Upload
others
View
1
Download
0
Embed Size (px)
Citation preview
Navy News Service for Wednesday February 15 2012
httpcontentgovdeliverycombulletinsgdUSNAVYDMA-2f01f4[20120216 113409]
Navy News Service for Wednesday February 152012US Navy sent this bulletin at 02152012 0346 PM ESTYou are subscribed to Navy News for US Navy This information has recently been updatedand is now available
Navy News Service for Wednesday February 15 2012
NNS120215-07 Navy Names Five New Ships-- httpwwwnavymilsearchdisplayaspstory_id=65361
NNS120214-20 USNS Comfort to Move to Naval Station Norfolk-- httpwwwnavymilsearchdisplayaspstory_id=65347
NNS120215-10 Navy Marine Corps Publish Naval Aviation Vision January 2012-- httpwwwnavymilsearchdisplayaspstory_id=65360
AHU -- Headlines for Wednesday February 15 2012 Continuation Board Results Released onBUPERS Online HSV Swift 2 Participates in Project Handclasp-- httpwwwnavymilswfmmummplyraspid=16823
NNS120214-18 NAVSUP GLS Supports Shipmates to Workmates Program-- httpwwwnavymilsearchdisplayaspstory_id=65329
NNS120215-06 USS Mason Upgraded with New Chemical Agent Detection Capability -- httpwwwnavymilsearchdisplayaspstory_id=65356
NNS120215-01 Africa Partnership Station 2012 begins -- httpwwwnavymilsearchdisplayaspstory_id=65351
NNS120215-03 HSV 2 Project Handclasp On-load in GTMO-- httpwwwnavymilsearchdisplayaspstory_id=65353
NNS120215-05 NMCB 3 Relieves NMCB 5 of AFRICOM and EUCOM Seabee Operations-- httpwwwnavymilsearchdisplayaspstory_id=65357
AHU -- USS Port Royal Returns From Deployment-- httpwwwnavymilswfmmummplyraspid=16824
NNS120215-09 ONR Works to Build a Diverse Future Force Through Outreach-- httpwwwnavymilsearchdisplayaspstory_id=65352
NNS120215-08 Navy Warfare Development Command Announces Speakers for InnovationSymposium-- httpwwwnavymilsearchdisplayaspstory_id=65355
NNS120214-21 Making Your Move Easier-- httpwwwnavymilsearchdisplayaspstory_id=65348
Receive Updates 0
Navy News Service for Wednesday February 15 2012
httpcontentgovdeliverycombulletinsgdUSNAVYDMA-2f01f4[20120216 113409]
AHU -- Sasebo Holds Command Financial Specialist Training-- httpwwwnavymilswfmmummplyraspid=16825
AHU -- Montel Williams Cooks for Wounded Warriors-- httpwwwnavymilswfmmummplyraspid=16822
NNS120214-19 Montel Williams Provides Lunch for Wounded Warriors-- httpwwwnavymilsearchdisplayaspstory_id=65345
AHU -- Students Get Head Start on Jobs on Naval Base Guam-- httpwwwnavymilswfmmummplyraspid=16826
NNS120215-11 Current All Hands Update-- httpwwwnavymilsearchdisplayaspstory_id=65359
NNS011213-26 This Day in Naval History - Feb 15-- httpwwwnavymilsearchdisplayaspstory_id=355
All Hands Radio News - 16 February 2012USS Port Royal Returns Home from Final Operation New Dawn Deployment -- httpwwwnavymilnavydataradioPlayaspid=5560
Eye on the Fleet - US Navy Photo of The Day-- httpwwwnavymillist_singleaspid=115665
-USN--USN--USN-
NNS120215-07 Navy Names Five New Ships
From Department of the Navy
WASHINGTON (NNS) -- Secretary of the Navy Ray Mabus announced Feb 15 the next fiveNavy ships three Arleigh Burke-class guided-missile destroyers USS John Finn USS RalphJohnson and USS Rafael Peralta and two littoral combat ships (LCS) USS Sioux City andUSS Omaha
Mabus named the three destroyers after Navy and Marine Corps heroes whose actionsoccurred during different conflicts which spanned several decades but were united in theiruncommon valor The littoral combat ships were named after two American communities
John Finn who retired as a lieutenant received the Medal of Honor from Adm Chester Nimitzfor displaying magnificent courage in the face of almost certain death during the Japaneseattack on military installations in Hawaii during Pearl Harbor Marine Corps Pfc Ralph HenryJohnson was posthumously awarded the Medal of Honor for shouting a warning to his fellowMarines and hurling himself on an explosive device saving the life of one Marine andpreventing the enemy from penetrating his sector of the patrols perimeter during theVietnam War Marine Corps Staff Sgt Rafael Peralta was posthumously awarded the NavyCross for selflessly covering a grenade with his body to save his fellow Marines from the blastduring Operation Iraqi Freedom
Finn Johnson and Peralta have all been recognized with some of our nations highestawards said Mabus I want to ensure their service and sacrifice will be known by todayssailors and Marines and honored for several decades to come by a new generation ofAmericans and people from around the world who will come in contact with these ships
The Arleigh Burke-class destroyers will be able to conduct a variety of operations frompeacetime presence and crisis management to sea control and power projection All three
Navy News Service for Wednesday February 15 2012
httpcontentgovdeliverycombulletinsgdUSNAVYDMA-2f01f4[20120216 113409]
ships will be capable of fighting air surface and subsurface battles simultaneously and willcontain a myriad of offensive and defensive weapons designed to support maritime warfare inkeeping with the Navys ability to execute the Department of Defense defense strategy
The littoral combat ship is a major part of the future of our Navy Mabus said pointing outLCS is fast agile and operates with a smaller crew and can perform operations in bothshallow and deep waters
I chose the name for our two new littoral combat ships after Midwestern cities fromAmericas heartland to honor the patriotic hard-working citizens of Sioux City Iowa andOmaha Nebraska for their support of and contributions to the military
Sioux City and Omaha will be outfitted with reconfigurable payloads called mission packageswhich can be changed out quickly as combat needs demand These mission packages aresupported by special detachments that will deploy manned and unmanned vehicles andsensors in support of mine undersea and surface warfare missions
Marinette Marine in Marinette Wis will build the Freedom variant USS Sioux City which willbe 378 feet in length have a waterline beam of 57 feet displace approximately 3000 tonsand make speed in excess of 40 knots Austal USA in Mobile Ala will build the Independencevariant USS Omaha which will be 419 feet in length have a waterline beam of 103 feetdisplace approximately 3000 tons and make speed in excess of 40 knots
For more news from secretary of the Navy public affairs visit httpwwwnavymilSECNAV
For ore information about the littoral combat ship class visithttpwwwnavymilnavydatafact_displayaspcid=4200amptid=1650ampct=4
For more information about the Arleigh Burke class destroyers visithttpwwwnavymilnavydatafact_displayaspcid=4200amptid=900ampct=4
For more news visit wwwnavymil -USN--USN--USN-
NNS120214-20 USNS Comfort to Move to Naval Station Norfolk
From US Fleet Forces Public Affairs
NORFOLK Va (NNS) -- The Navy announced Feb 14 the hospital ship USNS Comfort (T-AH20) will shift its layberth from Baltimore Md to Naval Station (NS) Norfolk
Comforts current layberth contract in Baltimore runs through May 2013 if all options areexercised The Navy plans to execute the layberth shift on or about March 1 2013
A number of factors contributed to the decision to shift the Military Sealift Command vessel toNorfolk including an estimated annual savings of $17 million in the initial year and $21million for following years improved access to military facilities for the 59 permanent militarymembers assigned to the ship better use of the naval logistics hub and industrial base inNorfolk and a reduction in transit time to typical mission areas
The move of Comfort from a commercial layberth in Baltimore to a government pier at NSNorfolk Pier 1 maximizes use of existing infrastructure and facilities provides cost savings andoperational advantages that enhance Comforts mission capability and does not negativelyimpact medical staffing flexibility
The mission of Comfort is to provide afloat medical capacity for acute medical and surgicalcare for forward deployed operational forces As a secondary mission the ship provides a full-service hospital asset in support of disaster relief humanitarian assistance and defensesupport to civilian authorities worldwide
Navy News Service for Wednesday February 15 2012
httpcontentgovdeliverycombulletinsgdUSNAVYDMA-2f01f4[20120216 113409]
For more information visit wwwnavymil wwwfacebookcomusnavy orwwwtwittercomusnavy
For more news from US Fleet Forces Command visit wwwnavymillocalclf -USN--USN--USN-
NNS120215-10 Navy Marine Corps Publish Naval Aviation Vision January 2012
From Naval Aviation Enterprise Public Affairs
PATUXENT RIVER Md (NNS) -- The Naval Aviation Enterprise announced Feb 15 the latestNaval Aviation Vision book is now available
US Navy and Marine Corps aviation leaders published the latest edition of the biennialaviation overview Naval Aviation Vision January 2012 presenting a reflection of wherenaval aviation is today and how it will evolve to meet shifting international responsibilities andnational imperatives
The vision expressed in the book represents the collaborative views of the commander NavalAir Forces the deputy commandant for Aviation the commander Naval Air SystemsCommand the director Air Warfare Division and the director Program Integration forInformation Dominance
Naval Aviation Vision January 2012 consists of three main sections entitled Naval AviationToday Naval Aviation Tomorrow and Making Our Vision Real The Naval Aviation Todaysection provides examples of Naval Aviation in action conducting the full spectrum ofoperations from combat power to humanitarian assistance The Naval Aviation Tomorrowportion of the book describes various transformation roadmaps that represent naval aviationsrecapitalization and modernization plans for aviation-centric ships manned and unmannedaircraft systems and weapons The Making Our Vision Real section includes discussions ofthe Air-Sea Battle concept along with science and technology strategies for both the Navyand Marine Corps that highlight the transition from concepts to capabilities-based systemsand weaponry employed by Sailors and Marines
The vision book also presents information on the Naval Aviation Enterprise partnership and itscontributions toward readiness The Naval Aviation Enterprise is a partnership to advance andsustain naval aviation warfighting capabilities at an affordable cost today and in the future
It is comprised of more than 190000 Sailors Marines civilians and contractors that worktogether in support of naval aviation Enterprise efforts provide processes and forums forvarious naval aviation stakeholders to collaborate break down barriers spearhead cost-effective initiatives and provide leadership with critical data to make superior decisions
For more information about the Naval Aviation Enterprise visithttpwwwcnafnavymilnae
To view Naval Aviation Vision January 2012 visithttpwwwpublicnavymilairfornaeVision20BookNaval_Aviation_Visionpdf
For additional information about the book please contact naenavymil
For more information visit wwwnavymil wwwfacebookcomusnavy orwwwtwittercomusnavy
For more news from Naval Aviation Enterprise visit wwwnavymillocalNAE -USN--USN--USN-
Navy News Service for Wednesday February 15 2012
httpcontentgovdeliverycombulletinsgdUSNAVYDMA-2f01f4[20120216 113409]
NNS120214-18 NAVSUP GLS Supports Shipmates to Workmates Program
By Sam Samuelson NAVSUP GLS Corporate Communications Director
SAN DIEGO (NNS) -- Naval Supply Systems Command (NAVSUP) Global Logistics Support(GLS) supported more than 300 Sailors exploring government employment during theShipmates to Workmates job fair at Naval Base Coronado Feb 9
The job program links Sailors most of whom are anticipating leaving the Navy due to EnlistedRetention Board (ERB) results with Department of Navy (DON) agencies seeking the kinds ofskills and experiences the Sailors represent
Record-high retention and low attrition among active duty Sailors for 31 specific ratingsmanned at more than 103 percent prompted the creation of the ERB The purpose of ERB isto balance the force in terms of seniority experience and skills and to improve overalladvancement opportunity
Shipmates to Workmates maximizes the skills Sailors have with opportunities and needsthat exist throughout the DoN Its one way the Navy is communicating to Sailors that forcebalancing notwithstanding their skills are still valuable and marketable according to JoeBernardo director NAVSUP GLS workforce management division
There is a lot of skill talent and enthusiasm in these Sailors and we want them to know thatwere interested in exploring a future with them if we can Bernardo said
Sailors attracted by the NAVSUP GLS booth said they were eager to look into alternatives inemployment that capitalized on the skills they learned and developed in the Navy
Im just here to see what the Navy is offering in terms of future employment said AviationWarfare Systems Operator (Mechanical) 1st Class Josh Glennon No one likes to be told itstime to go home but at least theyre offering these opportunities There has been a lot ofassistance to ensure there is a safety net
Lt Jasmine Gough sought the NAVSUP GLS booth
I just love logistics Gough said I dont know I think Im a geek for numbers supply chainmanagement
