobs, who many people consider to be “the” maverick; who, defining the aesthetic standards for consumer electronic goods made them a must-have for everyone, everywhere. The small i – iPad, iMac, iPhone – is a sign of belonging to a style that simply has no equals, no offence to their Asian competitors... “Fashion changes, Style endures”, Coco Chanel once said. “Fashion reflects the times we live in, even if, when the times are dull we prefer to forget about it”. There are different and equally signifi-cant examples of brands active in specific sectors of fashion who then branched out into the clothing sector with enormous success4.

Reflecting on style and production you inevita-bly end up talking about the market. The fourth indus-trial revolution is close at hand; the production norms are in continuous development as are, consequently, commercial relations. The big names previously men-tioned remind us that capitalism reveals itself with has new dynamics, new forms of aggregation and for any company the knowledge of being original, today, more than ever before, has to do with its brand identity and the storytelling of the brand and its products. Or rather the telling of stories because the design industries (fashion, furniture and technologies) channel within theirs, next to their own, numerous others that they must make their own or in one way or anoth-er cannot not consider. Stories about people who reflect the company and vice versa, the so-called testimonials, or others that inspirit the key growth stages, consistent interpreters of a style.

The production houses that, considering the current complex and competitive market conditions need to retain their clients, having been won over

Marketing activities that have been able to tap into new sectors successfully “exporting” if you were, their reputation for the original excellence of materials and workmanship.

4 Illuminating examples from the luxury leather goods industry: Louis Vuitton, Prada, Fendi, Trussardi.

3

Più scivolosa ancora della parola stile è la parola lusso. Che cosa è il lusso?

Il settore del lusso comprende tutti quei prodotti per i quali il consumatore ritiene esista una caratteristica di esclusività. Questo implica che la definizio-ne è relativa, variabile in base agli individui. Per un adolescente “esclusive” sarannolescarpeNikeche,finalmente,èriuscitoafarsicomprare,perBillGates esclusivo è il Codice di Leonardo da Vinci che ha acquistato per parec-chi milioni di dollari. Sul mercato esistono quindi migliaia di sfumature rispetto alla percezione dell’esclusività.

Eppure, nel settore della moda, la parola lusso è oggi pratica-mente abolita, è diventata quasi una parola tabù?

Sicuramente è una parola di cui ciascuno di noi dà una definizione diversa. Ci sono però due aspetti importanti che consentono a un’azienda operante in questo settore di vendere a 100 quello che in termini di produzione costa 10/15. Il primo aspetto è appunto l’esclusività: chi compra deve percepire ciò che sceglie come esclusivo. Il secondo aspetto è invece l’incremento di identità personale: una volta acquistata, la “cosa” in questione riesca a fornire un aspetto identitario all’acquirente.

Noncredicheoggilaforbicetraprezzodivenditaevaloreeffettivo si sia allargata eccessivamente? E che persino le fasce più abbienti della popolazione se ne siano accorte?

Il rischio maggiore è in realtà un altro ovvero che un marchio oggi percepito come esclusivo possa, in tempi molto brevi, banalizzarsi, perdendo appeal. Certo, ci sono una serie di tratti che ci consentono di misurare questo rischio e che indicano “difendibilità del valore”. A questo proposito bisogna sottoli-neare come il “valore intrinseco” diventi una variabile molto importante nel momento in cui assistiamo all’ingresso sul mercato di marchi nuovi con una struttura di costi molto diversa. Mi spiego: le grandi aziende del lusso oggi si basano ancora su una distribuzione diretta di tipo fisico: hanno negozi posi-zionati nelle zone più esclusive del mondo, quindi con affitti molto alti, ed ecco che il margine lordo diventa molto elevato e il costo del venduto non può essere superiore al 10/15%. Viceversa i nuovi marchi, vendendo su internet, hanno costi di distribuzione molto più bassi e quindi possono forni-re una percentuale di valore intrinseco molto più alta. E’ un argomento fonda-mentale soprattutto per il consumatore giovane, il cosiddetto millennial, che a parte analisi di altro tipo, ha senz’altro meno denaro della generazione precedente.

Questi due mondi, la moda e il design, da un lato distanti, dall’altro molto vicini, in che modo potrebbero cominciare a interagire?

Ma guarda che, anche per l’arredamento, non siamo poi così lontani dalle problematiche che stavo illustrando: pensiamo al problema della distribuzio-ne e a come alcuni nuovi players lo stiano affrontando ad esempio con la vendita via internet oppure analizziamo certe politiche di sconti eccessive. Ovviamente lo story telling dell’esclusività viene immediatamente corroso

5

se io trovo, in rete, lo stesso mobile che ho appena comprato a un prezzo scontato. Risolto questo aspetto però il problema del mercato dell’arreda-mento è esattamente l’inverso di quello, ad esempio, della pelletteria di lusso: perché se i marchi della pelletteria di lusso, o degli orologi, simulano un’esclusività, ma poi vendono a milioni di clienti nel mondo, i marchi del living sono effettivamente esclusivi. Quindi, caso mai, il mercato del living ha il problema di democratizzarsi e di rendersi accessibile a un mag-gior numero di clienti.

