Upload
others
View
6
Download
0
Embed Size (px)
Citation preview
1
Transformation of Solanum lycopersicum
(tomatoes) with a growth regulating protein
apyrase
Michael Wu
Deans Scholars Honor Thesis
The University of Texas at Austin
May 5, 2010
____________________________________________
Greg Clark
Molecular, Cell and Developmental Biology
Co-Supervising Professor
____________________________________________
Stanley Roux
Molecular, Cell and Developmental Biology
Supervising Professor and Honors Advisor
2
Dedication
To my parents, for their continual support these past four years which made this thesis
possible. I couldn’t have done it without the life skills you both taught me.
To my sister, Grace, thanks for always reminding me to reach past what I can achieve.
3
Tables of Content
I. Abstract............................................................................................ 5
II. Background...................................................................................... 6
a. Motivation
b. Rationale
c. Agrobacterium mediated transformation
d. Micro-Tom Tomatoes
III. Materials and Methods................................................................... 10
a. Plant Materials and Growth Conditions
b. Cloning
c. Vectors
d. Transformation of Tomatoes
IV. Results.............................................................................................. 17
a. Sequence
b. Differential expression of SlAPY1 in various tomato tissues
c. Transformed tomatoes overexpressing tomato ectoapyrase, SlAPY1
V. Discussion......................................................................................... 20
VI. Figures.............................................................................................. 25
VII. Supplementary Figures .................................................................. 28
VIII. Appendix ......................................................................................... 34
IX. References ....................................................................................... 37
X. Acknowledgements ......................................................................... 40
4
List of Figures
Fig. Sequence alignment between SlAPY1 and 1a AtAPY1 and 2b AtAPY2.......... 25
Fig. 2 SlAPY1‟s predicted transmembrane domain ................................................. 26
Fig 3 Differential expression profile of SlAPY1 ...................................................... 27
Fig 4 RT-PCR confirmation of SlAPY1 overexpressing lines ................................. 27
Supplementary Fig. SlAPY1 la cDNA sequence, 1b amino acid sequence,
and 1c segment used for RNAi ................................................................................. 28
Supplementary Fig. 2 SlAPY1 band with size 1.3 kb............................................. 29
Supplementary Fig. Predicted transmembrane domain for 3a AtAPY1 and
3b AtAPY2 ............................................................................................................... 29
Supplementary Fig. 4a Internal SlAPY1 primers 4b SlAPY1 primers with
restriction enzyme sites 4c Sequencing primers 4d RNAi primers .......................... 30
Supplementary Fig. Map of 5a pRT100 5b pCAMBIA 2300
5c pB7GWIWG2(I) .................................................................................................. 31
Supplementary Fig. 6 Preliminary tomato root hair experiment ............................ 33
Supplementary Fig. 7 Gus stain confirming presence of control vector in
transformed tomatoes ............................................................................................... 33
5
I. Abstract
In previous studies the role of apyrase in plant growth and development has been
investigated in the model plant, Arabidopsis thaliana. Results obtained in Arabidopsis
have suggested that ectoapyrases regulate plant growth and participate in wound
responses. To apply these findings to an agriculturally relevant plant we transformed
apyrase into tomatoes (Solanum lycopersicum, MicroTom). Our goal is to overexpress
and knockdown this gene in transgenic tomato plants to determine if their function in
tomatoes is similar to those found in Arabidopsis. We first began by constructing vectors
for apyrase to either overexpress the gene through a 35-S promoter in a pCambia 2300
plasmid or knockdown the gene by RNAi. These constructs were used for
Agrobacterium mediated transformation of tomato plants, where kanamycin was used for
plant selection. Thus far we have successfully produced transgenic tomato lines with
Solanum apyrase overexpressed as judged by RT-PCR analysis. These transgenic tomato
lines will be tested for growth phenotypes including increased fruit size.
6
II. Background
Motivation
Ectoapyrases have been characterized as Nucleoside Triphosphate
Diphosphohydrolases (NTPDase) which cleave the γ and β phosphate from adenosine
triphosphate (ATP) and adenosine diphosphate (ADP), respectively (Komoszynski and
Wojtczak, 1996). This catalytic ability has been linked to a role in extracellular ATP
(eATP) signaling in animals and plants.
In plants, in particular Arabidopsis thaliana, eATP signaling is initiated by an
increase in eATP concentration in the extracellular matrix. Growing root hairs release
eATP during polar growth as the tip of the root expands (Kim et al., 2006). In turn
ectoapyrases are essential in regulating this eATP concentration so that during growth
phases, eATP will not build up to inhibitory levels that signal growth inhibition.
Chemical and genetic approaches have been used to demonstrate the growth regulatory
function of apyrases (Wu et al., 2007). For example, ectoapyrase inhibitors have been
found to inhibit pollen tube growth (Wu et al., 2007) and root hair growth (Clark et al.,
ms. in review). It has been theorized that when ectoapyrase inhibitors are applied, the
buildup in eATP concentration is caused by the inactivation of the NTPDase activity of
apyrase. Furthermore, when high concentrations of non-hydrolyzable forms of ATP and
ADP are exogenously applied to root hairs, significant inhibition of growth is seen (Clark
et al., ms. in review).
In addition to chemical suppression of pollen and root hair growth through
inhibitors and ATP/ADP analogs, the knockdown of the expression of AtAPY1 and
7
AtAPY2 (two members of the Arabidopsis apyrase family) resulted in dwarf phenotypes
in transgenic plants due to suppressed root and shoot growth (Wu et al., 2007).
Moreover, overexpression of apyrase in Arabidopsis shows promotion of pollen tube and
hypocotyl growth in early plant development (Wu et al., 2007). Recent studies in the
Roux lab have also indicated the potential role of apyrase in stomata opening and closure
(Clark, Fraley et al., manuscript in preparation).
The growth-regulation function of apyrases has also been studied in a variety of
other plants. The knockdown of apyrase expression in potato results in reduced tuber
size (Riewe et al.,2008). Enhanced apyrase expression in cotton fibers is correlated with
enhanced growth of the fiber (Clark et al., 2010). Finally, in a recent rice genetic screen
of a root hairless mutant, rth1, the disrupted gene causing the phenotype was found to be
apyrase (Yuo et al., 2009). These findings further support the importance apyrase has in
plant growth and development.
Rationale
With increasing evidence of the role ectoapyrases have in regulating vegetative
growth in a variety of plants though extracellular ATP (eATP) signaling, we proposed
that a further investigation into the function of ectoapyrases might reveal a similar role in
controlling fruit growth. To test this we decided to investigate the role of SlAPY1 in
tomatoes.
Due to promising discoveries from genetic studies on the growth regulating
function of ectoapyrases in Arabidopsis, we wished to transform an agriculturally
8
relevant plant, tomato, to overexpress and knockdown SlAPY1, a tomato apyrase similar
in sequence to the Arabidopsis ectoapyrases. We hoped the growth changes observed in
the transformed Arabidopsis from Wu et al. (2007) could be mimicked in transformed
tomatoes; we were especially interested in potential effects on fruit size. Our approach
for the project was to construct two vectors that overexpress and knockdown Solanum
(tomato) apyrase, SlAPY1.