The former supply corps school student said she has always gravitated toward logistics
If you know what you like if you know your calling then thats what you look for Goughsaid
Thats the shared hope of coordinators of Shipmates to Workmates and the Sailors seekingemployment opportunities
Its just another way of looking for opportunities no matter what happens in life saidPersonnel Specialist 1st Class Manuel Delgado I received word from the ERB aroundThanksgiving About the same time our extended family experienced a tragedy and thatswhen I told myself Im young healthy and have healthy kids I have a lot to be thankfulfor I already have a job opportunity so this is great
As of Jan 10 2012 2942 Sailors were in a not selected for retention status These Sailorsmust separate from the Navy no later than Sept 1 2012 unless operational waiver approvedfor later separation date (up to 90 days later)
Representatives from NAVSUP Global Logistics Support included Joe Bernardo Chachi Gormanand Anthony Goodwin From NAVSUP FLC San Diego were Linda Willis Jeffrey Allen andMargie Hontucan
Navy News Service for Wednesday February 15 2012
httpcontentgovdeliverycombulletinsgdUSNAVYDMA-2f01f4[20120216 113409]
Comprised of more than 5700 military and civilian logistics professionals contractors andforeign nationals NAVSUP GLS operates as a single cohesive team providing global logisticsservices from 110 locations worldwide
A component of the Naval Supply Systems Command headquartered in Mechanicsburg PaNAVSUP GLS is part of a worldwide network of more than 22500 military and civilianpersonnel providing combat capability through logistics
For more information about transition benefits visit the Transition Assistance Web Pageavailable under the Hot Links section of the Navy Personnel Command at wwwnpcnavymilor contact the NPC customer service center at CSCmailboxnavymil or 1-866-U-ASK-NPC
More information on ERB transition assistance can be found on the NPC Web page athttpwwwpublicnavymilbupers-npcboardsERBPagesTransitionInfoaspx
Visit httpswwwnavsupnavymilnavsupourteamnavsupglsnews for more NAVSUP GLSnews Connect with NAVSUP GLS on Facebook at httpwwwfacebookcomnavsupgls
For more information visit wwwnavymil wwwfacebookcomusnavy orwwwtwittercomusnavy
For more news from Naval Supply Systems Command visit wwwnavymillocalnavsup -USN--USN--USN-
NNS120215-06 USS Mason Upgraded with New Chemical Agent Detection Capability
By John J Joyce Naval Surface Warfare Center Dahlgren Public Affairs
DAHLGREN Va (NNS) -- A new automated chemical warfare agent detection capability thatsuccessfully passed operational tests aboard USS Mason (DDG 87) will be installed onwarships throughout the fleet Navy officials announced Feb 15
The Navy plans to install the new system - designed to quickly alert warfighters to thepresence of chemical warfare agents - on all active guided-missile destroyers and cruisersaircraft carriers large and small deck amphibious ships littoral combat ships and drycargoammunition ships by the end of 2018
IPDS-LR (Improved Point Detection System - Lifecycle Replacement) will provide the Navycontinued chemical warfare agent detection identification and alerting along with the highsystem reliability they need to perform their mission worldwide said Bruce Corso IPDS-LRsystem manager office of the Joint Project Manager for Nuclear Biological and ChemicalContamination Avoidance (JPM NBCCA)
This successful deployment of the IPDS-LR is a culmination of the work of some greatscientists and engineers collaboration with the joint community and having waterfrontlocations that provide continuous fleet interaction said Naval Surface Warfare CenterDahlgren Division (NSWCDD) Chemical Biological and Radiological (CBR) Defense DivisionHead Mike Purello
Warfighters aboard Mason - the first guided-missile destroyer (DDG) protected by IPDS-LR -are now relying on a better performing system that features ion mobility spectrometry Thischemical detection technology creates ions that separate by the time it takes the ion clustersto traverse a constant electric field drift region
I am excited to have the Improved Point Detection System - Lifecycle Replacement onboard said Mason Commanding Officer Cmdr Adan Cruz after testing concluded Jan 27As captain I hold the responsibility for the safety of the crew and this system providesenhanced chemical warfare defense to ensure our sailors will return home safely
Navy News Service for Wednesday February 15 2012
httpcontentgovdeliverycombulletinsgdUSNAVYDMA-2f01f4[20120216 113409]
The install went extremely well said Mason Executive Officer Cmdr Mike Briggs Having areliable chemical detection system onboard to aid in ships defense goes towards makingMason a more effective warship
Teams based in Norfolk Va and San Diego Calif are prepared to install the new system on35 ships in 2012
USS William P Lawrence (DDG-110) USS Howard (DDG-83) and USS Mesa Verde (LPD-19)are the next ships on NSWCDD CBR Defense Divisions schedule for IPDS-LR installation
More DDGs will follow said NSWCDD IPDS-LR Project Lead Brian Flaherty The Sailor willsee a system they can turn on and be confident it is protecting them It samples air fromoutside the ship evaluates it for the presence of chemical warfare agents and if theres anagent present - IPDS-LR will alert them in an adequate amount of time to take precautionarymeasures
IPDS-LR components located on the port and starboard sides of a ship sample air throughexternal intakes in the hull The system analyzes the external air for chemical agents
If the detector identifies a chemical agent it sends a signal that displays an alert at both theships damage control central and the bridge said Flaherty The system also interfacesdirectly to the ships chemical alarm which broadcasts an audible ship-wide alarm to alertthe crew of a chemical warfare agent
IPDS-LRs test and evaluation involved extensive time both in the laboratory and aboard ship- with extensive time at sea as well as an independent underway evaluation by the Navyscommander operational test and evaluation force
The new system is more maintainable and reliable said Flaherty Warfighters will seeimproved false alarm performance and longer periods of time between repairs It will beeasier and cheaper to repair
Based on a commercial-off-the-shelf concept a joint team of NSWCDD and JPM NBCCAengineers evaluated IPDS-LR in reliability availability and maintainability (RAM) testsemphasizing a Navy shipboard maritime environment
The team collected more than 14000 hours of underway and in-port test time supporting theRAM analysis with multiple ships - and ship classes - based in the Norfolk and San Diegoareas Additional data collection continued aboard ships in forward deployed locations
Its very rewarding to field this system to the Fleet said Flaherty noting that his teamconducted IPDS-LR tests on the Navy side - shock testing vibration testing electromagneticinterference - and worked with different groups over two-and-a-half years to make sure thesystem is ready to field to the warfighter
The Navys CBR Defense Division exists to provide our warfighter with the tools andcapabilities necessary to detect protect and if necessary decontaminate threats resultingfrom a CBR attack said Purello Our direct and active connection with the fleet helps thewarfighter and provides a wealth of valuable information for our scientists and engineers inthe lab This knowledge is immediately put to use as they work to create develop andprovide updates and future solutions for our men and women in uniform
A Navy leader in CBR Defense NSWC Dahlgrens CBR Defense Division provides a fullcomplement of capabilities that support the naval warfighter both on land and at sea as wellas the joint and Homeland Defense communities
For more information visit wwwnavymil wwwfacebookcomusnavy orwwwtwittercomusnavy
For more news from Naval Surface Warfare Center Dahlgren visit
Navy News Service for Wednesday February 15 2012
httpcontentgovdeliverycombulletinsgdUSNAVYDMA-2f01f4[20120216 113409]
wwwnavymillocalnswcdahlgren -USN--USN--USN-
NNS120215-01 Africa Partnership Station 2012 begins
From Commander US Naval Forces Europe-AfricaCommander US 6th Fleet Public Affairs
NAPLES Italy (NNS) -- Sailors and coast guardsmen from several African nations aregathered in Lagos Nigeria to participate in the start of Africa Partnership Station 2012 (APS)Feb 14
APS is part of an ongoing international effort to assist African nations to improve maritimesafety and security The security cooperation initiative now in its fifth year is aimed atstrengthening global maritime partnerships through training and collaborative activities inorder to improve maritime safety and security in Africa
This years program builds upon relationships fostered in previous years and brings togethermore than 30 African European North and South American countries
By working together African navies and coast guards are able to bring maritime safety andsecurity which will help secure their future said Chief Warrant Officer Eve McAnallen APStraining officer
USS Simpson (FFG 56) arrived in Lagos Nigeria to launch this years training program Whilein port Simpsons crew will work with Nigerian sailors and coast guardsmen and with crewsfrom 11 other African nations participating in the first leg of training events
Its a great way to start APS said Cmdr Leonard Milliken Simpsons commanding officerAPS is an important mission because it helps growing navies and coast guards in Africaconduct maritime operations
Bringing these nations together for specifically tailored training events both ashore and atsea allow African maritime nations to improve their capabilities while strengtheningrelationships with partner nations APS also allows African maritime nations to bolsterregional maritime safety and security throughout the maritime environment in three specificareas counter-piracy illicit trafficking and energy and resource security
Through a regional comprehensive approach APS helps African nations build their ownmaritime domain awareness create maritime professionals build required maritimeinfrastructure and improve response capabilities in the maritime environment The commonbelief among participating nations is that APS contributes to development economicprosperity and security within Africa
I really appreciate the APS program because it helps us improve and meet our potentialthrough different experiences said Gabonese Chief Petty Officer Pierre Mboulou I hope thisprogram can be held every year and keep going to help African militaries
APS brings together African partners allowing them to focus on common security challenges
By working together African navies and coast guards are able to improve maritime safetyand security which will help secure their future Chief Warrant Officer McAnallen said
Simpsons visit to Lagos is one example of how APS works to bring regional partners togetherto share and learn specialty skills Experts will use practical classroom and sometimes real-world events to help build African navies professional skill to combat crime at sea
APS is about developing African solutions to global problems and building upon long-standingrelationships African European and North and South American partners and non-governmental organizations share a common goal of regional prosperity stability and peace
Navy News Service for Wednesday February 15 2012
httpcontentgovdeliverycombulletinsgdUSNAVYDMA-2f01f4[20120216 113409]
APS helps to create partnerships among a number of organizations who have not traditionallyworked with each other in the past to achieve common goals through collaboration
Following this visit Simpson will continue APS engagements in the Gulf of Guinea Later inthe year the dock landing ship USS Fort McHenry (LSD 43) and the High Speed Vessel Swift(HSV 2) will deploy in support of APS
For more information visit wwwnavymil wwwfacebookcomusnavy orwwwtwittercomusnavy
For more news from Commander US Naval Forces Europe and AfricaUS 6th Fleet visitwwwnavymillocalnaveur -USN--USN--USN-
NNS120215-03 HSV 2 Project Handclasp On-load in GTMO
By Lt Matthew Comer High Speed Vessel-Southern Partnership Station Public Affairs
GUANTANAMO BAY Cuba (NNS) -- High Speed Vessel (HSV) 2 Swift arrived at Naval StationGuantanamo Bay Cuba Feb 14 to prepare for the final stop of its four-month missionduring HSV-Southern Partnership Station 2012 (HSV-SPS 12)
Swift stopped in Cuba to on-load more than $4 million of Project Handclasp suppliesscheduled to be delivered in Cap-Haitien Haiti
Project Handclasp is a US Navy program that accepts and transports educationalhumanitarian and goodwill materials donated by Americas private sector on a space-availablebasis aboard Navy ships for distribution to foreign nation recipients
Swifts unique design allows us to transport these supplies quickly and efficiently saidCmdr Garry Wright HSV-SPS 12 mission commander Project Handclasp illustrates howhaving great partnerships in the Caribbean can really have an impact
While in Guantanamo Bay Swift on-loaded cargo that included more than 200 pallets ofsupplies The pallets included medical supplies disinfectant an ultrasound machine booksand high-calorie meals Swift also took-on two pick-up trucks to be delivered in Haiti