Ritorniamo ancora un momento al fashion per dedurne delle lezioni applicabili nell’ambito dell’arredo: mi pare che, in tempi recenti, alcuni marchi di moda ancora in mano a famiglie italiane abbiano conosciuto una crisi piuttosto forte?

E’ vero, ma credo che in realtà i problemi non siano tanto legati all’e-commerce, quanto piuttosto al cambio di identità del consumatore. Se 10 anni fa uno qualunque di quei marchi arrivava ad avere un 2% di consumatori cinesi, oggi la Cina conta per un terzo del mercato. Se, all’inizio, i consumatori cinesi, che non avevano “nulla” negli armadi, compravano compulsivamente tutti i pezzi più iconici, ora non li comprano più: semplicemente perché ce li hanno già! Quindi ciò che sta guidando il successo sul mercato è in questo momento la capacità di innovare e di colpire il consumatore con delle nuove idee di prodotto. Prendi ad esempio Gucci e la sua rivoluzione estetica negli ultimi due anni oppure considera le edizioni limitate di Louis Vuitton con Supreme o con Jeff Koons (in generale l’arte è uno dei modi con il quale le imprese del lusso cercano di nobilitarsi!). Tutto ciò serve a creare un impatto mediatico molto forte e quindi “traffico” nei negozi. Altri marchi, che si sono forse fidati troppo dei successi del passato, non hanno beneficiato di questo fenomeno (penso a Prada o a Bottega Veneta) e inoltre, presi dall’entusiasmo di andare verso l’alto di gamma, si sono dimenticati, proprio nel momento in cui erano particolarmente esposti per l’apertura di molti nuovi negozi nel mondo, di quella fascia di consumatori che comprano borsette tra 500 e 1500 euro: una fascia importante per tutti quelli che non si chiamano Chanel o Hermes.

Parliamo dunque del futuro dei negozi. Credo che, a breve, si arriverà a far pagare un biglietto per entrare in certi negozi: infatti se la vendita passerà sostanzialmente sul canale digitale, il negozio dovrà offrire un’alternativa esperienziale. Ma se nei negozi non ci sarà più la merce, cosa ci sarà? Solo schermi interattivi?

Se pensiamo allo sviluppo del retail monomarca di lusso negli ultimi quindi-ci anni possiamo verificare che si è trattato di uno sviluppo “di conquista”, con una continua espansione ove la preoccupazione maggiore era dare un’immagine “coerente” in tutti i punti vendita del mondo e garantire un comune standard qualitativo. Standardizzazione è stata quindi la parola chiave: a Shanghai come a Milano vieni accolto nello stesso modo, trovi un ambiente simile. Tutto molto noioso! Forse, se sono arrivato a Shanghai, voglio trovare qualcosa di diverso, con una rilevanza locale. Credo che dovrà quindi esserci una contro-standardizzazione del retail e che i negozi dovranno 4

The word luxury is even trickier than the word style. Whatisluxury?

The luxury sector includes all those products that the consumer considers to beexclusive.Thisthereforeimpliesthatthedefinitionisrelativetoeveryindividual.AnadolescentwouldconsiderthatpairofNikesneakersthattheyhavefinallybeenabletobuy“exclusive”,ontheotherhandBillGateswouldconsider his million dollar worth Leonardo da Vinci Codex exclusive. So the market offers a wide range of interpretations to the perception of exclusivity.

And yet, in the fashion sector, the word luxury has practically been abolished. Has it become a taboo word?

Itisdefinitelyawordthateveryonegivesadifferentmeaningto.Therearehowever two important aspects that allow a company working in this sector to sell goods at 100 but those same goods in terms of production cost 10/15. Thefirstaspect,aswesaid,isexclusivity:theconsumermustperceiveasense of exclusivity about their choice. The second aspect is the enhancement of personal identity: once the item has been purchased, the item in question is able to provide the purchaser with an identity factor.

Do you not think that the difference between the Recommended Retail Price and the actual value of products has become excessive?Andthateventhemostaffluentconsumershavebecome aware of this difference?

In reality the greatest risk is another, and that is that a brand considered exclusive today can lose appeal in no time at all. Of course there are a series of features that act as a gauge, assessing this risk and indicating the “ defensibility of value”. To this effect it must be underlined how “ intrinsic value” becomes an important variable when we witness new brands entering into the market with a different cost structure. Let me explain: the big luxury brands still usedirectbricksandmortardistribution,theyhavetheirflagshipsandstoresin the most exclusive locations resulting in high overheads, resulting in a high gross margin, but the cost of the sale cannot exceed 10/15%. The new brands,on the other hand, selling on-line, have much lower distribution costs and consequently can provide a much higher intrinsic value. This is an im-portant issue especially for the young consumer, the so-called millennial, who has,without doubt, less spending power and disposable income than the previous generation.