Agrobacterium Transformation
Agrobacterium mediated transformation is commonly used in plant biology labs
to insert new genes into plant cells for integration into the plant‟s genome. This process
was developed based on the natural ability of a soil bacterium, Agrobacterium
tumefaciens, to transfer its own genetic information into a host plant. In nature,
Agrobacterium tumefaciens utilizes this genetic engineering ability to confer genetic
information to form tumors at plant wound sites (crown gall). This natural exchange of
genes was discovered to have laboratory relevance when the original T-DNA containing
the tumor formation genes were removed and replaced with foreign DNA. This new
method for plant transformation has revolutionized plant biology and has been used to
produce transgenic plants ranging from monocots, dicots, conifers, marine algae, and
fungi. (Cambia, 2010; Federal Ministry of Education and Research, 2006)
9
Micro-Tom Tomatoes
This cultivar of tomato was chosen due to its small plant size (grows up to 5-8
inches tall) and short life cycle of which produces mature fruit in 70-90 days after
sowing. Due to these characteristics Meissner et. al.(1997) proposed using Micro-Tom
tomatoes as the model system for testing tomato genetics. This miniature tomato was
originally bred for urban gardens (Scott & Harbaugh, 1989) but due to its small stature it
was ideal for laboratory settings which needed plants to grow at a high density in limited
space. Moreover Micro-Tom tomatoes have been assessed to undergo Agrobacterium
mediated transformation of cotyledons at frequencies of up to 80% and only differ from
standard tomato cultivars by two major genes (Meissner et. al., 1997). The only major
drawback in using Micro-Tom tomatoes is the absence of in vitro regeneration ability
which can be corrected by transferring the high organogenetic competence from the MsK
genotype to Micro-Tom plants (Lima et. al., 2004).
10
III. Materials and Methods
Plant Material and Growth Conditions
Micro-Tom seeds were purchased through Tomato Growers Supply Company
with roughly 30 seeds per packet, #6536. Seeds were first surface sterilized in 50% (v/v)
commercial bleach plus 0.1% Tween-20 for 20 minutes and then rinsed with autoclaved
water five to seven times (outlined from Lima et. al., 2004). The sterilized seeds were
allowed to vernalize in 4°C for at least three days. Prepared seeds were then planted in
325 mL pots filled with sterilized soil. Potted seeds were placed in a growth chamber at
roughly 70°C under 24 hour light, watered daily.
Transgenic tomato lines were obtained from Dr. Jean Gould (Texas A&M
University) after transformation. Received plants were grown in sterile containers under
24 hour light at 70°C until the callus began to exhibit plant like phenotypes (leaves and
roots). Once the plants had a hypocotyl length of roughly 1.5 inches they were
transplanted into 325 mL pots with sterilized soil. Plants were watered daily.
Cloning
Overview
Our approach for the project was to construct two vectors – one that overexpress
and one that knocks down Solanum (tomato) apyrase, SlAPY1. Our cloning strategy was
to first amplify the SlAPY1 gene from a Micro-Tom leaf cDNA library, which we
generated from a Micro-Tom leaf tissue collection after RNA extraction and reverse
11
transcription. The resulting SlAPY1 gene is roughly 1.3 kb (Supplementary Fig. 2) and
was extracted from a DNA gel. The PCR product was next inserted into a vector and
transformed into E. coli. This process was repeated several times – Topo8/pENTR-
D/TOPO vector for sequencing, pRT100 vector for the Cauliflower Mosaic Virus
(CaMV) 35S promoter and polyA tail, pCambia 2300 for tomato transformation, and
pB7GWIWG2(I) for RNAi knockdown. Completed constructs were sent to Dr. Gould‟s
lab at Texas A&M University for transformation into Micro-Tom tomatoes. Transgenic
tomatoes were returned to the Roux lab for screening and further experimentation.
Formation of first strand cDNA library
Eighty to one hundred mg of tissue from Micro-Tom tomatoes were needed for
each library. Collected plant tissues were immediately frozen in liquid nitrogen after
removal and were kept in liquid nitrogen throughout the steps leading up to RNA
extraction. Tissues were broken down by a motorized hand-held pestle to a fine powder
which usually took 15-20 minutes. Once broken down the powdered plant tissue
underwent RNA extraction using a Qiagen RNeasy Plant Minikit. The concentration of
RNA was measured using a Nanodrop and was either immediately stored in -40 °C or
used for first strand cDNA synthesis. Extra care was made throughout the RNA
extraction process to reduce contamination from RNase. For first strand cDNA synthesis
1 μg of RNA was used. A DNase reaction was performed to remove any DNA
contaminants; the Invitrogen DNase protocol was used. Finally the remaining steps of
first strand synthesis were carried out following the Invitrogen Superscript RT III
procedure. The synthesized cDNA was then stored in 4°C for future use.
12
High fidelity PCR
Due to a low error rate, Phusion High-Fidelity DNA polymerase from New
England Biolabs was used. PCR was carried out following the protocol set out in the
NEB Phusion webpage with an annealing temperature of 50°C and an extension time of
45 seconds for amplifying SlAPY1. Primers used for amplifying SlAPY1 for
overexpression and RNAi vectors are outlined in Supplementary Fig. 4b and
Supplementary Fig. 4d, respectively. The PCR product was run on an agarose (1%) gel
electrophoresis with 1X ethidium bromide (EtBr) to visualize the DNA band. The correct
size band was excised from the gel and purified using a Qiagen Qiaex II Gel Extraction
Kit to produce 30 μL of product. The purified PCR product was then stored at 4° C.
Sequencing
Purified PCR products used for cloning were first sequenced to assess fidelity.
To sequence the insert, the product was either first cloned into the Invitrogen pENTR-
D/TOPO vector (RNAi strategy) or the TOPO 8 vector (overexpressor strategy).
Instructions set out in the TOPO vector manuals were used for the TOPO cloning
reactions and the transformation of One Shot TOP10 Chemically Competent E. coli.
Successful insertion into the TOPO vector was assessed by collecting plasmids from
individual colonies with the Qiagen Qiaprep Spin miniPrep Kit. Plasmids were screened
for the insert by performing a restriction enzyme digest with the appropriate restriction
enzyme(s). If the insert was present, the plasmid was sequenced by the ICMB core
facility with M13 forward and reverse primers.
Restriction Enzyme Digestion and Ligation
13
Restriction Enzymes (RE) used, purchased from New England Biolabs, included
ApaI, KpnI, EcoRI, and HindIII. The restriction enzymes were added to a solution
designated by NEB recommendations with the RE at a 5X concentration. The digest
lasted for four hours and then was terminated by subsequent chemical or heat
inactivation. The digested DNA was then run on an agarose (1%) gel electrophoresis
with 1X EtBr to visualize the DNA bands. If the digest was successful the band was
excised and purified by the same means as designated above. Digested DNA fragments,
one digested with Calf Intestinal Alkaline Phosphatase (CIP) and another without CIP,
were ligated together with NEB T4 DNA ligase overnight at 14 °C (roughly 18 hours).