The ship was designed to carry cargo very quickly from one point to another said LtChristopher Ganske Swifts supply officer It is nice to get the opportunity to use the shipfor that purpose and at the same time have an impact on the Haitian community
The Project Handclasp off-load will compliment Seabee Marine and Naval CriminalInvestigative Service HSV-SPS 12 missions in Haiti The Swift will be in Haiti for three weeksworking with Haitian and United Nations personnel to exchange knowledge in the areas ofsecurity public health and construction The stop in Haiti follows visits to the DominicanRepublic Guatemala El Salvador Panama and Peru
The mission has been a great success thus far said Wright Our upcoming visit in Haiti willbe the keystone of this deployment highlighting the capabilities of the ship and its servicemembers as well as the partnerships we have created over the last four months
Southern Partnership Station is an annual deployment of US ships to the US SouthernCommand area of responsibility in the Caribbean and Latin America The missions primarygoal is information sharing with navies militaries and civilians in the regionUS Naval Forces Southern Command and US 4th Fleet (COMUSNAVSOC4F) supports USSouthern Command joint and combined full-spectrum military operations by providingprincipally sea-based forward presence to ensure freedom of maneuver in the maritimedomain to foster and sustain cooperative relationships with international partners and to fullyexploit the sea as maneuver space in order to enhance regional security and promote peace
Navy News Service for Wednesday February 15 2012
httpcontentgovdeliverycombulletinsgdUSNAVYDMA-2f01f4[20120216 113409]
stability and prosperity in the Caribbean Central and South American regions
For more information visit wwwpublicnavymilcomusnavso-c4fwwwfacebookcomNAVSOUS4THFLT or wwwtwittercomNAVSOUS4THFLT
For more information visit wwwnavymil wwwfacebookcomusnavy orwwwtwittercomusnavy
For more news from US Naval Forces Southern Command amp US 4th Fleet visitwwwnavymillocalcusns -USN--USN--USN-
NNS120215-05 NMCB 3 Relieves NMCB 5 of AFRICOM and EUCOM Seabee Operations
By Chief Mass Communication Specialist Jesse A Sherwin III Naval Mobile ConstructionBattalion 3 Public Affairs
CAMP MITCHELL Spain (NNS) -- Seabees from Naval Mobile Construction Battalion (NMCB) 3relieved NMCB 5 of all Seabee construction responsibilities in Europe and Africa during aformal ceremony Feb 14
The relief in place and transfer of authority ceremony (RIPTOA) marked the official end ofNMCB 5s deployment to Europe and Africa that started in August when they deployed fromPort Hueneme Calif
Before the RIPTOA could occur a weeklong inspection and review was conducted of allequipment supplies projects facilities and civil engineering support equipment (CESE)
Unlike a ship when a Seabee battalion deploys they do not travel with their equipmentInstead all of the construction equipment and supplies that they will use are already at theirdeployment sites A detailed turnover must be conducted before the oncoming battalioncommences work
The equipment and supplies that the battalion uses is called a table of allowance (TOA) Foran NMCB the entire TOA which is worth more than $70 million is designed to supportoperations and sustainment of a 600 Seabee battalion conducting forward contingency andhumanitarian assistance operations anywhere in the world said Chief Logistics SpecialistFrankie Acevedo the NMCB 3 supply chief
If any tools parts or other supplies are found to be missing during the inspection theyneed to be on order or placed on order said Acevedo We have to maintain the TOA at 100percent readiness
The CESE undergoes a more thorough inspection in a process called the Battalion EquipmentEvaluation Program (BEEP) The BEEP inspection is designed to transfer all special knowledgeof CESE maintenance operations and techniques to the relieving battalion During the BEEPinspection NMCB 3 Alfa Company consisting of construction mechanics and equipmentoperators inspected and received custody of more than 200 units of CESE When theinspection was complete a red diamond shaped sticker with a white number three called aBEEP sticker was placed on each piece of CESE
The BEEP sticker identifies what type and what specific Seabee unit the CESE belongs tosaid Construction Mechanic 1st Class James Gongas from NMCB 5
A red diamond identifies the CESE as belonging to an NMCB A triangle will identify it asbelonging to a naval construction regiment and a square is an underwater construction team
Along with the equipment and supply turnover NMCB 3 relieved NMCB 5 of constructionproject responsibilities throughout Europe and Africa
Navy News Service for Wednesday February 15 2012
httpcontentgovdeliverycombulletinsgdUSNAVYDMA-2f01f4[20120216 113409]
Some of the ongoing projects include building a school and a bathroom facility for the localsin Gende Gerade Ethiopia drilling seven water wells in Ethiopia and building two healthclinics in Djibouti Africa
As NMCB 3 completes projects they will begin new ones including placing a water line withthe help of local military engineers for Zagreb Croatia and extending an existing runway inManda Bay for the government of Kenya
Now that the turnover is complete NMCB 5 will return to Port Hueneme Calif
NMCB 3 is an expeditionary naval construction element currently assigned to US 6th FleetsCommander Task Force 68 to provide construction engineering and security services thatsupport national strategy naval power projection humanitarian assistance and contingencyoperations
For more information visit wwwnavymil wwwfacebookcomusnavy orwwwtwittercomusnavy
For more news from Naval Mobile Construction Battalion 3 visit wwwnavymillocalnmcb3 -USN--USN--USN-
NNS120215-09 ONR Works to Build a Diverse Future Force Through Outreach
By Katherine H Crawford Office of Naval Research
ARLINGTON Va (NNS) -- Office of Naval Research (ONR) personnel will be in PhiladelphiaFeb 17-18 providing information to approximately 10000 students and professionalsattending the annual Black Engineer of the Year (BEYA) conference
BEYA is an opportunity for ONR to interact with a diverse group of young engineers who maycontribute to some of our future work force needs said Dr Anthony Junior directorDepartment of the Navy (DoN) Historically Black Colleges and UniversitiesMinorityInstitutions Program office
Attracting a wide assortment of top employees-particularly for Science TechnologyEngineering and Math (STEM) fields-is a DON priority It is also a key component of thesecretary of the Navys STEM roadmap which aims to expand nationwide efforts to increasestudent and teacher participation in science and technology-related fields as well as bolsterinterest from underserved populations The ultimate goal is to increase the number ofstudents pursing STEM studies and careers to support both the DON and the nation
ONR subject-matter experts will be in booth No 515 speaking to attendees about thecommands internship research and career opportunities Exhibit hours are 9 am- 4 pmFeb 17 and 10 am- 4 pm Feb 18
Formally called the 26th BEYA STEM Global Competitiveness Conference the event will alsofeature opportunities for students including a career fair and job search resources as well asfor professionals including training networking role models mentors and awards Attendeesinclude college representatives thousands of elite professionals and students from across thecountry who are interested or involved in STEM disciplines and careers
The event also includes seminars workshops presentations and a Stars amp Stripes dinnerhonoring active and retired African-American high-ranking military personnel and members ofthe Senior Executive Service
ONR provides the science and technology necessary to maintain the Navy and Marine Corpstechnological advantage Through its affiliates ONR is a leader in science and technology with
Navy News Service for Wednesday February 15 2012
httpcontentgovdeliverycombulletinsgdUSNAVYDMA-2f01f4[20120216 113409]
engagement in 50 states 30 countries 1035 institutions of higher learning and more than900 industry partners ONR employs approximately 1065 people comprising uniformedcivilian and contract personnel with additional employees at the Naval Research Lab inWashington DC
For more information visit wwwnavymil wwwfacebookcomusnavy orwwwtwittercomusnavy
For more news from Office of Naval Research visit wwwnavymillocalonr -USN--USN--USN-
NNS120215-08 Navy Warfare Development Command Announces Speakers for InnovationSymposium
From Navy Warfare Development Command Public Affairs
NORFOLK Va (NNS) -- Navy Warfare Development Commands (NWDC) Innovation Series2012 will kick off this years campaign with a Maritime Innovation Symposium scheduled forMarch 13-14 at NWDC on Naval Station Norfolk
Under the theme Regaining the Innovation AdvantageAwakening Our Creative DNA thesymposium will feature speakers from military academia and industry to exchange ideasidentify opportunities and challenges propose ways to move maritime innovation forwardand educate and elevate awareness of innovation across the fleet
Adm John C Harvey Jr commander US Fleet Forces will kick off the event Rear AdmTerry B Kraft commander Navy Warfare Development Command will also provide remarksand serve as host
Featured speakers will includeDr Williamson Murray author of Military Innovations in the Interwar Period will set thestage during an opening session on Historical Perspectives on Navy Innovation
Robert Rubel dean of the Center for Naval Warfare Studies at the Naval War College willtalk about the Sociology of Innovation in the Navy
Dennis Bushnell chief scientist at NASA Langley Research Center will discuss InnovationBarriers and Opportunities
Art Corbet director Marine amp Naval Concepts will bring a Marine perspective through TheBenefits of Mission Command
Vice Adm Robert Parker Commander Coast Guard Atlantic Area will provide a Coast Guardperspective
Dr Lawrence Schuette director of Innovation at the Office of Naval Research will presentIncreasing the Navys Capacity for Innovation
Peter Wilson senior defense research analyst for RAND Corporation will talk aboutRelationships of Military Innovation across Four Generations of Warfare
John Kao chairman of the Institute for Large Scale Innovation will give his insights onHarnessing Innovative Practices
Professor Don Chisholm of the Joint Military Operations Department at the Naval WarCollege will wrap-up the conference with a discussion on Setting the Conditions for anInnovative Culture
Our Navy has a unique history of creativity and adaptability The challenge now in a
Navy News Service for Wednesday February 15 2012
httpcontentgovdeliverycombulletinsgdUSNAVYDMA-2f01f4[20120216 113409]
changing world with budget challenges is to regain our innovation advantage Kraft saidThat is the focus of the symposium and our overall Innovation Series 2012 campaign toawaken our culture of innovation in direct support of the warfighter
Individuals who would like to attend the event can find registration and other logistical information at on NWDCs CAC-enabled portal athttpsportalnwdcnavymilcftISdefaultaspx
For more information visit wwwnavymil wwwfacebookcomusnavy orwwwtwittercomusnavy
For more news from Navy Warfare Development Command visit wwwnavymillocalnwdc -USN--USN--USN-
NNS120214-21 Making Your Move Easier
By Pat Tiny Del Grosso NAVSUP Fleet Logistics Center Puget Sound Director CorporateCommunications
WASHINGTON (NNS) -- The Personal Property Office at NAVSUP Fleet Logistics Center (FLC)Puget Sound stood up operation of new Defense Personal Property System (DPS) kiosks Feb13
The DPS kiosks located at Building 985 consist of two computer workstations where activeduty members civilian government employees and their spouses can access movemilwhich is a portal into DPS
DPS is a web-based tool customers use to schedule and manage their household goodsmoves
While DPS and Movemil are accessible from any computer that connects to the internetmany customers new to the DPS system often experience difficulties navigating the site Thekiosks provide an opportunity for customers who are having issues with one or two portionsof the application at home to come into the office and receive assistance said AndreaGergen NAVSUP FLC Puget Sound household goods regional manager
To access DPS service members and civilians must first establish an account and a passwordby clicking on DPS Registration on the Movemil homepage DPS offers the registeredpersonnel 24-hour access to their moving arrangements It also provides the ability to trackshipments from anywhere anytime
The goal of the Personal Property Office at Bremerton is to provide on-the-spot help tocustomers so they can submit their application and be on their way Customers will like theconvenience of being able to fill out their paperwork online After completing as much oftheir application as they can at home customers can come into the office and pull up theironline application on the kiosk At that point we can provide immediate help said Gergen