How can these two worlds, fashion and design, which are similar but yet different, begin interacting?

Youknow,evenintheworldoffurnituretheproblemsarenotsodifferenttothose I previously outlined: think about the problem of distribution and how some new players are tackling it by, for example, selling on-line or by analys-ing excessive discount policies. It goes without saying that the story telling of exclusivity is immediately damaged if I come across the same piece of furniture offered at a discount price on line. Once this aspect is resolved however the problem of the furniture market is exactly the opposite of that of luxury leather goods: because luxury leather goods brands, or watch brands

7

diremoltodipiùsulDNAesullecaratteristichespecifichedelmarchio.Facciol’esempio di Fendi che ha il suo flagship store a Roma: ebbene, dietro un vetro, come in certi ristoranti di lusso, vi sono degli artigiani che producono le celebri pellicce. Ecco un aspetto specifico che non potrai trovare da Gucci o da Vuitton! Si tratta insomma della necessità di rendere l’incontro con il cliente più pre-gnante. Questo è fondamentale anche per i nuovi marchi che si affacciano sul mercato provenendo da Internet: avranno meno punti vendita, ma capaci di proporre esperienze forti, di grande impatto e che consentano al consumatore di comprendere appieno l’identità del marchio stesso (pensiamo, ad esempio, all’occhialeria da sole coreana Gentle Monster).

Tornando all’e-commerce,seprimac’eranoYooxeNet-a-porter, ora impazza Farfetch. Qual è la differenza? Forse che i primi due compravano la merce e creavano grandissimi magazzini cui attingevano per evadere gli ordini, mentre il secondo, fatta la vendita on-line, si appoggia direttamente a 500 negozi nel mondo che si approvvigionano presso i loro magazzini. E’ questa la strada?

Certo! E’ evidente come ci sia una grande differenza in termini di capitale investito: se voglio vendere “net-a-porter” devo fare magazzino, investendo veramente un grosso capitale, mentre se “non ho investito” nulla quello che avrò guadagnato avrà un “ritorno sul capitale” molto più alto.

Le aziende devono farsi carico direttamente della loro distribuzione?

Sarebbe meglio, ma affrontiamo un momento la questione dell’wholesale. Ricordiamo innanzitutto di cosa si tratta: wholesale significa vendere non al cliente finale, ma a qualcuno che distribuisce per me. Quale è il problema in questo meccanismo? Il problema sta nel controllo del marchio, dell’esperien-za d’acquisto e soprattutto di quella che chiamiamo la “disciplina del prezzo”. Se ad esempio io ho insistito parossisticamente sulla esclusività, poi però ho venduto la mia merce a un grande magazzino americano che alla fine della stagionelasvendeal70%off:èunbelguaio!Iocompratoresareimoltonaive se continuassi a credere a quanto mi avevano raccontato. Problema moltipli-cato per 100 nell’epoca di Internet: basta infatti che uno dei miei clienti internet decida di vendere in stagione la merce al 30% off, ed ecco il disastro! Nonsitrattainfatti,comeavvenivauntempo,diandareascoprire,graziealpassa-parola, queste speciali condizioni in un negozietto di Hong Kong, basta usare Google e chiunque lo scoprirà. Ecco perché l’wholesale può far male!

E il vintage, come si inserisce nel mercato del lusso? E’ importante oggi la memoria?

Anche se non è l’unico modo, pensiamo ad Apple che gioca totalmente sull’innovazione, il vintage è certamente uno dei modi di convincere il cliente che una cosa è esclusiva: fare riferimento all’eredità del passato… Heritage first of all!

6

feign exclusivity but then sell to millions of clients throughout the world, the brands of living and design are essentially exclusive. Therefore, if anything, the living and design market has the problem of democratizing itself and making it accessible to a greater number of clients.

Let’s go back a moment to fashion to gather some lessons that can be applied to the furniture sector: I believe that, in recent times, some of those fashion brands still in the hands of Italian families have been experiencing an extremely deep-rooted crisis?

It is true, but I think the problems are not so much connected to e-commerce, but more to the changing identity of the consumer. If 10 years ago any one of those brands had had 2% of Chinese consumers, today China accounts for a third of the market. If, at the beginning, Chinese consumers didn’t have any-thing or at least anything they wanted in their wardrobes, they would go out and compulsively buy up all the iconic pieces, now they don’t buy them any-more: simply because they already have them! So what is driving the success of the market is the ability to innovate and to amaze the consumer with new product ideas. Take Gucci, for example, and its revolution in appearance over the last two years or consider the limited editions by Louis Vuitton with Su-preme or with Jeff Koons (in general art is one of the ways with which luxury companies try to distinguish themselves!). All this in order to create a media impact and therefore footfall in stores. Other brands, who perhaps relied too much on past successes (Prada or Bottega Veneta to name a few) were not able tobenefitfromthisphenomenonandmoreover,absorbedbytheenthusiasmof going in the direction of luxury and prestigious goods, they forgot about that market segment of consumers who spend between 500 and 1500 euro on a bag: an important segment of the market for those who do not go by the name of Chanel or Hermes.