Vectors
pRT100
The pRT100 vector (Supplementary Fig. 5a) was used in the overexpressor
strategy to attach the CaMV 35S promoter and polyA tail to our SlAPY1 gene. The
SlAPY1 gene was first amplified using primers designed to add an ApaI RE cut site on
the 5‟ end and KpnI RE cut site on the 3‟ end (Supplementary Fig. 4b). These RE sites
were added so that SlAPY1 could be directionally cloned into pRT100. Once the gene
was amplified with the appropriate cut sites it was ligated into TOPO8 for sequencing.
When the gene sequence was confirmed to be correct, the TOPO8 SlAPY1 vector was
subjected to a digestion with ApaI and KpnI. Concurrently, a digestion of pRT100 was
carried out with the same restriction enzymes and CIP, which prevented any re-ligation of
the pRT100 vector. Both digests were separated by gel electrophoresis and the SlAPY1
14
(1.3kb) band and the pRT100 (3.34kb) band were excised and purified. The purified
insert (SlAPY1) and the purified pRT100 were then ligated together overnight and then
transformed into E. coli. Colonies were screened until successful constructs of SlAPY1
and pRT100 were found. These constructs were then sent for sequencing using designed
primers for the promoter and terminator regions (Supplementary Fig. 4c).
pCAMBIA 2300
The pCAMBIA 2300 vector (Supplementary Fig. 5b) was chosen because of
previous literature using pCAMBIA vectors in tomato transformations as a minimal
selection vector. Additionally, we chose the 2300 vector due to its kanamycin plant
selection which is easily used for screenings. The pRT100 construct with SlAPY1 was
first digested with Hind III along with the pCAMBIA 2300 vector with CIP added. The
digested fragments were run on a DNA gel from which the SlAPY1 segment (2.0 kb)
band and the pCAMBIA 2300 (8.742 kb) band was excised and purified. The purified
fragments were then ligated together to form our final construct. Successful ligations
were screened for after subsequent transformations of E. coli, plasmid isolations, and
restriction digests. Our final construct of pCAMBIA 2300 with SlAPY1 and associated
promoter/terminator regions was then screened for fidelity one last time with our
sequencing primers (Supplementary Fig. 4c).
pB7GWIWG2(I) (RNAi vector)
This RNAi vector (Supplementary Fig. 5c) was chosen because it had been
successfully used for RNAi transformations of Arabidopsis plants in our lab. Because of
this familiarity we decided to use this RNAi vector for our tomato transformation. A 300
15
bp segment of SlAPY1 (Supplementary Fig. 1c) was amplified with specific primers
(Supplementary Fig. 4d) for ligation into the pENTR-D/TOPO vector. Successful
ligation was screened for by PCR using the M13(+) primer. One of these constructs was
then chosen for sequencing using the forward and reverse M13 primers. Once fidelity
was assessed the construct was then transformed into E. coli so that isolated plasmids
could be collected. These constructs were next used as entry vectors for the LR
recombination with pB7GWIWG2(I) by LR clonase. The recombined constructs were
transformed into E. coli and screened by restriction digestion. Our final RNAi vector
containing a segment of SlAPY1 was again sequenced for fidelity.
Transformation of Tomatoes
Protocol for tomato transformation was obtained from the Gould lab. Procedures
presented were modified from Park, et. al. (2003), and Byce, J. E. (last updated 8/1/06).
Plant Material
We sterilized seeds by immersing them in 10% Clorox plus 1 drop of detergent
for 15 min. (use 90 seeds~380mg) then rinsing them well with sterile Milli-Q water (4 or
more times). We sowed seeds in Petri-dishes containing 1/2 MS (Murashige & Skoog,
1962), approximately 30 seeds/dish, and allowed them to germinate for 7 days. One day
prior to inoculation with Agrobacterium, we cut cotyledons from 6 – 8-day-old seedlings,
placed them on Medium 1 [MS+1mg/L BAP + 0.1mg/L NAA], and cultured them for 1
day in light at room temperature.
Agrobacterium
16
We grew colony(s) of Agrobacterium tumefaciens EHA105 containing Apyrase
overexpression or knockdown constructs, in 5-6 ml liquid LB media containing 100 mg/L
kanamycin, rotated at 200 rpm overnight at 25-26°C. Do not exceed 27°C, because the
Agro transformation process is temperature sensitive. The following day, we centrifuged
the cell suspension, decanted the supernatant, and suspended the pellet in 5-6 ml of
Virulence Induction Medium (VIM). [VIM (glucose 20 g/l + AS 20 mg/L + MES 75 mM
pH 5.4]
Inoculation & Co-cultivation, Selection, and Rooting
We incubated cotyledon explants with Agrobacterium suspended in VIM ~15-20
min. The inoculated explants were then placed on Medium 1 plus 20mg/L
Acetoysyringone (AS) in the dark at 20°C for 3 days. [MS+BAP 1mg/L + NAA 0.1
mg/L + AS 20~60mg/L]. After 3 days, explants were transferred to Media 2 [MS +
Zeatin 2mg/L + IAA 0.1mg/L + Clavamox 250mg/L + kanamycin 100~150mg/L] where
they were cultured at room temperature with a 16-hr photoperiod. Explants were
transferred to fresh Medium 3 with Clavamox and kanamycin every 2-3 weeks. We
observed shoots appearing within 4 - 6 weeks. Shoots were excised from explants when
shoots were about 2 cm tall. They were placed in large culture containers (Kerr or Ball
half-pint canning jars, baby food jars, Magenta Boxes, deli containers, etc.) containing
Rooting Media with a selective agent and antibiotic used to prevent Agrobacterium
growth. [RM+ Selection: MS + Clavamox 250mg/l + Kanamycin 150mg/l].
17
IV. Results
Sequence
Solanum lycopersicum, MicroTom was the tomato cultivar used to determine the
apyrase sequence. No known full cDNA sequence of Solanum lycopersicum apyrase has
been identified. Therefore based on the Arabidopsis apyrase amino acid sequence we
created a putative tomato apyrase cDNA sequence (Supplemental Fig. 1a) from Solanum
lycopersicum expressed sequence tags (EST). When our final sequence underwent a
nucleotide BLAST against tomato EST, we found multiple sequences with alignment
scores above 200. This sequence was amplified from a Micro-Tom leaf cDNA library.
Additionally an amino acid alignment of the Solanum lycopersicum apyrase
sequence (Supplemental Fig. 1b) with Arabidopsis apyrase 1 (AtAPY1) resulted in a 49%
identity and 82% similarity (Fig. 1a). While the amino acid alignment with apyrase 2
(AtAPY2) resulted in a 51% identity and 82% similarity (Fig. 1b). Alignments were
made with the sequence analysis tool, ClustalW2 from the European Bioinformatics
Institute (EBI) website. Due to the tomato apyrase amino acid sequence having roughly
80% similarity to both AtAPY1 and AtAPY2, we believe that it is appropriate to identify
this sequence as Solanum lycopersicum apyrase 1 or SlAPY1. No other putative Solanum
apyrase sequences were identified during our analysis.