For more information visit wwwnavymil wwwfacebookcomusnavy orwwwtwittercomusnavy
For more news from Naval Supply Systems Command visit wwwnavymillocalnavsup -USN--USN--USN-
NNS120214-19 Montel Williams Provides Lunch for Wounded Warriors
By Mass Communication Specialist 1st Class (SWAW) Monique K Hilley
Navy News Service for Wednesday February 15 2012
httpcontentgovdeliverycombulletinsgdUSNAVYDMA-2f01f4[20120216 113409]
BETHESDA Md (NNS) -- Montel Williams provided lunch for nearly 100 wounded warriorsand their families at the Fisher House in Bethesda Md Feb 13
Service members and their families were treated to a feast of donated baby back ribs pulledpork and coleslaw fried fish cooked by Montels sister Marjorie crab cakes made by hisfather Herman a salad and turkey chili prepared by one of Montels favorite chefs ClaireWinslow and green fruit smoothies which Montel prepared himself Two large patriotic cakeswere also donated for dessert
This started six trips ago and now this is trip number seven and by the time we get donewell be at trip number 70 or 80 because Im going to continue to do this I think its just away for us to give back said Williams Why am I doing this Because I want to stop peoplefrom just paying lip service to I support the troops and understand there is something youcan do personally to put a smile on a soldiers face
The luncheon marked the Williams familys seventh trip to provide lunch at Fisher House forwounded warriors their family members and the guards on the base
These family members come down here and they do what we dont do for those who allowus to live with the dignity we do and the freedom we do said Williams These familymembers dont ask for anything they barely even ask for help they dont even know aboutFisher House Most of the time Fisher House has to reach out to them and say look I havea place for you to stay
Fisher House has provided help on average for 17000 families a year across the nation at56 Fisher Houses located nationwide The houses are located near Veterans Affairs (VA)hospitals and at all major military medical facilities The Fisher House in Bethesda has fivehouses with 72 rooms total
We are opening number 57 at Joint Base Elmendorf-Richardson near Anchorage Alaska onFriday [Feb 17] one at the end of the month in Salt Lake City at the VA and one at FtBelvoir on the 22nd of May said Cindy Campbell Fisher House Foundation Inc vicepresident for Community Relations and Media Affairs
So were expanding a great deal Were also building a Fisher House in Birmingham Englandto support British wounded warriors at their hospital Its our chance to reach out to our alliesand thank them for their service as Americans and to give back to the British soldiers whohave served us so well
Fisher Houses are free of charge for all family members and caregivers to the woundedwarriors not just spouses parents or siblings Family members can stay for any length oftime needed whether that is for a week six months or a year Cindy and all members of theFisher House Foundation of which Montel Williams is a trustee are grateful to have himtalking about Fisher House and providing lunches for the families
This is a chance for us at Fisher House to thank the families for what theyre doing becausewe all forget that when the military member is wounded we only tend to think about theprice of that injury that has to do with the recovery of the wounded said Campbell Theother price is the family because you have the entire family that has now taken on this injuryTheyre the ones who have to get him through this
One of the families Fisher House is helping is Deborah Elliott and her husband Marine CaptTommy Elliott an aviation supply officer assigned to Cherry Point NC who was recentlydiagnosed with Crohns disease The Elliotts who are expecting their son Oliver to bedelivered at Bethesda within the next 10 days have been at Fisher House since Dec 312011 when Capt Elliott was admitted to the hospital
He was in the hospital for two weeks inpatient care and hes getting outpatient care soweve been here for six weeks said Debbie Elliott For the treatment they have my husbandon theyre still trying to work everything out because its such a severe disease He has tobe near the hospital because hes on complete digestive rest so he cant eat at all and is on
Navy News Service for Wednesday February 15 2012
httpcontentgovdeliverycombulletinsgdUSNAVYDMA-2f01f4[20120216 113409]
a feeding tube and nutrition bag They said no food for another two to three weeks but thedoctors suggest we are in this area for another six months
For the Elliotts charities such as Fisher House can become a long-term solution to what mayhave quickly become a financial crisis brought on by severe health issues and the expensesthat can rack up during those times
It has been wonderful that we are here and weve been provided with a place to stay saidDebbie Elliott Its really nice to have this facility on base close to the hospital where wecan come and go as we need to his appointments Its nice knowing that hes gettingtreatment and Ill be getting treatment here shortly for the birth of our son
Montel Williams providing lunch at Fisher House took some guests by surprise Montel arrivedat nine am to begin preparing and cooking the food with lunch beginning at noon
I didnt expect to wake up and go down to get some breakfast and Montel Williams is inthere getting ready for lunch said Debbie Elliott Its just wonderful that he is here and thathe supports Fisher House Hes got his own history with the military so hes very connectedto this place
During the lunch he chatted with many of the families and let them know how much heappreciated them As a former enlisted Marine and graduate of the US Naval Academy with22 years of service Montel has a connection to those who are currently serving in themilitary
I spent every single day I could trying my best at the time I was on active duty thinking thatI was in every hot spot we had said Williams I have a very strong bond with the guys whostill are willing to not have to do so because they were forced by draft they step up to theplate and volunteer to continue to support and defend my democracy I mean come onwhat else am I supposed to be doing then what Im doing here
Over the course of the last three years Williams has been visiting the wounded warriors inBethesda Md almost every month
I go and I see them and after about a year I didnt even know Fisher House existed saidWilliams I was introduced to one of the board members of Fisher House and was shockedthat this is an organization that number one doesnt have as much media attention as itshould because these guys are in my opinion the No 1 wounded warrior charity in thecountry They are providing free living space for family members while their loved onesrecover in the hospital here and in the course of about nine years now theyve given over180 million dollars in services just to our fallen Soldiers
Montel Williams a former talk show host who has prided himself in leading his life in a waythat may serve as an example to others continues to do that through his work with theFisher House Foundation
I think its just as important to give lip service to it as it is to give heart to it to give yourpersonal time to it said Williams I can sit on television and say you need to do this butunless I bring myself down here and try to show by example and do it again and again andagain and again I dont think it makes sense to people Then once they start to see stuff likethis maybe theyll start to realize that what did I do last week to say thank you for beingfree
For more news from Commander Navy Installations Command visit wwwnavymillocalcni
-USN--USN--USN-
NNS120215-11 Current All Hands Update
Navy News Service for Wednesday February 15 2012
httpcontentgovdeliverycombulletinsgdUSNAVYDMA-2f01f4[20120216 113409]
From Defense Media Activity - Navy
WASHINGTON (NNS) -- All Hands Update features five newscasts today - one two-minutenewscast and four one-minute newscasts
Two-minute newscast-- Montel Williams Cooks for Wounded Warriorshttpwwwnavymilswfmmummplyraspid=16822 httpyoutubewUMhms4tb1Q
First one-minute newscast-- Headlines for Wednesday February 15 2012 Continuation Board Results Released onBUPERS Online HSV Swift 2 Participates in Project Handclasphttpwwwnavymilswfmmummplyraspid=16823 httpyoutubel2-RbH6W7mM
Second one-minute newscast-- USS Port Royal Returns From Deploymenthttpwwwnavymilswfmmummplyraspid=16824 httpyoutubedp1YLuWhXFI
Third one-minute newscast-- Sasebo Holds Command Financial Specialist Traininghttpwwwnavymilswfmmummplyraspid=16825 httpyoutubePyFD31bOtuw
Fourth one-minute newscast--Students Get Head Start on Jobs on Naval Base Guamhttpwwwnavymilswfmmummplyraspid=16826 httpyoutube_ySktc48LnA
Defense Media Activity-Navy produces four All Hands Update (AHU) newscasts each day - onetwo-minute newscast and three one-minute newscasts AHU can be seen throughout the dayand evening on the Direct-to-Sailor (DTS) satellite television service available aboard 160ships of the fleet and via the Navy Web site at wwwnavymil Check your local DTS programschedule for air times AHU can also be seen throughout the world on the American ForcesRadio and Television Service-USN--USN--USN-
-USN--USN--USN-
NNS011213-26 This Day in Naval History - Feb 15
From the Navy News Service
1856 - USS Supply commanded by Lt David Dixon Porter sails from Smyrna Syria boundfor Indianola Texas with a load of 21 camels intended for experimental use in the Americandesert west of the Rockies1898 - The battleship USS Maine mysteriously blows up in Havana Harbor in Cuba killingmore than 260 Sailors and Marines while injuring scores more The tragedy sparks theSpanish-American War
-USN--USN--USN-
Navy News Service for Wednesday February 15 2012
httpcontentgovdeliverycombulletinsgdUSNAVYDMA-2f01f4[20120216 113409]
Navy News Service is the official news wire service of the US Navy containing storiesrecently posted to the Navy Web site at wwwnavymil It is a product of the Defense MediaNavy - 6700 Taylor Rd Fort Meade MD 20755 Reprints should be credited to the NavyNews Service (NNS)
For the latest in Navy news from around the fleet visit wwwnavymil
For all Navy-related questions review the FAQs posted at wwwnavymil or visitwwwhistorynavymil
Media queries should be directed to the Navy News Desk at (703) 697-5342-USN-
Navy Names Five New Ships
httpwwwnavymilsearchdisplayaspstory_id=65361[20120216 113433]
Careers Info Index About Us Contact Us Home
gtgtgt Advanced Search US Navy Today About the Navy Navy Leadership Media Resources Links of Interest Information Index
Navy Names Five New Ships Related Photos
Navy Names Five New ShipsStory Number NNS120215-07 Release Date 2152012 25000 PM 0 Comments
Font Size A A A 5 0
From Department of the Navy
WASHINGTON (NNS) -- Secretary of the Navy Ray Mabus announced Feb 15 the next five Navy shipsthree Arleigh Burke-class guided-missile destroyers USS John Finn USS Ralph Johnson and USS RafaelPeralta and two littoral combat ships (LCS) USS Sioux City and USS Omaha
Mabus named the three destroyers after Navy and Marine Corps heroes whose actions occurred duringdifferent conflicts which spanned several decades but were united in their uncommon valor The littoralcombat ships were named after two American communities
John Finn who retired as a lieutenant received the Medal of Honor from Adm Chester Nimitz fordisplaying magnificent courage in the face of almost certain death during the Japanese attack on militaryinstallations in Hawaii during Pearl Harbor Marine Corps Pfc Ralph Henry Johnson was posthumouslyawarded the Medal of Honor for shouting a warning to his fellow Marines and hurling himself on anexplosive device saving the life of one Marine and preventing the enemy from penetrating his sector ofthe patrols perimeter during the Vietnam War Marine Corps Staff Sgt Rafael Peralta was posthumouslyawarded the Navy Cross for selflessly covering a grenade with his body to save his fellow Marines fromthe blast during Operation Iraqi Freedom
Finn Johnson and Peralta have all been recognized with some of our nations highest awards saidMabus I want to ensure their service and sacrifice will be known by todays sailors and Marines andhonored for several decades to come by a new generation of Americans and people from around the worldwho will come in contact with these ships
The Arleigh Burke-class destroyers will be able to conduct a variety of operations from peacetimepresence and crisis management to sea control and power projection All three ships will be capable offighting air surface and subsurface battles simultaneously and will contain a myriad of offensive anddefensive weapons designed to support maritime warfare in keeping with the Navys ability to execute theDepartment of Defense defense strategy
The littoral combat ship is a major part of the future of our Navy Mabus said pointing out LCS is fastagile and operates with a smaller crew and can perform operations in both shallow and deep waters
I chose the name for our two new littoral combat ships after Midwestern cities from Americas heartlandto honor the patriotic hard-working citizens of Sioux City Iowa and Omaha Nebraska for their supportof and contributions to the military