So let’s talk about the future of shops. I think that shortly we will get to the stage of having to pay a ticket in order to enter certain shops. If sales shift from the traditional bricks and mortar channel to a digital one, shops will have to offer an al-ternative experience. But if the goods are no longer stocked in shops, what will replace them? Only interactive screens?

Ifwethinkaboutthedevelopmentofluxuryflagshipstoresinthelastfifteenyears we can see that it is a “conquering” one,in continuous expansion, and where the main concern was to to give a “coherent” image to all points of sale throughout the world and offer a common quality standard. Standardiza-tion has been the key word: you are accommodated in Shanghai the same way you are in Milan, there is a similar environment. And it is incredibly boring! Perhaps,whenIarriveinShanghai,Iwanttofindsomethingdifferent,some-thinguniquewithalocalvalueorsignificance.Ithinkthereshouldbethenacounter standardization strategy in retail and that shops should be telling us aboutthebrand’sDNAanditsspecificcharacteristics.ImaketheexampleofFendi,whohasitsflagshipstoreinRome:well,behindaglasspane,justasinsome luxury restaurants, there are a number of artisans who are working on thebrand’srenownedfurs.Aspecificaspectthatyouwon’tfindatGucciorVuitton! It is about making the encounter with the client richer. This is funda-

19 Style

Analoghi gli esempi nella moda, con un panorama di casi e storie estremamente vario. Se i grandi fondatori dei mitici marchi degli anni cinquanta non ci sono più, e se la loro visione non sembra rintracciabile nelle collezioni dei nuovi designer delle griffe, essa rimane comunque fortissima come memoria, aura e dunque come segnale di riferimento per il pubblico. Anche qui le sofisticate dinamiche necessarie a preservare lo stile sono sollecitate dall’innovazione tecnologica, in questo ambito rappresentata dalla diffusione del digitale.

Caso straordinario infine quello di Steve Jobs, per molti “il” visionario in assoluto, il quale, definendo i canoni di bellezza dell’elettronica di consumo, l’ha resa un must have mondiale. La i minuscola – iPad, iMac, iPhone – è un segno di appartenenza a uno stile che, con buona pace dei competitor orientali, non ha uguali. “La moda passa, lo stile resta”, diceva Coco Chanel. “La moda riflette i tempi in cui si vive, anche se, quando i tempi sono banali, preferiamo dimenti-carlo”. Diversi e altrettanto significativi i casi di brand che, attivi in precisi settori della moda, hanno allarga-to il loro campo d’azione all’abbigliamento, ottenendo enormi successi4. Operazioni di marketing che, nel segno di uno stile inconfondibile, hanno saputo entrare e vincere in nuovi settori, “esportandovi” l’originaria eccellenza dei materiali e delle lavorazioni.

Riflettendo su stile e produzione si finisce gioco- forza a parlare di mercato. La quarta rivoluzione industriale è prossima: le forme della produzione sono in continua evoluzione, così come, di conseguenza, i rapporti commerciali. I grandi nomi citati ci ricordano che il capitalismo si manifesta con nuove dinamiche, nuove forme di aggregazione e che, per qualsiasi azienda, il saper essere originali, oggi più che mai, ha a che fare con l’identità e la narrazione di sé e dei propri prodotti. Storie che spesso riguardano personaggi in cui si identificano le aziende stesse, i cosiddetti testimo-nial, o altri che ne animano le tappe di crescita fonda-mentali, interpreti coerenti di uno stile.

Le case produttrici, nel panorama odierno estremamente complicato e segnato da una forte compe- titività, hanno l’esigenza sia di mantenere la propria clientela, conquistata e fidelizzata grazie a uno stile ben preciso, sia di acquisire nuove quote di mercato (l’export e il contract sono parti fondamentali dei loro

Lo shop-online sta infatti trasformando il sistema di distribuzione rendendo gli showroom un luogo funzionale alla necessaria valorizzazione del brand, dove vivere “l’esperienza” dello stile, mentre il processo fisico della vendita avviene attraverso più comode modalità.

4 Esempi illuminanti, provenienti tutti dalla alta pelletteria: Louis Vuitton, Prada, Fendi, Trussardi.

8

mental also for the new brands appearing on the market and coming from e-commerce: they will have less points of sale, but will be able to propose memorable experiences which leave an long-lasting impact and allow the consumer to fully understand the identity of the brand (think about the Korean eyewear brand Gentle Monster).

Going back to e-commerce for a moment, before there were YooxandNet-a-porter,nowFarfetchisalltherage.Whatisthedifference?Perhapsthefirsttwoboughtthegoodsand created large warehouses to store them in, and then manage the orders, while the latter, once the sale is processed on-line, is directly supported by a network of 500 shops located throughout the world that get the stock from their wareshouses. Is this the direction to go down?