Using the amino acid sequence of SlAPY1 to predict transmembrane domains, we
discovered that tomato apyrase SlAPY1 is most likely an ectoapyrase with one membrane
spanning domain. The program used was TMHMM which has an N-best algorithm. The
18
results (Fig. 2) show a roughly 20 amino acid (#7-27) transmembrane helix on the N-
terminus. This region is speculated to be a transmembrane domain but could also be a
signal peptide sequence. Concurrently when AtAPY1 and AtAPY2 are analyzed with the
TMHMM program both resulted in one transmembrane domain (Supplementary Fig. 3a
and Fig. 3b respectively). Interestingly, AtAPY1 also has the transmembrane domain in
the first 60 amino acids of the N-terminus.
Differential expression of SlAPY1 in various tomato tissues
First strand cDNA libraries were made from a variety of tissues from the wild-
type Micro-Tom tomato. The following tissues were collected: red fruit (mature), red
fruit skin, green fruit (immature), flower, and young leaves. Internal SlAPY1 primers
(Supplementary Fig. 4a) were used to assess the relative concentration of SlAPY1 mRNA
in the various tissues. RT-PCR was performed with NEB Quick-Load Taq 2X master
mix with an annealing temperature of 52 °C. The number of cycles (30) was adjusted so
that visible differences between band intensity were seen. Our results indicate that
SlAPY1 expression is the highest in young leaves, then expressed less in the green fruit,
and expressed the least in the flower (Fig. 4). Expression in red fruit and the skin of the
red fruit was not seen after 30 cycles. However the results of our experiment are
inconclusive. The RNA isolation of certain samples (red fruit and red fruit skin) did not
yield sufficient RNA concentrations needed to make uniform cDNA libraries, thus a
loading control needs to be run to confirm results.
19
Transformed tomatoes overexpressing a tomato ectoapyrase, SlAPY1
Potential transgenic plants were sent to the Roux lab for screening after
Agrobacterium mediated transformation of Micro Tom tomatoes with the SlAPY1
overexpressor vector and pCNL56 control vector. Plants were received in sterile
containers with callus growth. Due to this vulnerable stage of plant growth, transgenic
plants were allowed to grow for an additional 1 ½ months. Once plants had normal
phenotypes they were transplanted into soil. During this time, we had five healthy
transgenic plants potentially overexpressing SlAPY1, and over 10 transgenic plants with
the control vector (confirmed by a GUS stain). Two weeks after transplantation, young
leaves were collected for first strand cDNA synthesis. Internal SlAPY1 primers
(Supplementary Fig. 4a) were used for RT-PCR. Extra care was taken to make sure the
same amount of RNA was used to create each cDNA library. The resulting PCR revealed
two lines (21 2(1) and 21 (1)) that are highly likely overexpressing SlAPY1 (Fig. 3). A
loading control is needed to confirm these results. These two lines are the F1 generation,
thus they have not been further analyzed for phenotypic differences. Currently seeds are
being collected so that other observations can be made with the F2 generation.
20
V. Discussion
Due to the high percent similarity between SlAPY1 and AtAPY1 and AtAPY2, we
believe the functions of these proteins could be related. Additionally the prediction of a
transmembrane helix (TMH) in SlAPY1 is further indication that SlAPY1 is similar to the
ectoapyrases AtAPY1 and AtAPY2 which both have one TMH. However the location of
SlAPY1‟s TMH is in the first 60 amino acids of the protein, which could imply this
region is instead a signal peptide. Nevertheless, we still believe SlAPY1 is likely an
ectoapyrase due to the fact that AtAPY1, a confirmed ectoapyrase whose percent
similarity with SlAPY1 is 82 %, also has its TMH in the N terminal region of the protein.
With the likely chance that SlAPY1 is related to Arabidopsis (At) APY1 and
APY2, the growth regulatory ability of these Arabidopsis ectoapyrases could be a
possible function of SlAPY1. Thus to further elucidate the function of Arabidopsis
ectoapyrase we decided to perform a few experiments that chemically inhibit root hair
growth. To do this we first used a known apyrase inhibitor NGXT191 to see if
Arabidopsis root hair growth could be inhibited. Using data provided by Windsor, B
(2000) PhD dissertation, The University of Texas at Austin, we already knew that
NGXT191 has no inhibitory effect on acid phosphatase. But instead has almost equal
inhibitory activity for apyrase and alkaline phosphatase. Thus to ensure that alkaline
phosphatase is not the enzyme regulating eATP concentrations we performed a control
experiment where 500 μM levamisole (a known alkaline phosphatase inhibitor) was
applied to root hairs. Our results indicated that when levamisole was applied, root hair
21
growth did not change, however when an apyrase inhibitor (NGXT191) was applied,
inhibition of root hair growth was observed (data provided in the appendix). Thus we
believe apyrase is the key enzyme in limiting eATP concentrations to below inhibitory
levels. These inhibitory levels can be artificially created to observe root hair inhibition
by application of ATPγS, a poorly-hydrolysable form of ATP. This form of ATP was
chosen because of its relative resistance to hydrolysis by ATPases, thus eliminating or
greatly reducing the likelihood that it could be used as an energy source or as a source of
a phosphate group during phosphorylation. From our results we consistently saw
inhibition of root hair growth when 125 μM ATPγS or more was applied to root hairs
(data provided in the appendix). These two experiments further indicate Arabidopsis
ectoapyrases‟ role in growth regulation through control of eATP concentrations.
A preliminary experiment of applying 150 μM ATPγS to tomato root hairs using
the same method as the Arabidopsis root hair experiments (see Appendix) resulted in a
significant inhibition of tomato root hair growth in one hour (Supplementary Fig. 6).
Only one trial was performed due to the constraints of measuring tomato root hairs which
are extremely short and densely packed. However this preliminary experiment revealed
to us the high possibility that SlAPY1 and AtAPY1 and AtAPY2 have the same function
of regulating eATP concentrations as a proxy to controlling growth.
In addition to uncovering the probable function of SlAPY1 we were also
interested in the expression profile of SlAPY1 in wild-type Micro-Tom tomatoes. The
tissues we collected included young leaves, flowers, green (immature) fruit tissue, red
(mature) fruit tissue, and red fruit skin. We were unable to collect green fruit skin due to
22
the attachment the skin had to the fruit, making it almost impossible to cleanly remove a
large portion of the skin. From our results we found SlAPY1 to be highly expressed in
young leaves. More surprisingly was the expression of SlAPY1 in the green fruit but not
in the red fruit of tomatoes. This finding is promising since it shows that this tomato
apyrase is expressed during early stages of fruit development where the most growth
occurs. Additionally, when growth stops and fruit ripening begins, apyrase expression
disappears. These findings still need to be verified with an appropriate loading control.
However, if our results are correct our assumption that overexpressing SlAPY1 will
affect fruit growth is strengthened due to the localization of SlAPY1 expression in green
fruit.