Sioux City and Omaha will be outfitted with reconfigurable payloads called mission packages which canbe changed out quickly as combat needs demand These mission packages are supported by specialdetachments that will deploy manned and unmanned vehicles and sensors in support of mine underseaand surface warfare missions
Marinette Marine in Marinette Wis will build the Freedom variant USS Sioux City which will be 378 feetin length have a waterline beam of 57 feet displace approximately 3000 tons and make speed inexcess of 40 knots Austal USA in Mobile Ala will build the Independence variant USS Omaha whichwill be 419 feet in length have a waterline beam of 103 feet displace approximately 3000 tons andmake speed in excess of 40 knots
For more news from secretary of the Navy public affairs visit httpwwwnavymilSECNAV
For ore information about the littoral combat ship class visithttpwwwnavymilnavydatafact_displayaspcid=4200amptid=1650ampct=4
For more information about the Arleigh Burke class destroyers visithttpwwwnavymilnavydatafact_displayaspcid=4200amptid=900ampct=4
For more news visit wwwnavymil
View Larger Download HiRes View All Photos
Official US Navy file photo
Related ContentNo related content is currentlyavailable
Submit StoryPhotos
Tools
Privacy amp Security
External Links
To sign up for updates or toaccess your subscriberpreferences please enter youre-mail address
httpwwwnavymilmanagementphotodbphotos120202-N-OY799-048jpg[20120216 113450]
USNS Comfort to Move to Naval Station Norfolk
httpwwwnavymilsearchdisplayaspstory_id=65347[20120216 113513]
Careers Info Index About Us Contact Us Home
gtgtgt Advanced Search US Navy Today About the Navy Navy Leadership Media Resources Links of Interest Information Index
USNS Comfort to Move to Naval Station Norfolk Related Photos
USNS Comfort to Move to Naval StationNorfolk
Story Number NNS120214-20 Release Date 2142012 94900 PM 0 Comments Font Size A A A 0 0
From US Fleet Forces Public Affairs
NORFOLK Va (NNS) -- The Navy announced Feb 14 the hospital ship USNS Comfort (T-AH 20) will shiftits layberth from Baltimore Md to Naval Station (NS) Norfolk
Comforts current layberth contract in Baltimore runs through May 2013 if all options are exercised TheNavy plans to execute the layberth shift on or about March 1 2013
A number of factors contributed to the decision to shift the Military Sealift Command vessel to Norfolkincluding an estimated annual savings of $17 million in the initial year and $21 million for followingyears improved access to military facilities for the 59 permanent military members assigned to the shipbetter use of the naval logistics hub and industrial base in Norfolk and a reduction in transit time totypical mission areas
The move of Comfort from a commercial layberth in Baltimore to a government pier at NS Norfolk Pier 1maximizes use of existing infrastructure and facilities provides cost savings and operational advantagesthat enhance Comforts mission capability and does not negatively impact medical staffing flexibility
The mission of Comfort is to provide afloat medical capacity for acute medical and surgical care forforward deployed operational forces As a secondary mission the ship provides a full-service hospitalasset in support of disaster relief humanitarian assistance and defense support to civilian authoritiesworldwide
For more information visit wwwnavymil wwwfacebookcomusnavy or wwwtwittercomusnavy
For more news from US Fleet Forces Command visit wwwnavymillocalclf
View Larger Download HiRes View All Photos
110618-N-EP471-301 SAN JUAN DEL SURNicaragua (June 18 2011) The Military SealiftCommand hospital ship USNS Comfort (T-AH20) is anchored off the coast of Nicaraguaduring its fifth mission stop of ContinuingPromise 2011 Continuing Promise is a five-month humanitarian assistance mission to theCaribbean Central and South America (USNavy photo by Mass Communication Specialist1st Class Kim WilliamsReleased)
Related ContentNo related content is currentlyavailable
Submit StoryPhotos
Tools
Privacy amp Security
External Links
To sign up for updates or toaccess your subscriberpreferences please enter youre-mail address
httpwwwnavymilmanagementphotodbphotos110618-N-EP471-301jpg[20120216 113527]
Navy Marine Corps Publish Naval Aviation Vision January 2012
httpwwwnavymilsearchdisplayaspstory_id=65360[20120216 113621]
Careers Info Index About Us Contact Us Home
gtgtgt Advanced Search US Navy Today About the Navy Navy Leadership Media Resources Links of Interest Information Index
Navy Marine Corps Publish Naval Aviation Vision January 2012 Related Content
Navy Marine Corps Publish NavalAviation Vision January 2012
Story Number NNS120215-10 Release Date 2152012 31100 PM 0 Comments Font Size A A A 0 0
From Naval Aviation Enterprise Public Affairs
PATUXENT RIVER Md (NNS) -- The Naval Aviation Enterprise announced Feb 15 the latest Naval AviationVision book is now available
US Navy and Marine Corps aviation leaders published the latest edition of the biennial aviation overviewNaval Aviation Vision January 2012 presenting a reflection of where naval aviation is today and how itwill evolve to meet shifting international responsibilities and national imperatives
The vision expressed in the book represents the collaborative views of the commander Naval Air Forcesthe deputy commandant for Aviation the commander Naval Air Systems Command the director AirWarfare Division and the director Program Integration for Information Dominance
Naval Aviation Vision January 2012 consists of three main sections entitled Naval Aviation TodayNaval Aviation Tomorrow and Making Our Vision Real The Naval Aviation Today section providesexamples of Naval Aviation in action conducting the full spectrum of operations from combat power tohumanitarian assistance The Naval Aviation Tomorrow portion of the book describes varioustransformation roadmaps that represent naval aviations recapitalization and modernization plans foraviation-centric ships manned and unmanned aircraft systems and weapons The Making Our VisionReal section includes discussions of the Air-Sea Battle concept along with science and technologystrategies for both the Navy and Marine Corps that highlight the transition from concepts to capabilities-based systems and weaponry employed by Sailors and Marines
The vision book also presents information on the Naval Aviation Enterprise partnership and itscontributions toward readiness The Naval Aviation Enterprise is a partnership to advance and sustainnaval aviation warfighting capabilities at an affordable cost today and in the future
It is comprised of more than 190000 Sailors Marines civilians and contractors that work together insupport of naval aviation Enterprise efforts provide processes and forums for various naval aviationstakeholders to collaborate break down barriers spearhead cost-effective initiatives and provideleadership with critical data to make superior decisions
For more information about the Naval Aviation Enterprise visit httpwwwcnafnavymilnae
To view Naval Aviation Vision January 2012 visithttpwwwpublicnavymilairfornaeVision20BookNaval_Aviation_Visionpdf
For additional information on the book please contact naenavymil
For more information visit wwwnavymil wwwfacebookcomusnavy or wwwtwittercomusnavy
For more news from Naval Aviation Enterprise visit wwwnavymillocalNAE
No related content is currentlyavailable
Submit StoryPhotos
Tools
Privacy amp Security
External Links
To sign up for updates or toaccess your subscriberpreferences please enter youre-mail address
All Hands Update -- Headlines for Wednesday February 15 2012
httpwwwnavymilswfmmummplyraspid=16823[20120216 113637]
All Hands Update - - Headlines for Wednesday February 15 2012
NAVSUP GLS Supports Shipmates to Workmates Program
httpwwwnavymilsearchdisplayaspstory_id=65329[20120216 113701]
Careers Info Index About Us Contact Us Home
gtgtgt Advanced Search US Navy Today About the Navy Navy Leadership Media Resources Links of Interest Information Index
NAVSUP GLS Supports Shipmates to Workmates Program Related Photos
NAVSUP GLS Supports Shipmates toWorkmates Program
Story Number NNS120214-18 Release Date 2142012 43200 PM 0 Comments Font Size A A A 0 0
By Sam Samuelson NAVSUP GLS Corporate Communications Director
SAN DIEGO (NNS) -- Naval Supply Systems Command (NAVSUP) Global Logistics Support (GLS)supported more than 300 Sailors exploring government employment during the Shipmates toWorkmates job fair at Naval Base Coronado Feb 9
The job program links Sailors most of whom are anticipating leaving the Navy due to Enlisted RetentionBoard (ERB) results with Department of Navy (DON) agencies seeking the kinds of skills and experiencesthe Sailors represent
Record-high retention and low attrition among active duty Sailors for 31 specific ratings manned at morethan 103 percent prompted the creation of the ERB The purpose of ERB is to balance the force in termsof seniority experience and skills and to improve overall advancement opportunity
Shipmates to Workmates maximizes the skills Sailors have with opportunities and needs that existthroughout the DoN Its one way the Navy is communicating to Sailors that force balancingnotwithstanding their skills are still valuable and marketable according to Joe Bernardo directorNAVSUP GLS workforce management division
There is a lot of skill talent and enthusiasm in these Sailors and we want them to know that wereinterested in exploring a future with them if we can Bernardo said
Sailors attracted by the NAVSUP GLS booth said they were eager to look into alternatives in employmentthat capitalized on the skills they learned and developed in the Navy
Im just here to see what the Navy is offering in terms of future employment said Aviation WarfareSystems Operator (Mechanical) 1st Class Josh Glennon No one likes to be told its time to go home butat least theyre offering these opportunities There has been a lot of assistance to ensure there is a safetynet
Lt Jasmine Gough sought the NAVSUP GLS booth
I just love logistics Gough said I dont know I think Im a geek for numbers supply chainmanagement
The former supply corps school student said she has always gravitated toward logistics
If you know what you like if you know your calling then thats what you look for Gough said
Thats the shared hope of coordinators of Shipmates to Workmates and the Sailors seeking employmentopportunities
Its just another way of looking for opportunities no matter what happens in life said PersonnelSpecialist 1st Class Manuel Delgado I received word from the ERB around Thanksgiving About the sametime our extended family experienced a tragedy and thats when I told myself Im young healthy andhave healthy kids I have a lot to be thankful for I already have a job opportunity so this is great
As of Jan 10 2012 2942 Sailors were in a not selected for retention status These Sailors mustseparate from the Navy no later than Sept 1 2012 unless operational waiver approved for laterseparation date (up to 90 days later)
Representatives from NAVSUP Global Logistics Support included Joe Bernardo Chachi Gorman andAnthony Goodwin From NAVSUP FLC San Diego were Linda Willis Jeffrey Allen and Margie Hontucan
Comprised of more than 5700 military and civilian logistics professionals contractors and foreignnationals NAVSUP GLS operates as a single cohesive team providing global logistics services from 110locations worldwide
A component of the Naval Supply Systems Command headquartered in Mechanicsburg Pa NAVSUP GLSis part of a worldwide network of more than 22500 military and civilian personnel providing combatcapability through logistics
For more information about transition benefits visit the Transition Assistance Web Page available underthe Hot Links section of the Navy Personnel Command at wwwnpcnavymil or contact the NPC customerservice center at CSCmailboxnavymil or 1-866-U-ASK-NPC
More information on ERB transition assistance can be found on the NPC Web page athttpwwwpublicnavymilbupers-npcboardsERBPagesTransitionInfoaspx
Visit httpswwwnavsupnavymilnavsupourteamnavsupglsnews for more NAVSUP GLS newsConnect with NAVSUP GLS on Facebook at httpwwwfacebookcomnavsupgls
For more information visit wwwnavymil wwwfacebookcomusnavy or wwwtwittercomusnavy
For more news from Naval Supply Systems Command visit wwwnavymillocalnavsup
View Larger Download HiRes View All Photos
Official US Navy file photo
Related ContentNAVSUP GLS Welcomes NewCommand Master Chief - 2132012
Transition Benefits Fleet EngagementTeam Focuses on Post-ERBAssistance - 2132012
MCPON Tours Norfolk CommandsVisits with Sailors - 2122012
Bangor Submarine Culinary SpecialistsReceive Advanced Training - 232012
SECNAV Names 2012 OutstandingFood Service Ney Award Winners - 232012
Submit StoryPhotos
Tools
Privacy amp Security
External Links
To sign up for updates or toaccess your subscriberpreferences please enter youre-mail address
NAVSUP GLS Supports Shipmates to Workmates Program
httpwwwnavymilsearchdisplayaspstory_id=65329[20120216 113701]
httpwwwnavymilmanagementphotodbphotos110831-N-NB544-106jpg[20120216 113716]
USS Mason Upgraded with New Chemical Agent Detection Capability