Sure! It is obvious that there is a big difference in terms of investment: if I want to sell “net-a-porter” I have to take stock, investing large amounts of capital, but if I “haven’t invested “anything then what I earn will have a much higher “return on capital”.

Do companies have to be directly responsible for their distribution?

It would be better if they were, but lets talk about the question of wholesale. First of all, let’s just remind ourselves what it is about: wholesale is the sale of goods to other professional business users. It is the sale of goods to anyone otherthanthefinalconsumer,someonewhodistributesthegoodsforme.Whatproblemsareinvolved?Theproblemliesinthecontrolofthebrand,the buying experience and above all what is called price regulation. If, for example,Ihavefiercelybackedmybrand’sexclusivitybutthenIsellmygoods to a large American department store who decides to clear stock at the endoftheseasonoffering70%off:wellthatisaskingfortrouble!Thebuyerwould be incredibly naive if he continued to believe all the story telling. That problem is multiplied 100 times in the Internet era: it would just take one of my internet clients to decide to sell the current season at 30% discounted prices and that would be disastrous. It is no longer about by word-of-mouth: findingoutaboutthesespecialconditionsinasmallshopinHongKong,nowjustbyusingGoogleanyonecanfindout.That’swhywholesalecanbebad!

Andhowdoesvintagefitintotheluxurymarket.Arememoriesand the past important nowadays?

Even if it is not the only way, (just think about Apple who wagers its whole company on innovation) vintage is certainly one of the ways of persuading the client that something is exclusive: referring to past legacies: Heritage first of all!


fatturati) senza tuttavia stravolgere né la loro immagine né lo stile che hanno scelto. L’immobilità, per contro, è letale: “Non importa se vai avanti piano, l’importante è che non ti fermi”, sentenziava Confucio5.

Esigenza oltremodo sollecitata da un target culturalmente sfuggente, quello riconducibile ai cosiddetti nuovi mercati, rispetto al quale occorre definire linguaggi e forme di comunicazione diffe-renti. Se il sistema moda, con i suoi ritmi rapidissimi, sembra non fare in tempo ad avere paura, per altri ambiti la questione è differente: la produzione di un nuovo prodotto richiede tempo e sperimentazione, ovvero grossi investimenti. Questa la ragione per cui l’evoluzione di uno stile si presenta con tempi lenti, mentre risulta più evidente la battaglia giocata sul dettaglio, sui materiali. Una sfida che vuole comunque dire ricerca: altra voce che dà allo stile una importante dinamicità. Fare ricerca, innovare non è un luogo comune. È un lavoro di squadra che fa crescere l’azienda.

Le industrie del design sono strutture produttive ad alto contenuto tecnologico. La ricerca e l’impiego di materiali inediti, così come l’abilità nel conferire nuove performance ai materiali tradizionali, sono condizioni fondamentali per poter parlare di evoluzione degli stili, per migliorare e rendere maggiormente attraenti le invarianti estetiche di ciascuna industria. Parlare dello stile di un prodotto significa in realtà infatti parlare dello stile di produzione di una certa azienda, di come essa ha saputo organizzare i proces-si di realizzazione, quindi, sintetizzando, ambiente, sostenibilità, riciclo. Altri tre vocaboli difficili cui però anche il pubblico meno preparato è oramai partico-larmente sensibile. Oggi possiamo sostenere che certificazioni, tracciabilità delle materie, limitati consu-mi energetici per la produzione, basso impatto ambien-tale, cura della salute dei dipendenti, siano tutti ele-menti che influiscono sulla definizione dello stile di un’impresa e di conseguenza sul consenso per i suoi prodotti.

La “stile della produzione” determina infatti un nuovo rapporto tra azienda e cliente. Non si tratta più unicamente di un rapporto commerciale, smart o friendly che dir si voglia, ma di stima e affetto reali. Se il cliente è informato sull’attenzione dell’azienda per l’ambiente e per i suoi dipendenti, è naturalmente portato a concederle la propria fiducia. Lo “stile di produzione” è dunque un altro importante messag-

5 Confucio(551a.C.–479a.C.),non esistono testi da lui direttamente scritti. Le sue celebri frasi e gli aforismi sono stati organizzati in un testo – I Dialoghi – dagli allievi che li avevano raccolti oralmente dal maestro.

La lentezza viceversa è certamente un lusso, ma è indispensabile per elaborare compiutamente uno stile che non rappresenti un exploit del mo-mento, ma un ponderato passo evolutivo.

The design industries are productive and highly technological industries. Research and the use of new materials, just as the ability to lend new performance to traditional ones, are fundamental conditions for the evolution of styles, to enhance them and to make the aesthetic invariants of every industry more attractive.

and having enhanced their loyalty thanks to a well defined style, need to acquire new market share (export and contract clients play an essential part in their turnover) without however shaking up their image or the style they have chosen. At the same time immobility is lethal. “It does not matter how slowly you go as long as you do not stop” Confucio5 said. Taking time, on the other hand, today, is undoubtedly a luxury, but it is indispensable in order to fully create a style that is not simply a passing fad, but a well thought out, evolutionary step. A requirement urgently required by a culturally elusive target, the one that refers to the so-called new markets, where it is neces-sary to define new languages and different forms of communication.