Once the sequence for SlAPY1 was established, we began to clone this gene to be
constitutively expressed by a CaMV 35S promoter. During this process we revised the
cloning strategy three times until a successful construct was produced. The overview of
the final strategy is outlined in the materials and methods section. However to
summarize the lessons I learned during my thesis it will be helpful to run through the
various permutations my strategy had. My first strategy failed due to my oversight of an
ATG start codon present in the restriction site I added to the SlAPY1 sequence. This
mistake was not discovered until after I had cloned this insert into pRT100 and had
sequenced the construct. Due to my oversight I carefully re-analyzed my strategy and
decided to choose two different restriction sites with compatible restriction digest
conditions. Unfortunately one of these RE sites created blunt ends after digest. I soon
discovered how tenuous blunt end ligation could be and after several failed attempts I
23
returned to my strategy for revision. This time I had only one more option left due to the
limited RE sites present in pRT100. My final strategy was to mix and match my previous
strategies and use the C terminal RE site I had in my first strategy and the N terminal RE
site I had in my second strategy, both producing sticky ends. The only problem I had was
that these REs did not have compatible digest conditions. Thus I had to be extremely
careful in keeping my yields high even after a serial digestion. In addition to this major
revision I also decided to first clone my SlAPY1 sequence into a TOPO vector so that I
could assess fidelity before I continued any further in my project. With these changes I
was soon able to successfully clone SlAPY1 into pRT100 and then clone SlAPY1 with its
appropriate promoter and terminator regions into pCAMBIA 2300 for transformation.
Due to my previous errors in cloning I made sure I did not repeat any mistakes when
designing my RNAi strategy. Because of these lessons learned, I quickly and
successfully cloned a portion of the SlAPY1 sequence into the RNAi vector.
Once these constructs were made we sent them to the Gould lab at Texas A&M
University to be transformed into Micro-Tom tomatoes. Once the transformation process
was completed we received several plants that contained the control vector, pCNL56,
confirmed by a GUS stain (example in Supplementary Fig. 7). Additionally we received
potential transgenic tomato plants that overexpress SlAPY1. Through RT-PCR screens
we believe that two of the seven lines are overexpressing SlAPY1 when compared to
transgenic tomato plants with the control vector. Unfortunately due to the extensive time
spent cloning two vectors and the relatively long generation time of Micro-Tom
tomatoes, we were unable to perform any further experiments. Ideally we would have
24
liked to run a loading control for our RT-PCR screen with either tomato actin or ubiquitn
primers. Even more helpful would have been a western blot to analyze the protein
concentrations of the various lines. This experiment would be problematic due to no
known antibody for SlAPY1. However we were hoping to use AtAPY1 or AtAPY2
antibodies for a western blot hoping that the high percent similarity between these
proteins would result in AtAPY1 and AtAPY2 antibody recognition for SlAPY1.
If these lines are indeed overexpressing SlAPY1 we would be most interested in
observing the phenotype of these transgenic plants. Apyrase expression has been found
to be localized in tomato skin and in guard cells. If SlAPY1 is overexpressed in these
tissues we would expect to see some type of phenotype change, whether it is increased
fruit size or even increased stomata opening. These potential changes could have a huge
impact on our understanding of the role SlAPY1 has in fruit growth and even in drought
resistance.
25
Figures
(A.)
SlAPY1 ----------------MQKHN-----ISNVYNLFNIMLLILVGLPLSSHANDYSEK---- 35
AtAPY1 MTAKRAIGRHESLADKVHRHRGLLLVISIPIVLIALVLLLMPGTSTSVSVIEYTMKNHEG 60
:::*. ** *: ::**:: * . * . :*: *
SlAPY1 --------KYAVIFDAGSTGSRVHVFRFNSNLDLINIGNDLELFLQIKPGLSSYADDPKA 87
AtAPY1 GSNSRGPKNYAVIFDAGSSGSRVHVYCFDQNLDLVPLENELELFLQLKPGLSAYPNDPRQ 120
:*********:******: *:.****: : *:******:*****:*.:**:
SlAPY1 AANSLKPLLEKAEAVIPKNLQSQTPIKVGATAGLRLLKGDSSEKILQAVRDMLKNETTLS 147
AtAPY1 SANSLVTLLDKAEASVPRELRPKTPVRVGATAGLRALGHQASENILQAVRELLKGRSRLK 180
:**** .**:**** :*::*:.:**::******** * ::**:******::**..: *.
SlAPY1 YKDEWVSVLEGTLEGSYFWVSLNYLYGNLGKNYPDTIATIDLGGGSVQIAYAVSKQSAIN 207
AtAPY1 TEANAVTVLDGTQEGSYQWVTINYLLRTLGKPYSDTVGVVDLGGGSVQMAYAIPEEDAAT 240
: : *:**:** **** **::*** .*** *.**:..:********:***:.::.* .
SlAPY1 APKLPNG-DAYVQQKALLGTNYYLYVHSFLNYGLLAARADILKASKNYTSPCIVEGHNGT 266
AtAPY1 APKPVEGEDSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSNNPCIATGYAGT 300
*** :* *:**:: * * :*:*****:*:********:***.*:: ..***. *: **
SlAPY1 YTYNGVSYKAASRKQGPNIRRCKAIIRKLLQID-APCNHKNCSFAGIWNGGGGAGTKNLY 325
AtAPY1 YKYGGKAFKAAASPSGASLDECRRVAINALKVNNSLCTHMKCTFGGVWNGGGGGGQKKMF 360
*.*.* ::***: .*..: .*: : : *::: : *.* :*:*.*:******.* *:::
SlAPY1 ISSFFYDYASTVGIVDPKEAYGITQPIQYYKAATLACKTKKQNMKSVFPNINDKDIPFIC 385
AtAPY1 VASFFFDRAAEAGFVDPNQPVAEVRPLDFEKAANKACNMRMEEGKSKFPRVEEDNLPYLC 420
::***:* *: .*:***::. . .:*::: ***. **: : :: ** **.:::.::*::*
SlAPY1 MDLLYEYTLLVNGFGIDPIRKITVVHQVNYKNHLVEAAWPLGSAIDAVSSTTSENMISYV 445
AtAPY1 LDLVYQYTLLVDGFGLKPSQTITLVKKVKYGDYAVEAAWPLGSAIEAVSSP--------- 471
:**:*:*****:***:.* :.**:*::*:* :: ***********:****.