httpwwwnavymilsearchdisplayaspstory_id=65356[20120216 113831]
Careers Info Index About Us Contact Us Home
gtgtgt Advanced Search US Navy Today About the Navy Navy Leadership Media Resources Links of Interest Information Index
USS Mason Upgraded with New Chemical Agent Detection Capability Related Content
USS Mason Upgraded with New ChemicalAgent Detection Capability
Story Number NNS120215-06 Release Date 2152012 24800 PM 0 Comments Font Size A A A 0 0
By John J Joyce Naval Surface Warfare Center Dahlgren Public Affairs
DAHLGREN Va (NNS) -- A new automated chemical warfare agent detection capability that successfullypassed operational tests aboard USS Mason (DDG 87) will be installed on warships throughout the fleetNavy officials announced Feb 15
The Navy plans to install the new system - designed to quickly alert warfighters to the presence ofchemical warfare agents - on all active guided-missile destroyers and cruisers aircraft carriers large andsmall deck amphibious ships littoral combat ships and dry cargoammunition ships by the end of 2018
IPDS-LR (Improved Point Detection System - Lifecycle Replacement) will provide the Navy continuedchemical warfare agent detection identification and alerting along with the high system reliability theyneed to perform their mission worldwide said Bruce Corso IPDS-LR system manager office of the JointProject Manager for Nuclear Biological and Chemical Contamination Avoidance (JPM NBCCA)
This successful deployment of the IPDS-LR is a culmination of the work of some great scientists andengineers collaboration with the joint community and having waterfront locations that providecontinuous fleet interaction said Naval Surface Warfare Center Dahlgren Division (NSWCDD) ChemicalBiological and Radiological (CBR) Defense Division Head Mike Purello
Warfighters aboard Mason - the first guided-missile destroyer (DDG) protected by IPDS-LR - are nowrelying on a better performing system that features ion mobility spectrometry This chemical detectiontechnology creates ions that separate by the time it takes the ion clusters to traverse a constant electricfield drift region
I am excited to have the Improved Point Detection System - Lifecycle Replacement on board saidMason Commanding Officer Cmdr Adan Cruz after testing concluded Jan 27 As captain I hold theresponsibility for the safety of the crew and this system provides enhanced chemical warfare defense toensure our sailors will return home safely
The install went extremely well said Mason Executive Officer Cmdr Mike Briggs Having a reliablechemical detection system onboard to aid in ships defense goes towards making Mason a more effectivewarship
Teams based in Norfolk Va and San Diego Calif are prepared to install the new system on 35 ships in2012
USS William P Lawrence (DDG-110) USS Howard (DDG-83) and USS Mesa Verde (LPD-19) are the nextships on NSWCDD CBR Defense Divisions schedule for IPDS-LR installation
More DDGs will follow said NSWCDD IPDS-LR Project Lead Brian Flaherty The Sailor will see a systemthey can turn on and be confident it is protecting them It samples air from outside the ship evaluates itfor the presence of chemical warfare agents and if theres an agent present - IPDS-LR will alert them inan adequate amount of time to take precautionary measures
IPDS-LR components located on the port and starboard sides of a ship sample air through externalintakes in the hull The system analyzes the external air for chemical agents
If the detector identifies a chemical agent it sends a signal that displays an alert at both the shipsdamage control central and the bridge said Flaherty The system also interfaces directly to the shipschemical alarm which broadcasts an audible ship-wide alarm to alert the crew of a chemical warfareagent
IPDS-LRs test and evaluation involved extensive time both in the laboratory and aboard ship - withextensive time at sea as well as an independent underway evaluation by the Navys commanderoperational test and evaluation force
The new system is more maintainable and reliable said Flaherty Warfighters will see improved falsealarm performance and longer periods of time between repairs It will be easier and cheaper to repair
Based on a commercial-off-the-shelf concept a joint team of NSWCDD and JPM NBCCA engineersevaluated IPDS-LR in reliability availability and maintainability (RAM) tests emphasizing a Navyshipboard maritime environment
The team collected more than 14000 hours of underway and in-port test time supporting the RAManalysis with multiple ships - and ship classes - based in the Norfolk and San Diego areas Additional datacollection continued aboard ships in forward deployed locations
Its very rewarding to field this system to the Fleet said Flaherty noting that his team conductedIPDS-LR tests on the Navy side - shock testing vibration testing electromagnetic interference - andworked with different groups over two-and-a-half years to make sure the system is ready to field to thewarfighter
The Navys CBR Defense Division exists to provide our warfighter with the tools and capabilitiesnecessary to detect protect and if necessary decontaminate threats resulting from a CBR attack saidPurello Our direct and active connection with the fleet helps the warfighter and provides a wealth ofvaluable information for our scientists and engineers in the lab This knowledge is immediately put to useas they work to create develop and provide updates and future solutions for our men and women in
No related content is currentlyavailable
Submit StoryPhotos
Tools
Privacy amp Security
External Links
To sign up for updates or toaccess your subscriberpreferences please enter youre-mail address
USS Mason Upgraded with New Chemical Agent Detection Capability
httpwwwnavymilsearchdisplayaspstory_id=65356[20120216 113831]
uniform
A Navy leader in CBR Defense NSWC Dahlgrens CBR Defense Division provides a full complement ofcapabilities that support the naval warfighter both on land and at sea as well as the joint and HomelandDefense communities
For more information visit wwwnavymil wwwfacebookcomusnavy or wwwtwittercomusnavy
For more news from Naval Surface Warfare Center Dahlgren visit wwwnavymillocalnswcdahlgren
Africa Partnership Station 2012 begins
httpwwwnavymilsearchdisplayaspstory_id=65351[20120216 113903]
Careers Info Index About Us Contact Us Home
gtgtgt Advanced Search US Navy Today About the Navy Navy Leadership Media Resources Links of Interest Information Index
Africa Partnership Station 2012 begins Related Photos
Africa Partnership Station 2012 beginsStory Number NNS120215-01 Release Date 2152012 60700 AM 0 Comments
Font Size A A A 0 0
From Commander US Naval Forces Europe-AfricaCommander US 6th Fleet Public Affairs
NAPLES Italy (NNS) -- Sailors and coast guardsmen from several African nations are gathered in LagosNigeria to participate in the start of Africa Partnership Station 2012 (APS) Feb 14
APS is part of an ongoing international effort to assist African nations to improve maritime safety andsecurity The security cooperation initiative now in its fifth year is aimed at strengthening globalmaritime partnerships through training and collaborative activities in order to improve maritime safetyand security in Africa
This years program builds upon relationships fostered in previous years and brings together more than30 African European North and South American countries
By working together African navies and coast guards are able to bring maritime safety and securitywhich will help secure their future said Chief Warrant Officer Eve McAnallen APS training officer
USS Simpson (FFG 56) arrived in Lagos Nigeria to launch this years training program While in portSimpsons crew will work with Nigerian sailors and coast guardsmen and with crews from 11 otherAfrican nations participating in the first leg of training events
Its a great way to start APS said Cmdr Leonard Milliken Simpsons commanding officer APS is animportant mission because it helps growing navies and coast guards in Africa conduct maritimeoperations
Bringing these nations together for specifically tailored training events both ashore and at sea allowAfrican maritime nations to improve their capabilities while strengthening relationships with partnernations APS also allows African maritime nations to bolster regional maritime safety and securitythroughout the maritime environment in three specific areas counter-piracy illicit trafficking and energyand resource security
Through a regional comprehensive approach APS helps African nations build their own maritime domainawareness create maritime professionals build required maritime infrastructure and improve responsecapabilities in the maritime environment The common belief among participating nations is that APScontributes to development economic prosperity and security within Africa
I really appreciate the APS program because it helps us improve and meet our potential throughdifferent experiences said Gabonese Chief Petty Officer Pierre Mboulou I hope this program can beheld every year and keep going to help African militaries
APS brings together African partners allowing them to focus on common security challenges
By working together African navies and coast guards are able to improve maritime safety and securitywhich will help secure their future Chief Warrant Officer McAnallen said
Simpsons visit to Lagos is one example of how APS works to bring regional partners together to shareand learn specialty skills Experts will use practical classroom and sometimes real-world events to helpbuild African navies professional skill to combat crime at sea
APS is about developing African solutions to global problems and building upon long-standingrelationships African European and North and South American partners and non-governmentalorganizations share a common goal of regional prosperity stability and peace APS helps to createpartnerships among a number of organizations who have not traditionally worked with each other in thepast to achieve common goals through collaboration
Following this visit Simpson will continue APS engagements in the Gulf of Guinea Later in the year thedock landing ship USS Fort McHenry (LSD 43) and the High Speed Vessel Swift (HSV 2) will deploy insupport of APS
For more information visit wwwnavymil wwwfacebookcomusnavy or wwwtwittercomusnavy
For more news from Commander US Naval Forces Europe and AfricaUS 6th Fleet visitwwwnavymillocalnaveur
View Larger Download HiRes View All Photos
120209-N-IZ292-079 ATLANTIC OCEAN (Feb9 2012) Gas Turbine System Technician(Mechanical) 3rd Class Botha Nzinga explainsthe propulsion control console aboard theguided-missile frigate USS Simpson (FFG 56)to Gabonese Ensign Luther Mouloungui as partof Africa Partnership Station (APS) 2012 APSis an international security cooperationinitiative facilitated by Commander US NavalForces Europe-Africa aimed at strengtheningglobal maritime partnerships through trainingand collaborative activities in order to improvemaritime safety and security in Africa (USNavy photo by Mass Communication Specialist2nd Class Felicito RustiqueReleased)
Related ContentUS Navy Delegation Wraps UpMoroccan Staff Talks Visit - 262012
USS Simpson Concludes Visit toCasablanca - 232012
US 6th Fleet Commander Visits CJTF-HOA Sailors - 212012
USS Vella Gulf Concludes Port Visit toSevastopol Ukraine - 1312012
Ukrainian Sailors Tour USS Vella Gulf - 1312012
Submit StoryPhotos
Tools
Privacy amp Security
External Links
To sign up for updates or toaccess your subscriberpreferences please enter youre-mail address
httpwwwnavymilmanagementphotodbphotos120209-N-IZ292-079jpg[20120216 113919]
HSV 2 Project Handclasp On-load in GTMO
httpwwwnavymilsearchdisplayaspstory_id=65353[20120216 114006]
Careers Info Index About Us Contact Us Home
gtgtgt Advanced Search US Navy Today About the Navy Navy Leadership Media Resources Links of Interest Information Index
HSV 2 Project Handclasp On - load in GTMO Related Content
HSV 2 Project Handclasp On-load in GTMOStory Number NNS120215-03 Release Date 2152012 123700 PM 0 Comments
Font Size A A A 0 0
By Lt Matthew Comer High Speed Vessel-Southern Partnership Station Public Affairs
GUANTANAMO BAY Cuba (NNS) -- High Speed Vessel (HSV) 2 Swift arrived at Naval Station GuantanamoBay Cuba Feb 14 to prepare for the final stop of its four-month mission during HSV-SouthernPartnership Station 2012 (HSV-SPS 12)
Swift stopped in Cuba to on-load more than $4 million of Project Handclasp supplies scheduled to bedelivered in Cap-Haitien Haiti
Project Handclasp is a US Navy program that accepts and transports educational humanitarian andgoodwill materials donated by Americas private sector on a space-available basis aboard Navy ships fordistribution to foreign nation recipients
Swifts unique design allows us to transport these supplies quickly and efficiently said Cmdr GarryWright HSV-SPS 12 mission commander Project Handclasp illustrates how having great partnerships inthe Caribbean can really have an impact
While in Guantanamo Bay Swift on-loaded cargo that included more than 200 pallets of supplies Thepallets included medical supplies disinfectant an ultrasound machine books and high-calorie mealsSwift also took-on two pick-up trucks to be delivered in Haiti