If the fashion system, with its incredibly fast-paced rhythms, almost seems not to have the time to be afraid, in other sectors the story is different: producing a new product requires time and testing, in other words big investments. This is the reason why the evolution in style takes longer, while the contest on details and materials seems more evident. A chal-lenge, that means in any case, research. And that is something that gives style its dynamism. Research and innovation are not clichés. It is team work that makes a company grow and excel.

Speaking about the style of a product actually means speaking about the company’s production style, how it has been able to organize its production processes, in short therefore, the environment, sustainability, recycling. Three difficult words that even the less knowledgeable members of the public have become sensitive to. Today we can affirm that certificates, traceability, limited energy consumption for production, low environmental impact, staff health and safety all affect the definition of style for a compa-ny and consequently the approval of its products.

The style of production actually determines a new relationship between the company and the client. It is no longer simply a commercial relationship, one that is smart or friendly, call it what you will, but it is one of real esteem and affection. If the client is informed about the company’s awareness on

5 Confucio(551a.C.–479a.C.),there are no texts written directly by him, his renown phrases and aphorisms have been put together in The Dialogues, analects by his disciples who collected fragments of dialogues.


gio che il significante prodotto veicola: si acquista perché si condividono determinati valori etici. Estremizzando, il cliente diventa, in certo senso, un nuovo membro della “famiglia azienda”.

Entità misteriosa il pubblico: pluristratificato, difficile, volubile, distratto, internazionale. Il suo orologio bio-economico è tachicardico, batte al ritmo della moda6 che, dice Deyan Sudjic, direttore del Design Museum di Londra “è la forma più sviluppata di obsolescenza programmata”. Dunque il suddetto pubblico, una volta catturatane l’attenzione, non è detto che, altrettanto rapidamente, non possa stancarsi. Perché, come precisa Alberto Bassi, saggista e do- cente allo IUAV di Venezia, “alle principali ragioni che sono state per lungo tempo alla base delle nostre scelte, e cioè da una parte l’efficacia funzionale, tecnica e di rendimento, dall’altra la qualità estetica e realizzati-va dei prodotti, si è affiancata l’esigenza di dimostrare l’acquisizione di status symbol attestanti una condizione economico-sociale, o di style symbol, a prova di una particolare condizione culturale ed esistenziale”.

Con quale stile dunque decideremo di comu-nicare un nuovo prodotto? Se lo stile ha a che fare con la narrazione della identità aziendale e di prodot-to, oggi è fondamentale sapere scegliere come, in quale/i modo/i operare: determinare cioè quale sarà lo stile più adatto a veicolare efficacemente quella specifica identità.

La nascita e il diffondersi a livello planetario della grande rete-ragnatela dei nuovi media impone alle aziende una diversa riflessione sulla comunica-zione del proprio stile. Si tratta di una nuova sfida in quanto la struttura stessa del web, il suo essere un parente spurio della televisione, della radio e della parola scritta costringe a inventare nuove forme/format nei quali spesso adottare un nuovo stile non è semplice. Certo, la rete è veloce, superficiale: è da guardare. La parola sopravvive, ma l’immagine è predominante.

Per “comunicare lo stile” ci vuole insomma un “nuovo stile di comunicazione”, o meglio, l’esistente va aggiornato, integrato, adattato al mondo nuovo. Perché lo stile nella sua essenza è sempre lì, insieme di fattori fisici e immateriali, forma e visione, la pelle di un oggetto e l’aura che lo circonda e che spesso lo rende desiderabile. Oggi non basta più descrivere un oggetto, farlo vedere in ogni particolare. Ciò che tutti desiderano, si è detto, è vivere un’esperienza, meglio se unica. Il mondo bidimensionale e immobi-le della foto, anche di quella “d’autore”, è diventato piccolo e il prodotto di design per farsi conoscere, esperire, deve trovare altri luoghi, altri mondi, o quantomeno immagini di mondi, in cui posizionarsi.

La strada dell’esperienza culturale è una auspicabile scelta di stile nella comunicazione, da

6 Moda. Entriamo in un campo didiscussione davvero ampio: se di design accettiamo la traduzione lette-rale, cioè “progetto”, allora dobbiamo accettare che tutto il sistema di oggetti e simboli in cui viviamo sia “design”, perché, senza dubbio alcuno, ogni cosa è stata pensata (progettata) per assolvere a determinati compiti. Ma il design è solo questo? E la moda cibastadefinirlacometendenzado-minanteepasseggeracheinfluenzailmodo di vita e le abitudini di un certo periodo storico? Parafrasando Dino Formaggio che diceva “Arte è tutto ciò che gli uomini chiamano arte”, viene da chiedersi se “Moda” non sia tutto ciò che gli uomini chiamano moda; non volendo così risolvere la questione con una battuta, ma sem-plicemente sottolineare che la moda, come l’arte e in fondo il design, è strettamente correlata ai periodi stori-ci in cui nasce, si sviluppa, decade per poi tornare diversa e uguale.