SlAPY1 GRISY 450
AtAPY1 -----
(B.) SlAPY1 ------------------------------------------------------------
AtAPY2 MLNIVGSYPSPAIVTHNVFCLHPSLSHTKFRSEAHTSFGFQIKSGDSSRFPKFTVDLEPL 60
SlAPY1 ------------------------------------------------------------
AtAPY2 QDPPQTTASSGTGNGNGKIRYRSPSSTELLESGNHSPTSDSVDGGKMTAKRGIGRHESLA 120
SlAPY1 --MQKHN-----ISNVYNLFNIMLLILVGLPLS-SHANDYSE------------KKYAVI 40
AtAPY2 DKIQRHRGIILVISVPIVLIGLVLLLMPGRSISDSVVEEYSVHNRKGGPNSRGPKNYAVI 180
:*:*. ** *:.::**:: * .:* * .::** *:****
SlAPY1 FDAGSTGSRVHVFRFNSNLDLINIGNDLELFLQ--------------------------- 73
AtAPY2 FDAGSSGSRVHVYCFDQNLDLIPLGNELELFLQSLVKKLASPNGSNRANMTLFDHGNISC 240
*****:******: *:.***** :**:******
SlAPY1 -------------------------IKPGLSSYADDPKAAANSLKPLLEKAEAVIPKNLQ 108
AtAPY2 PEVKLNRINGKLRTLLSMYIIDLCSLKPGLSAYPTDPRQAANSLVSLLDKAEASVPRELR 300
:*****:*. **: ***** .**:**** :*::*:
SlAPY1 SQTPIKVGATAGLRLLKGDSSEKILQAVRDMLKNETTLSYKDEWVSVLEGTLEGSYFWVS 168
26
AtAPY2 PKTHVRVGATAGLRTLGHDASENILQAVRELLRDRSMLKTEANAVTVLDGTQEGSYQWVT 360
.:* ::******** * *:**:******::*::.: *. : : *:**:** **** **:
SlAPY1 LNYLYGNLGKNYPDTIATIDLGGGSVQIAYAVSKQSAINAPKLPNG-DAYVQQKALLGTN 227
AtAPY2 INYLLRNLGKPYSDTVGVVDLGGGSVQMAYAISEEDAASAPKPLEGEDSYVREMYLKGRK 420
:*** **** *.**:..:********:***:*::.* .*** :* *:**:: * * :
SlAPY1 YYLYVHSFLNYGLLAARADILKASKNYTSPCIVEGHNGTYTYNGVSYKAASRKQGPNIRR 287
AtAPY2 YFLYVHSYLHYGLLAARAEILKVSEDSENPCIVAGYDGMYKYGGKEFKAPASQSGASLDE 480
*:*****:*:********:***.*:: .**** *::* *.*.* .:**.: :.*..: .
SlAPY1 CKAIIRKLLQI-DAPCNHKNCSFAGIWNGGGGAGTKNLYISSFFYDYASTVGIVDPKEAY 346
AtAPY2 CRRITINALKVNDTLCTHMKCTFGGVWNGGRGGGQKNMFVASFFFDRAAEAGFVDPKQPV 540
*: * : *:: *: *.* :*:*.*:**** *.* **::::***:* *: .*:****:.
SlAPY1 GITQPIQYYKAATLACKTKKQNMKSVFPNINDKDIPFICMDLLYEYTLLVNGFGIDPIRK 406
AtAPY2 ATVRPMDFEKAAKKACSMKLEEGKSTFPLVEEENLPYLCMDLVYQYTLLIDGFGLEPSQT 600
. .:*::: ***. **. * :: **.** ::::::*::****:*:****::***::* :.
SlAPY1 ITVVHQVNYKNHLVEAAWPLGSAIDAVSSTTSENMISYVGRISY 450
AtAPY2 ITLVKKVKYGDQAVEAAWPLGSAIEAVSSP-------------- 630
**:*::*:* :: ***********:****.
Fig. 1 Sequence alignment of the amino acid sequence of SlAPY1 with a. AtAPY1‟s
amino acid sequence and with b. AtAPY2‟s amino acid sequence.
Fig. 2 Predicted transmembrane domain helix (roughly 20 amino acids) using the
TMHMM program. The transmembrane domain is located in the N terminal end of the
SlAPY1 protein.
27
Fig. 3 RT-PCR of the differential expression of SlAPY1 in red fruit, red fruit skin,
flower, green fruit, and young leaves.
Fig. 4 RT-PCR confirmation of SlAPY1 overexpressing lines.
1.636 kb
1.018 kb
Line 21
2(1)
Line 21
2(3)
Line 20
1(1)
Control 2 Line 21
(1)
Line 18
(2) Control 1
Red Fruit Red Fruit Skin Flower Green Fruit Young leaves 1.636 kb
1.018 kb
28
Supplemental Figures
Supplemental Fig. 1
a.) Solanum apyrase cDNA sequence
ATGCAGAAGCATAATATTAGTAATGTTTATAACTTGTTCAACATTATGTTGTTGATACT
TGTTGGGTTGCCATTGAGCTCGCATGCCAATGATTATTCGGAGAAAAAATATGCAGTGA
TATTTGACGCTGGAAGCACTGGTAGCAGAGTTCATGTCTTTCGTTTTAACTCAAATTTG
GATCTCATCAATATCGGCAATGATCTTGAACTCTTCTTGCAGATAAAACCAGGTCTGAG
TTCATATGCAGATGATCCAAAGGCAGCTGCAAATTCTCTAAAGCCCCTTCTTGAGAAAG
CTGAAGCTGTTATTCCTAAGAATTTACAGTCTCAAACCCCTATTAAAGTTGGGGCAACT
GCAGGGCTGAGGTTATTAAAGGGTGATTCATCTGAAAAGATTCTGCAAGCAGTAAGAGA
TATGCTGAAAAATGAAACTACTCTGAGTTACAAGGATGAATGGGTCTCTGTTCTCGAAG
GAACTCTAGAAGGTTCTTATTTTTGGGTAAGTTTGAACTATTTGTATGGGAATTTGGGC
AAAAATTACCCAGACACCATTGCTACAATTGATCTTGGAGGTGGATCAGTTCAAATTGC
TTATGCTGTCTCAAAACAAAGTGCTATAAATGCTCCAAAGTTACCAAATGGAGACGCTT
ATGTCCAACAAAAAGCACTTCTTGGAACTAATTATTACCTCTATGTTCACAGTTTTCTA
AATTATGGACTATTAGCAGCTCGAGCTGATATCTTGAAGGCTTCTAAAAATTACACTAG
TCCATGCATCGTGGAAGGGCACAATGGTACTTACACATATAATGGAGTATCTTATAAAG
CTGCATCACGAAAACAAGGTCCAAATATCAGAAGATGTAAAGCAATAATTAGAAAATTG
CTTCAGATTGATGCACCTTGCAATCACAAAAATTGTTCATTTGCTGGGATTTGGAATGG
TGGTGGTGGAGCTGGAACCAAAAATCTCTATATCTCTTCATTTTTCTATGATTATGCTT
CTACAGTTGGTATAGTGGATCCAAAAGAGGCCTATGGTATAACTCAGCCAATACAATAC
TATAAAGCAGCGACGCTGGCTTGTAAGACTAAGAAGCAAAACATGAAATCGGTATTCCC
TAACATTAACGATAAGGACATACCCTTTATCTGCATGGATTTATTATATGAATACACTT
TGCTGGTAAATGGATTTGGTATTGATCCAATAAGAAAGATTACAGTGGTGCATCAAGTT
AATTACAAAAATCACCTTGTTGAAGCTGCATGGCCATTAGGCTCTGCTATTGATGCTGT
CTCATCCACAACATCAGAAAATATGATTTCATATGTTGGGAGGATAAGTTATTAG
b.) Solanum apyrase amino acid sequence
MQKHNISNVYNLFNIMLLILVGLPLSSHANDYSEKKYAVIFDAGSTGSRVHVFRFNSNL
DLINIGNDLELFLQIKPGLSSYADDPKAAANSLKPLLEKAEAVIPKNLQSQTPIKVGAT
AGLRLLKGDSSEKILQAVRDMLKNETTLSYKDEWVSVLEGTLEGSYFWVSLNYLYGNLG
KNYPDTIATIDLGGGSVQIAYAVSKQSAINAPKLPNGDAYVQQKALLGTNYYLYVHSFL
NYGLLAARADILKASKNYTSPCIVEGHNGTYTYNGVSYKAASRKQGPNIRRCKAIIRKL
LQIDAPCNHKNCSFAGIWNGGGGAGTKNLYISSFFYDYASTVGIVDPKEAYGITQPIQY
YKAATLACKTKKQNMKSVFPNINDKDIPFICMDLLYEYTLLVNGFGIDPIRKITVVHQV
NYKNHLVEAAWPLGSAIDAVSSTTSENMISYVGRISY
29
c.) Segment of SlAPY1 used for the sense and antisense portion for RNAi
AAAGTTGGGGCAACTGCAGGGCTGAGGTTATTAAAGGGTGATTCATCTGAAAAGATTCT
GCAAGCAGTAAGAGATATGCTGAAAAATGAAACTACTCTGAGTTACAAGGATGAATGGG
TCTCTGTTCTCGAAGGAACTCTAGAAGGTTCTTATTTTTGGGTTGCTTTGAACTATTTG
TATGGGAATTTGGGCAAAAATTACCCAGACACCATTGCTACAATTGATCTTGGAGGTGG