The ship was designed to carry cargo very quickly from one point to another said Lt ChristopherGanske Swifts supply officer It is nice to get the opportunity to use the ship for that purpose and atthe same time have an impact on the Haitian community
The Project Handclasp off-load will compliment Seabee Marine and Naval Criminal Investigative ServiceHSV-SPS 12 missions in Haiti The Swift will be in Haiti for three weeks working with Haitian and UnitedNations personnel to exchange knowledge in the areas of security public health and construction Thestop in Haiti follows visits to the Dominican Republic Guatemala El Salvador Panama and Peru
The mission has been a great success thus far said Wright Our upcoming visit in Haiti will be thekeystone of this deployment highlighting the capabilities of the ship and its service members as well asthe partnerships we have created over the last four months
Southern Partnership Station is an annual deployment of US ships to the US Southern Command areaof responsibility in the Caribbean and Latin America The missions primary goal is information sharingwith navies militaries and civilians in the regionUS Naval Forces Southern Command and US 4th Fleet (COMUSNAVSOC4F) supports US SouthernCommand joint and combined full-spectrum military operations by providing principally sea-basedforward presence to ensure freedom of maneuver in the maritime domain to foster and sustaincooperative relationships with international partners and to fully exploit the sea as maneuver space inorder to enhance regional security and promote peace stability and prosperity in the Caribbean Centraland South American regions
For more information visit wwwpublicnavymilcomusnavso-c4f wwwfacebookcomNAVSOUS4THFLTor wwwtwittercomNAVSOUS4THFLT
For more information visit wwwnavymil wwwfacebookcomusnavy or wwwtwittercomusnavy
For more news from US Naval Forces Southern Command amp US 4th Fleet visitwwwnavymillocalcusns
HSV2 Swift Visits GTMO to LoadProject Handclasp Supplies - 2142012
HSV SPS Completes Mission in Peru - 2102012
SWIFT-SPS Veterinarians Visit PeruAnti-venom Research Facility - 1272012
Southern Partnership Station 2012Continues in Peru - 1192012
Submit StoryPhotos
Tools
Privacy amp Security
External Links
To sign up for updates or toaccess your subscriberpreferences please enter youre-mail address
NMCB 3 Relieves NMCB 5 of AFRICOM and EUCOM Seabee Operations
httpwwwnavymilsearchdisplayaspstory_id=65357[20120216 114035]
Careers Info Index About Us Contact Us Home
gtgtgt Advanced Search US Navy Today About the Navy Navy Leadership Media Resources Links of Interest Information Index
NMCB 3 Relieves NMCB 5 of AFRICOM and EUCOM Seabee Operations Related Content
NMCB 3 Relieves NMCB 5 of AFRICOM andEUCOM Seabee Operations
Story Number NNS120215-05 Release Date 2152012 24500 PM 0 Comments Font Size A A A 0 0
By Chief Mass Communication Specialist Jesse A Sherwin III Naval Mobile ConstructionBattalion 3 Public Affairs
CAMP MITCHELL Spain (NNS) -- Seabees from Naval Mobile Construction Battalion (NMCB) 3 relievedNMCB 5 of all Seabee construction responsibilities in Europe and Africa during a formal ceremony Feb14
The relief in place and transfer of authority ceremony (RIPTOA) marked the official end of NMCB 5sdeployment to Europe and Africa that started in August when they deployed from Port Hueneme Calif
Before the RIPTOA could occur a weeklong inspection and review was conducted of all equipmentsupplies projects facilities and civil engineering support equipment (CESE)
Unlike a ship when a Seabee battalion deploys they do not travel with their equipment Instead all ofthe construction equipment and supplies that they will use are already at their deployment sites Adetailed turnover must be conducted before the oncoming battalion commences work
The equipment and supplies that the battalion uses is called a table of allowance (TOA) For an NMCB theentire TOA which is worth more than $70 million is designed to support operations and sustainment of a600 Seabee battalion conducting forward contingency and humanitarian assistance operations anywherein the world said Chief Logistics Specialist Frankie Acevedo the NMCB 3 supply chief
If any tools parts or other supplies are found to be missing during the inspection they need to be onorder or placed on order said Acevedo We have to maintain the TOA at 100 percent readiness
The CESE undergoes a more thorough inspection in a process called the Battalion Equipment EvaluationProgram (BEEP) The BEEP inspection is designed to transfer all special knowledge of CESE maintenanceoperations and techniques to the relieving battalion During the BEEP inspection NMCB 3 Alfa Companyconsisting of construction mechanics and equipment operators inspected and received custody of morethan 200 units of CESE When the inspection was complete a red diamond shaped sticker with a whitenumber three called a BEEP sticker was placed on each piece of CESE
The BEEP sticker identifies what type and what specific Seabee unit the CESE belongs to saidConstruction Mechanic 1st Class James Gongas from NMCB 5
A red diamond identifies the CESE as belonging to an NMCB A triangle will identify it as belonging to anaval construction regiment and a square is an underwater construction team
Along with the equipment and supply turnover NMCB 3 relieved NMCB 5 of construction projectresponsibilities throughout Europe and Africa
Some of the ongoing projects include building a school and a bathroom facility for the locals in GendeGerade Ethiopia drilling seven water wells in Ethiopia and building two health clinics in Djibouti Africa
As NMCB 3 completes projects they will begin new ones including placing a water line with the help oflocal military engineers for Zagreb Croatia and extending an existing runway in Manda Bay for thegovernment of Kenya
Now that the turnover is complete NMCB 5 will return to Port Hueneme Calif
NMCB 3 is an expeditionary naval construction element currently assigned to US 6th Fleets CommanderTask Force 68 to provide construction engineering and security services that support national strategynaval power projection humanitarian assistance and contingency operations
For more information visit wwwnavymil wwwfacebookcomusnavy or wwwtwittercomusnavy
For more news from Naval Mobile Construction Battalion 3 visit wwwnavymillocalnmcb3
No related content is currentlyavailable
Submit StoryPhotos
Tools
Privacy amp Security
External Links
To sign up for updates or toaccess your subscriberpreferences please enter youre-mail address
All Hands Update -- USS Port Royal Returns From Deployment
httpwwwnavymilswfmmummplyraspid=16824[20120216 114047]
All Hands Update - - USS Port Royal Returns From Deployment
ONR Works to Build a Diverse Future Force Through Outreach
httpwwwnavymilsearchdisplayaspstory_id=65352[20120216 114217]
Careers Info Index About Us Contact Us Home
gtgtgt Advanced Search US Navy Today About the Navy Navy Leadership Media Resources Links of Interest Information Index
ONR Works to Build a Diverse Future Force Through Outreach Related Content
ONR Works to Build a Diverse FutureForce Through Outreach
Story Number NNS120215-09 Release Date 2152012 25300 PM 0 Comments Font Size A A A 0 0
By Katherine H Crawford Office of Naval Research
ARLINGTON Va (NNS) -- Office of Naval Research (ONR) personnel will be in Philadelphia Feb 17-18providing information to approximately 10000 students and professionals attending the annual BlackEngineer of the Year (BEYA) conference
BEYA is an opportunity for ONR to interact with a diverse group of young engineers who may contributeto some of our future work force needs said Dr Anthony Junior director Department of the Navy (DoN)Historically Black Colleges and UniversitiesMinority Institutions Program office
Attracting a wide assortment of top employees-particularly for Science Technology Engineering and Math(STEM) fields-is a DON priority It is also a key component of the secretary of the Navys STEM roadmapwhich aims to expand nationwide efforts to increase student and teacher participation in science andtechnology-related fields as well as bolster interest from underserved populations The ultimate goal is toincrease the number of students pursing STEM studies and careers to support both the DON and thenation
ONR subject-matter experts will be in booth No 515 speaking to attendees about the commandsinternship research and career opportunities Exhibit hours are 9 am- 4 pm Feb 17 and 10 am- 4pm Feb 18
Formally called the 26th BEYA STEM Global Competitiveness Conference the event will also featureopportunities for students including a career fair and job search resources as well as for professionalsincluding training networking role models mentors and awards Attendees include collegerepresentatives thousands of elite professionals and students from across the country who are interestedor involved in STEM disciplines and careers
The event also includes seminars workshops presentations and a Stars amp Stripes dinner honoring activeand retired African-American high-ranking military personnel and members of the Senior ExecutiveService
ONR provides the science and technology necessary to maintain the Navy and Marine Corps technologicaladvantage Through its affiliates ONR is a leader in science and technology with engagement in 50states 30 countries 1035 institutions of higher learning and more than 900 industry partners ONRemploys approximately 1065 people comprising uniformed civilian and contract personnel withadditional employees at the Naval Research Lab in Washington DC
For more information visit wwwnavymil wwwfacebookcomusnavy or wwwtwittercomusnavy
For more news from Office of Naval Research visit wwwnavymillocalonr
No related content is currentlyavailable
Submit StoryPhotos
Tools
Privacy amp Security
External Links
To sign up for updates or toaccess your subscriberpreferences please enter youre-mail address
Navy Warfare Development Command Announces Speakers for Innovation Symposium
httpwwwnavymilsearchdisplayaspstory_id=65355[20120216 114242]
Careers Info Index About Us Contact Us Home
gtgtgt Advanced Search US Navy Today About the Navy Navy Leadership Media Resources Links of Interest Information Index
Navy Warfare Development Command Announces Speakers for Innovation Symposium Related Content
Navy Warfare Development CommandAnnounces Speakers for InnovationSymposium
Story Number NNS120215-08 Release Date 2152012 25200 PM 0 Comments Font Size A A A 0 0
From Navy Warfare Development Command Public Affairs
NORFOLK Va (NNS) -- Navy Warfare Development Commands (NWDC) Innovation Series 2012 willkick off this years campaign with a Maritime Innovation Symposium scheduled for March 13-14 atNWDC on Naval Station Norfolk
Under the theme Regaining the Innovation AdvantageAwakening Our Creative DNA the symposiumwill feature speakers from military academia and industry to exchange ideas identify opportunities andchallenges propose ways to move maritime innovation forward and educate and elevate awareness ofinnovation across the Fleet
Adm John C Harvey Jr commander US Fleet Forces will kick off the event Rear Adm Terry B Kraftcommander Navy Warfare Development Command will also provide remarks and serve as host
Featured speakers will include Dr Williamson Murray author of Military Innovations in the Interwar Period will set the stage duringan opening session on Historical Perspectives on Navy Innovation
Robert Rubel dean of the Center for Naval Warfare Studies at the Naval War College will talk aboutthe Sociology of Innovation in the Navy
Dennis Bushnell chief scientist at NASA Langley Research Center will discuss Innovation Barriers andOpportunities
Art Corbet director Marine amp Naval Concepts will bring a Marine perspective through The Benefits ofMission Command
Vice Adm Robert Parker Commander Coast Guard Atlantic Area will provide a Coast Guardperspective
Dr Lawrence Schuette director of Innovation at the Office of Naval Research will present Increasingthe Navys Capacity for Innovation
Peter Wilson senior defense research analyst for RAND Corporation will talk about Relationships ofMilitary Innovation across Four Generations of Warfare
John Kao chairman of the Institute for Large Scale Innovation will give his insights on HarnessingInnovative Practices
Professor Don Chisholm of the Joint Military Operations Department at the Naval War College will wrap-up the conference with a discussion on Setting the Conditions for an Innovative Culture
Our Navy has a unique history of creativity and adaptability The challenge now in a changing worldwith budget challenges is to regain our innovation advantage Kraft said That is the focus of thesymposium and our overall Innovation Series 2012 campaign to awaken our culture of innovation indirect support of the warfighter
Individuals who would like to attend the event can find registration and other logistical information at on NWDCs CAC-enabled portal at httpsportalnwdcnavymilcftISdefaultaspx
For more information visit wwwnavymil wwwfacebookcomusnavy or wwwtwittercomusnavy
For more news from Navy Warfare Development Command visit wwwnavymillocalnwdc