I nuovi media impongono alle aziende una nuova, diversa riflessione sulla comunicazione del proprio stile, la struttura stessa del web, (...) costringe a inventare nuove forme/format (...), la rete è veloce, superficiale: è da guardare, c’è la parola ma l’immagine è predominante.

The new media compel companies to reflect on a new different type of communicating their style, the very structure of the web, (...) means having to invent new forms and formats (...), the web is fast and superficial: it is to be seen, there are words but images are prevalent.


prefigurare come un investimento a medio/lungo termine.

Condizione fondamentale perché le attività di promozione culturale possano poi rivelarsi spunto di riflessione e motivo di stimolo. Solo il tempo aiuterà a riconoscerne gli effetti concreti.

Per avere risultati significativi esiste tuttavia una discriminante a monte ovvero che tale espe-rienza affondi nel DNA stilistico dell’azienda, in un patrimonio preesistente di esperienze e visioni autentiche.

matters like the environment and the well-being of its staff, they are naturally more inclined to become loyal. The “style of production” is therefore another important message that is conveyed. Clients purchase because they share certain company ethical values. Taking this idea to extremes, the client becomes, in a certain way, a new member of the family, company.

Because, as Alberto Bassi, essayist and teach-er at the IUAV in Venice, points out “along with the main reasons that have long been the basis of our choices, namely the functional, technical and perfor-mance qualities on one hand and aesthetics, on the other, there is now also the need to show off a status symbol-testifying a certain social-economic condition or a style symbol showing a particular cultural and existential condition”.

What style then do we decide to communicate a new product with? If style is connected to the story-telling of the product and the company, it is imperative nowadays to know how to choose what way or ways to operate: that is to say determine the style that describes that identity in the best possible way.

The creation and the diffusion of the current large network of new media on a global scale means that companies have to reflect on a new, different type of communication of their style. It is a new challenge because the web structure itself, being a spurious relative of the television, the radio and the written word, compel companies to invent new forms, where it is not often easy to adopt a new style. The web is, without doubt, fast and superficial, it is to be watched. Words live on but images are prevalent.

In order to “communicate style” a “new style of communication is required”, or rather, the current existing one needs to be updated, integrated and adapted. Because style in its essence is always present, a set of physical and immaterial factors, its form and vision, the life of an object and the hype or aura that surrounds is what often makes it desirable. Today it is no longer enough just to describe an object, to show

The general public are a mysterious lot: multilay-ered, difficult, fickle, absent-minded, international; their bio-economic clock is tachycardic and beats to the upbeat rhythm of trends6, which, says Deyan Sudjic, Director of the Design Museum in London “is the most developed form of planned obsolescence” and so, the so-called public, once their attention has been captured, can just as easily get bored.

6Fashion.Weareenteringawideranging area of discussion: if we accept the literal translation of design as “project” then we have to say that the entire system of objects and symbols in which we live are elements of design, because they have all be “designed” to do certain tasks. But is it only that? And is it enough to describe fashion as a dominant and passing trend thatinfluencesthelivesandhabitsof a certain period? Paraphrasing Dino Formaggio who said “Art is everything that man calls art”, raises the question is fashion all that man calls fashion? not wanting to solve the question with a joke, but rather emphasize that fashion, just like art and design is closely related to the historical periods in which it lives, develops, and eventually dies out, to then comes back differently but at the same time the same.


Lo stile ha a che fare con la narrazione della identità dell’azienda e del prodotto, oggi fondamentale è sapere scegliere come, in quale/i modo/i operare: cioè lo stile che più efficacemente racconti quelle identità.Style is connected to the storytelling of the company and the product, it is imperative to know how to choose what way or ways to operate that is to say the style that best describes that identity.

every slight detail. It is said that everyone wants to live an experience, and a unique one at that. The two dimensional and immobile world of photos, even the more artistic ones, has become small and in order to get themselves known and be experienced, products of design must find other places, other worlds or at least images of other worlds, to position themselves in.

The direction of cultural experience is a desira-ble choice of style for communication as a medium/ long term investment. In order to have significant results there is, however, from the outset, a discrimi-nating factor, that is to say, that that experience must merge into the company’s stylistic DNA, into a pre-existing wealth of authentic experiences and visions. An essential condition so that the activities of cultural promotion can then be a starting point for reflection and a further incentive. Only time will enable us to recognise its concrete effects. So it seems increasingly clear that style today is more than ever a distinctive imprint of cultural tradition.