ATCAGTTCAAATTGCTTATGCTGTCTCAAAACAAAGTGCTATAAATGCTCCAAAGTTAC
CAAAT
Supplementary Fig. 2
DNA gel of amplified SlAPY1 from Micro-Tom leaf cDNA, size – 1.3 kb
Supplementary Fig. 3
a.) Predicted TMH for AtAPY1
1.636 kb
1.018 kb
30
b.) Predicted TMH for AtAPY2
Supplementary Fig. 4
a.) Internal SlAPY1 primers
Forward 5‟ – AAAAAATATGCAGTGATATTTGAC
Reverse 3‟ – GGATGAGACAGCATCAATAGCAGA
b.) SIAPY1 primers with specified restriction enzyme cut site
Forward 5‟ – GCCGGGGCCCATGCAGAAGCATAATATTAGTAAT (with ApaI site)
Reverse 3‟ – CTAGGGTACCCTAATAACTTATCCTCCCAACATA (with KpnI site)
c.) Sequencing primers using 35S promoter and terminator regions
Forward 5‟ – ATGCCTCTACCGACAGTGGTC
Reverse 3‟ – ATTTGTAGAGAGAGACTGGTGAT
d.) RNAi primers
Forward 5‟ – CACCAAAGTTGGGGCAACTGCAGG
Reverse 3‟ – ATTTGGTAACTTTGGAGCATTTAT
31
Supplementary Fig. 5
a.) pRT100 vector
b.) pCAMBIA 2300 vector
32
c.) pB7GWIWG2(I) vector
33
Supplementary Fig. 6 Tomato root hair experiment with application of high ATPγS
Supplementary Fig. 7
Gus staining confirming the presence of the
control vector, pCNL56, in transformed
tomatoes. Work done by the Gould lab at
Texas A&M University.
0
0.1
0.2
0.3
0.4
0.5
0.6
0.7
first hour two hours second hour
Aveara
ge
Gro
wth
Rate
(u
m/m
in)
Time
Control
150 ATPYS
A
B
A1
A1
A2A2
34
X. Appendix:
Arabidopsis material and growth conditions
Arabidopsis thaliana ecotypes Columbia were used as the wild type in our study. Seeds
were first surface sterilized in 20% (v/v) bleach for 10 minutes and then rinsed with
autoclaved water five to seven times. The sterilized seeds were allowed to vernalize in
4°C for at least three days. Prepared seeds were next planted directly on a cellophane
membrane placed upon solidified Murashige and Skoog (MS) medium (4.3g/L MS salts
(Sigma), 0.5 % (w/v) MES, 1% (w/v) sucrose, and 1.0% (w/v) agar, raised to pH 5.7 with
1 M KOH). Planted plates were placed upright in a culture chamber and grown at 23 C
under 24-h fluorescent light for 3 ½ days.
Root Hair Experiments
Seeds used for microscopic analysis were grown in the same environmental
conditions on cellophane and MS agar plates. After 3 ½ days of growth, plates were
prepared for transfer. Experimental plates were made the day of the experiment with the
same agar composition used for planting. Each experimental plate had a designated
chemical concentration that was added to the agar before solidification. Transfers of the
seedlings were performed by lifting the cellophane membrane with tweezers from the
original plate to the solidified experimental plates. Air bubbles were removed with
tweezers by gently guiding the bubbles to the edge of the cellophane. Pictures of root
tips were taken immediately after transfer using Motic Images Plus 2.0 under 40X
35
magnification at time 0 and time 60. Analysis of the root hair growth for the hour period
was performed using ImageJ. Root hairs at time 0 with lengths greater than 150 µm were
not used.
ATPγS and levamisole stocks were made in purified H2O while the NGXT 191
stock was dissolved in DMSO. Stocks made of DMSO were made so that when added to
the MS agar plates they had a final concentration of 0.1% DMSO. Additionally when
chemicals were made with DMSO, the control plates were made with the same final
concentration of 0.1% DMSO that was in the treatment plate.
Chemical approaches to inhibit root hair growth
Portions of the Clark et. al., in review manuscript relate apyrase function to
extracellular ATP signaling. In theory ectoapyrases are present in the plasma membrane
of the plant cell to regulate eATP concentrations. Ectoapyrase AtApy1 and AtApy2 have
been found to be expressed in Arabidopsis root hairs (Wolf et. al., 2007). Therefore
when 2.5 μM apyrase inhibitors are applied exogenously to root hairs, a significant
decrease in root hair growth rate is observed (Fig. Appendix 1a). Additionally the
application of roughly 125– 150 μM ATPγS, a non-hydrolyzable form of ATP, can cause
significant decreases in root hair growth after one hour (Fig. Appendix 1b).
36
(A.)
(B.)
Appendix Fig. 1 Chemical inhibition of root hair growth caused by a. NGXT191 an
apyrase inhibitor and b. exogenous ATPγS. Different letters above the bars indicate
significant differences between treatments (p < 0.05; n ≥ 30). These results represent
three biological repeats.
0
0.5
1
1.5
2
Control 500 μM Levamisole Control (DMSO) 2.5 μg/mL NGXT 191
Ave
rage
Gro
wth
Rat
e
(μm
/min
)
A
BA
A
37
References
Cambia. Agrobacterium-mediated transformation. Retrieved April, 19, 2010, from Patent
Lens website: http://www.patentlens.net/daisy/AgroTran/835.html.
Clark, G., Fraley, D., manuscript in progress.
Clark, G., Torres, J., Finlayson, S., Guan, X., Handley, C., Lee, J., Kays, J.E., Chen, J., &
Roux, S.J. (2010). Apyrase (nucleoside triphosphate-diphosphohydrolase) and
extracellular nucleotides regulate cotton fiber elongation in cultured ovules. Plant
Physiol.152, 1073-1083.
Clark, G., Wu, M., Wat, N., Onyirimba, J., Pham, T., Herz, N., Ogoti, J., Gomez, D.,
Canales, A., Aranda, G., Blizard, M., Nyberg, T., Terry, A., Torres, J., Wu, J., &
Roux, S.J. (2010). Genetic evidence for the roles of nitric oxide and reactive
oxygen species in regulating both the stimulation and inhibition of root hair
growth induced by extracellular nucleotides in Arabidopsis. Plant Mol. Biol. In
review.
Federal Ministry of Education and Research. (May 10, 2006). Using a soil bacterium as a
gene transporter. Retrieved April 19, 2010, from GMO safety website:
http://www.gmo-safety.eu/en/gene_transfer/new_methods/35.docu.html.
Komoszynski, M., & Wojtczak, A. (1996). Apyrases (ATP diphosphohydrolases, EC
3.6.1.5): function and relationship to ATPases. Biochem Biophys Acta. 1310, 233-
241.
Kim, S.Y., Sivaguru, M., & Stacey, G. (2006). Extracellular ATP in plants: visualization,
38
localization, and analysis of physiological significance in growth and signaling.
Plant Physiol. 142, 984–99.
Lima, J.E., Carvalho, R. F., Neto, A.T., Figueira, A., & Peres, L. E. P. (2004). Micro-
MsK: a tomato genotype with miniature size, short life cycle, and improved in
vitro shoot regeneration. Plant Sci. 167, 753-757.
Meissner R., Jacobson, Y., Melamed, S., Levyatuv, S., Shalev, G., Ashri, A., Elkind, Y.,
& Levy, A. (1997). A new model system for tomato genetics. Plant J. 12, 1465–
1472.
Park, S.H., Morris, J.L., Park, J.E., Hirschi, K.D., & Smith, R.H. (2003). Efficient and
genotype-independent Agrobacterium-mediated tomato transformation. J. Plant
Physiol. 160, 1253–1257.
Riewe, D., Grosman, L., Fernie, A.R., Wucke, C., & Geigenberger, P. (2008). The
potato-specific apyrase is apoplastically localized and has influence on gene
expression, growth, and development. Plant Physiol. 147, 1092-1109.
Scott, J.W., & Harbaugh, B.K. (1989).Micro-Tom––A Miniature Dwarf Tomato, Circular
S-370, Florida Agricultural Experiment Station. pp.1–6.
Windsor, B. (2000). Establishing a role for ecto-phosphatase in drug resistance. Ph.D.
dissertation, The University of Texas at Austin.
Windsor, J.B., Thomas, C., Hurley, L., Roux, S.J., & Lloyd, A.M. (2002). Automated
colorimetric screen for apyrase inhibitors. Biotechniques. 33, 1024–1030.
Wolf, C., Hennig, M., Romanovicz, D., & Steinebrunner, I. (2007). Developmental
39
defects and seedling lethality in apyrase AtAPY1 and AtAPY2 double knockout
mutants. Plant Mol. Biol. 64, 657-672.
Wu, J., Steinebrunner, I., Sun, Y., Butterfield, T., Torres, J., Arnold, D., Gonzalez, A.,
Jacob, F., Reichler, S., & Roux, S.J. (2007). Apyrases (Nucleoside Triphosphate-
Diphosphohydrolases) Play a Key Role in Growth Control in Arabidopsis. Plant
Physiol. 144,961-975.
You, T., Toyota, M., Ichii, M., & Taketa, S. (2009). Molecular cloning of a root hairless
gene rth1 in rice. Breeding Sci. 59, 13-20.
40
X. Acknowledgements
As most of you know the Roux lab is my unofficial second home, I often feel like
I spend more time in the basement of the BIO building than at my own small one
bedroom efficiency. But because of my frequent visits to the lab I have had the
opportunity to work on two projects, mentor three amazing generations of FRI students,
and build and develop great friendships. Because of these reasons saying “bye, bye, bye”
is that much harder („N sync‟s Bye Bye Bye, 2000).
I would like to first thank Dr. Roux for sparking my interest in plant biology and
research in general. His enthusiasm for research is unsurpassable and can only be
compared to a love a fat kid has for cake (50 cent‟s “21 Questions”, 2003). It has been
my privilege to not only work in Dr. Roux‟s lab but also sit in his classroom. Because of
his class, I now have a new found appreciation and love for the plant world.
I would also like to thank Dr. Clark for four years of collaboration and
encouragement. If it wasn‟t for him I would have graduated college without any research
experience. But because of Dr. Clark‟s guidance and endless opportunities for free food I
have “made it through the wilderness” of college and research (Madonna‟s Like a Virgin,
1990).
To all my other lab mates, Araceli Cantero, Sonya Chiu, Devin Fraley, Elizabeth
Henaff, Julia Kays, Stuart Reichler, Jim Tseng, Jian Wu, and Jian Yang, thank you for
answering the multitude of questions I always seem to have. I would like to personally
thank Elizabeth Henaff and Jian Wu for being incredibly helpful TA‟s during my FRI
years and continuing their goodwill even after I completed the program. Sonya and Jim,
41
thanks for being such supportive friends and colleagues, I will definitely miss eating
lunch with you two. To Devin, our conversations have certainly been epic, but in the end
I value your opinions not only as a grad student but as a friend. Stuart and Araceli,
thanks for having such an amazing child like Raquel. Added to their baby making
ability, I have enjoyed getting to know the both of them more this semester; I hope
“Mikey” will always have a spot on future bike tours of Austin.
My experiences in the Roux lab would not have been the same without my fellow
FRI graduates. Our antics filled the halls with laughter and joy. To the original FRI
group – Arinda Canales, Delmy Gomez, and James Onyirimba , to the FRIlets – Daria
McKelvey, Justin Ogoti, Philip Onyirimiba, and Trieu Pham, to the micro-FRIs – Alex
Chung, Vibhuti Rana, and Chris Ramirez, and to the multitude of adopted “FRI”
undergraduate students, remember “you‟ve got a friend in me” (Randy Newman‟s
You‟ve got a friend in me, 1996).
To my dear lab partner and friend, Noel Wat, thanks for not “being afraid of
letting your true colors shine” these last few months (Cyndi Lauper‟s True colors, 1986),
our friendship has grown exponentially since. I have had the pleasure of working
alongside Noel for four years experiencing the rollercoaster ride research can be. From
the highs – getting our own bench and pipettes, to the lows – troubleshooting our
construct strategies, I couldn‟t think of anyone else I would have shared this experience
with. Wherever life takes you I hope our friendship and signature Wu/Wat flare will
never fade away.
42
I would like to say once again, “Thanks for the memories, thanks for the
memories”, from spontaneous snowman building, to Trudy lab lunches, to Dripping
Spring‟s barbeque potluck, to the FRI summer of 2007 and 2009, to FRI dinners/karaoke,
to the coffee or cocktail table debate, or to simply lunch time banter (Fall out boy‟s
Thnks fr th mmrs, 2007). “In my life”, I will never forget my time in the Roux lab. Even
if “these memories lose their meaning, I‟ll never lose affection” for the people that made
this experience possible (Beatle‟s In my life, 1965). Thank you, Roux lab.