30 gennaio 2018 Flagship store Milano Via Visconti di Modrone 26 Talking About Ecologia, Architettura, Tecnologia, Stile: quelli che Rimadesio considera i componenti del proprio DNA, sono stati i temi protagonisti di Talking About, una serie di incontri tra protagonisti della scienza, della cultura e dell'impresa svolti tra la primavera e l'autunno 2017. La sintesi di ogni incontro, affiancata da una libera riflessione dell'azienda, rappresenta il contenuto di una raccolta di dispense dedicate. In occasione della pubblicazione di Talking About, Davide Malberti, CEO di Rimadesio ha dichiarato: “Tra gli impegni costanti di un’azienda c’è senz’altro quello di interrogarsi sulla validità delle proprie scelte, sul piano stilistico e industriale, ovviamente, ma anche su quello etico e ambientale. Un impegno che necessariamente comporta l’indagine della attuale situazione segnata da una fase di straordinaria trasformazione. Da questa consapevolezza è nata l’esigenza di riflettere sui temi che in Rimadesio consideriamo da sempre componenti del nostro DNA ovvero architettura, ecologia, tecnologia e stile. Parole complesse, alcune sicuramente oggi abusate, ma che comunque celano un mondo intero di significati. Per questo è importante discuterne. Abbiamo così affidato a Marco Romanelli il compito di organizzare una serie di incontri con uno straordinario gruppo di protagonisti della contemporaneità, non necessariamente afferenti, in modo canonico, al panorama del design. Abbiamo parlato di Architettura degli Interni con Beppe Finessi, di Ecologia con Marco Belpoliti e Stefano Salis, di Tecnologia con Angelo Cangelosi e Matteo Pirola, di Stile con Luca Solca e Michele Lupi. In queste dispense, volutamente prive di immagini, troverete, oltre alla sintesi di ciascun incontro, una nostra indagine rispetto alle tematiche affrontate e, soprattutto, molti spunti di riflessione, molte domande ancora irrisolte e infine, forse, alcuni suggerimenti per il futuro.” Teatro Rimadesio Programma incontri 2017 25.05 Architecture Beppe Finessi a colloquio con Marco Romanelli

06.07 Ecology Marco Belpoliti a colloquio con Stefano Salis

28.09 Technology Angelo Cangelosi a colloquio con Matteo Pirola

26.10 Style Luca Solca a colloquio con Michele Lupi Credits Concept: Paolo Mojoli Curated by: Marco Romanelli Graphic design: Juma

Press Office – Alam per comunicare Tel +39 023491206 [email protected]

Rimadesio spa via Furlanelli 96 - 20833 Giussano (MB) Italy tel. +39 0362 3171 – fax +39 0362 317317 www.rimadesio.it – [email protected]

http://www.rimadesio.it/

January 30th, 2018

Flagship store Milano Via Visconti di Modrone 26 Talking About Ecology, Architecture, Technology, Style: the essential components of Rimadesio’s DNA were the main themes of Talking About, a series of meetings with the protagonists of science, culture, and industry that took place spring through autumn 2017. The summary of each meeting, together with an open consideration of the company, makes up the content of a collection of dedicated booklets. On the occasion of the publishing of Talking About, Davide Malberti, CEO of Rimadesio, declared: “One of the constant commitments of a company is, undoubtedly, to wonder about the effectiveness of its choices, in terms of style and industry, but, of course, also on an ethical and environmental level. It is a commitment that necessarily involves a study of the current situation, marked by a phase of extraordinary transformation. It is from this awareness that sprung the need to reflect on the issues that Rimadesio has always considered as the components of its DNA: architecture, ecology, technology, and style. They are complex words, that are sometimes overused nowadays, that conceal a whole world of meanings. This is why it is important to discuss them. We have thus entrusted Marco Romanelli with the task of organizing a series of meetings with an extraordinary group of contemporary protagonists, not necessarily canonically belonging to the design scene. We talked about Interior Architecture with Beppe Finessi, about Ecology with Marco Belpoliti and Stefano Salis, about Technology with Angelo Cangelosi and Matteo Pirola, about Style with Luca Solca and Michele Lupi. In these booklets, that are intentionally without any picture, you will find, in addition to the summary of each meeting, a study on the issue addressed during the meetings and, above all, a lot of food for thought, many still unresolved questions and, finally, perhaps some suggestions for the future.” Teatro Rimadesio meeting program 2017 25.05 Architecture Beppe Finessi talking with Marco Romanelli

06.07 Ecology Marco Belpoliti talking with Stefano Salis

28.09 Technology Angelo Cangelosi talking with Matteo Pirola

26.10 Style Luca Solca talking with Michele Lupi Credits Concept: Paolo Mojoli Curated by: Marco Romanelli Graphic design: Juma

Press Office – Alam per comunicare Tel +39 023491206 [email protected]

Rimadesio spa via Furlanelli 96 - 20833 Giussano (MB) Italy tel. +39 0362 3171 – fax +39 0362 317317 www.rimadesio.it – [email protected]

http://www.rimadesio.it/

Documents

Architecture - Rimadesio · Adolf Loos nel celebre Ornamento è delitto 2, scritto ... 2 Ornament and Crime: (original title Ornament und Verbrechen) is a short essay, written by