No related content is currentlyavailable
Submit StoryPhotos
Tools
Privacy amp Security
External Links
To sign up for updates or toaccess your subscriberpreferences please enter youre-mail address
Making Your Move Easier
httpwwwnavymilsearchdisplayaspstory_id=65348[20120216 114324]
Careers Info Index About Us Contact Us Home
gtgtgt Advanced Search US Navy Today About the Navy Navy Leadership Media Resources Links of Interest Information Index
Making Your Move Easier Related Content
Making Your Move EasierStory Number NNS120214-21 Release Date 2142012 95100 PM 0 Comments
Font Size A A A 0 0
By Pat ldquoTinyrdquo Del Grosso NAVSUP Fleet Logistics Center Puget Sound Director CorporateCommunications
WASHINGTON (NNS) -- The Personal Property Office at NAVSUP Fleet Logistics Center (FLC) Puget Soundstood up operation of new Defense Personal Property System (DPS) kiosks Feb 13
The DPS kiosks located at Building 985 consist of two computer workstations where active dutymembers civilian government employees and their spouses can access movemil which is a portal intoDPS
DPS is a web-based tool customers use to schedule and manage their household goods moves
While DPS and Movemil are accessible from any computer that connects to the internet manycustomers new to the DPS system often experience difficulties navigating the site The kiosks provide anopportunity for customers who are having issues with one or two portions of the application at home tocome into the office and receive assistance said Andrea Gergen NAVSUP FLC Puget Sound householdgoods regional manager
To access DPS service members and civilians must first establish an account and a password by clickingon DPS Registration on the Movemil homepage DPS offers the registered personnel 24-hour access totheir moving arrangements It also provides the ability to track shipments from anywhere anytime
The goal of the Personal Property Office at Bremerton is to provide on-the-spot help to customers so theycan submit their application and be on their way Customers will like the convenience of being able to fillout their paperwork online After completing as much of their application as they can at homecustomers can come into the office and pull up their online application on the kiosk At that point we canprovide immediate help said Gergen
For more information visit wwwnavymil wwwfacebookcomusnavy or wwwtwittercomusnavy
For more news from Naval Supply Systems Command visit wwwnavymillocalnavsup
No related content is currentlyavailable
Submit StoryPhotos
Tools
Privacy amp Security
External Links
To sign up for updates or toaccess your subscriberpreferences please enter youre-mail address
All Hands Update -- Sasebo Holds Command Financial Specialist Training
httpwwwnavymilswfmmummplyraspid=16825[20120216 114341]
All Hands Update - - Sasebo Holds Command Financial Specialist Training
All Hands Update -- Montel Williams Cooks for Wounded Warriors
httpwwwnavymilswfmmummplyraspid=16822[20120216 114353]
All Hands Update - - Montel Williams Cooks for Wounded Warriors
Montel Williams Provides Lunch for Wounded Warriors
httpwwwnavymilsearchdisplayaspstory_id=65345[20120216 114415]
Careers Info Index About Us Contact Us Home
gtgtgt Advanced Search US Navy Today About the Navy Navy Leadership Media Resources Links of Interest Information Index
Montel Williams Provides Lunch for Wounded Warriors Related Photos
Montel Williams Provides Lunch forWounded Warriors
Story Number NNS120214-19 Release Date 2142012 94300 PM 0 Comments Font Size A A A 1 0
By Mass Communication Specialist 1st Class (SWAW) Monique K Hilley
BETHESDA Md (NNS) -- Montel Williams provided lunch for nearly 100 wounded warriors and theirfamilies at the Fisher House in Bethesda Md Feb 13
Service members and their families were treated to a feast of donated baby back ribs pulled pork andcoleslaw fried fish cooked by Montels sister Marjorie crab cakes made by his father Herman a saladand turkey chili prepared by one of Montels favorite chefs Claire Winslow and green fruit smoothieswhich Montel prepared himself Two large patriotic cakes were also donated for dessert
This started six trips ago and now this is trip number seven and by the time we get done well be attrip number 70 or 80 because Im going to continue to do this I think its just a way for us to give backsaid Williams Why am I doing this Because I want to stop people from just paying lip service to Isupport the troops and understand there is something you can do personally to put a smile on a soldiersface
The luncheon marked the Williams familys seventh trip to provide lunch at Fisher House for woundedwarriors their family members and the guards on the base
These family members come down here and they do what we dont do for those who allow us to live withthe dignity we do and the freedom we do said Williams These family members dont ask for anythingthey barely even ask for help they dont even know about Fisher House Most of the time Fisher Househas to reach out to them and say look I have a place for you to stay
Fisher House has provided help on average for 17000 families a year across the nation at 56 FisherHouses located nationwide The houses are located near Veterans Affairs (VA) hospitals and at all majormilitary medical facilities The Fisher House in Bethesda has five houses with 72 rooms total
We are opening number 57 at Joint Base Elmendorf-Richardson near Anchorage Alaska on Friday [Feb17] one at the end of the month in Salt Lake City at the VA and one at Ft Belvoir on the 22nd of Maysaid Cindy Campbell Fisher House Foundation Inc vice president for Community Relations and MediaAffairs
So were expanding a great deal Were also building a Fisher House in Birmingham England to supportBritish wounded warriors at their hospital Its our chance to reach out to our allies and thank them fortheir service as Americans and to give back to the British soldiers who have served us so well
Fisher Houses are free of charge for all family members and caregivers to the wounded warriors not justspouses parents or siblings Family members can stay for any length of time needed whether that is fora week six months or a year Cindy and all members of the Fisher House Foundation of which MontelWilliams is a trustee are grateful to have him talking about Fisher House and providing lunches for thefamilies
This is a chance for us at Fisher House to thank the families for what theyre doing because we all forgetthat when the military member is wounded we only tend to think about the price of that injury that hasto do with the recovery of the wounded said Campbell The other price is the family because you havethe entire family that has now taken on this injury Theyre the ones who have to get him through this
One of the families Fisher House is helping is Deborah Elliott and her husband Marine Capt TommyElliott an aviation supply officer assigned to Cherry Point NC who was recently diagnosed with Crohnsdisease The Elliotts who are expecting their son Oliver to be delivered at Bethesda within the next 10days have been at Fisher House since Dec 31 2011 when Capt Elliott was admitted to the hospital
He was in the hospital for two weeks inpatient care and hes getting outpatient care so weve been herefor six weeks said Debbie Elliott For the treatment they have my husband on theyre still trying towork everything out because its such a severe disease He has to be near the hospital because hes oncomplete digestive rest so he cant eat at all and is on a feeding tube and nutrition bag They said nofood for another two to three weeks but the doctors suggest we are in this area for another six months
For the Elliotts charities such as Fisher House can become a long-term solution to what may have quicklybecome a financial crisis brought on by severe health issues and the expenses that can rack up duringthose times
It has been wonderful that we are here and weve been provided with a place to stay said DebbieElliott Its really nice to have this facility on base close to the hospital where we can come and go aswe need to his appointments Its nice knowing that hes getting treatment and Ill be getting treatmenthere shortly for the birth of our son
Montel Williams providing lunch at Fisher House took some guests by surprise Montel arrived at nineam to begin preparing and cooking the food with lunch beginning at noon
I didnt expect to wake up and go down to get some breakfast and Montel Williams is in there gettingready for lunch said Debbie Elliott Its just wonderful that he is here and that he supports FisherHouse Hes got his own history with the military so hes very connected to this place
During the lunch he chatted with many of the families and let them know how much he appreciatedthem As a former enlisted Marine and graduate of the US Naval Academy with 22 years of serviceMontel has a connection to those who are currently serving in the military
View Larger Download HiRes View All Photos
120213-N-RL694-001 Bethesda Md (Feb 132012) Montel Williams a former enlistedMarine and graduate of the US NavalAcademy serves military members during aluncheon he held for 100 wounded warriorsand their families at Fisher House (US Navyphoto by Mass Communication SpecialistMonique HilleyReleased)
Related ContentNo related content is currentlyavailable
Submit StoryPhotos
Tools
Privacy amp Security
External Links
To sign up for updates or toaccess your subscriberpreferences please enter youre-mail address
Montel Williams Provides Lunch for Wounded Warriors
httpwwwnavymilsearchdisplayaspstory_id=65345[20120216 114415]
I spent every single day I could trying my best at the time I was on active duty thinking that I was inevery hot spot we had said Williams I have a very strong bond with the guys who still are willing tonot have to do so because they were forced by draft they step up to the plate and volunteer to continueto support and defend my democracy I mean come on what else am I supposed to be doing then whatIm doing here
Over the course of the last three years Williams has been visiting the wounded warriors in Bethesda Mdalmost every month
I go and I see them and after about a year I didnt even know Fisher House existed said Williams Iwas introduced to one of the board members of Fisher House and was shocked that this is anorganization that number one doesnt have as much media attention as it should because these guysare in my opinion the No 1 wounded warrior charity in the country They are providing free living spacefor family members while their loved ones recover in the hospital here and in the course of about nineyears now theyve given over 180 million dollars in services just to our fallen Soldiers
Montel Williams a former talk show host who has prided himself in leading his life in a way that mayserve as an example to others continues to do that through his work with the Fisher House Foundation
I think its just as important to give lip service to it as it is to give heart to it to give your personal timeto it said Williams I can sit on television and say you need to do this but unless I bring myself downhere and try to show by example and do it again and again and again and again I dont think it makessense to people Then once they start to see stuff like this maybe theyll start to realize that what did Ido last week to say thank you for being free
For more news from Commander Navy Installations Command visit wwwnavymillocalcni
httpwwwnavymilmanagementphotodbphotos120213-N-RL694-001jpg[20120216 114456]
All Hands Update -- Students Get Head Start on Jobs on Naval Base Guam
httpwwwnavymilswfmmummplyraspid=16826[20120216 114614]
All Hands Update - - Students Get Head Start on Jobs on Naval Base Guam
Current All Hands Update
httpwwwnavymilsearchdisplayaspstory_id=65359[20120216 114656]
Careers Info Index About Us Contact Us Home
gtgtgt Advanced Search US Navy Today About the Navy Navy Leadership Media Resources Links of Interest Information Index
Current All Hands Update Related Content
Current All Hands UpdateStory Number NNS120215-11 Release Date 2152012 31200 PM 0 Comments
Font Size A A A 0 0
From Defense Media Activity - Navy
WASHINGTON (NNS) -- All Hands Update features five newscasts today - one two-minute newscast andfour one-minute newscasts
Two-minute newscast-- Montel Williams Cooks for Wounded Warriorshttpwwwnavymilswfmmummplyraspid=16822 httpyoutubewUMhms4tb1Q
First one-minute newscast-- Headlines for Wednesday February 15 2012 Continuation Board Results Released on BUPERS OnlineHSV Swift 2 Participates in Project Handclasphttpwwwnavymilswfmmummplyraspid=16823 httpyoutubel2-RbH6W7mM
Second one-minute newscast-- USS Port Royal Returns From Deploymenthttpwwwnavymilswfmmummplyraspid=16824 httpyoutubedp1YLuWhXFI
Third one-minute newscast-- Sasebo Holds Command Financial Specialist Traininghttpwwwnavymilswfmmummplyraspid=16825 httpyoutubePyFD31bOtuw
Fourth one-minute newscast--Students Get Head Start on Jobs on Naval Base Guamhttpwwwnavymilswfmmummplyraspid=16826 httpyoutube_ySktc48LnA
Defense Media Activity-Navy produces four All Hands Update (AHU) newscasts each day - one two-minutenewscast and three one-minute newscasts AHU can be seen throughout the day and evening on theDirect-to-Sailor (DTS) satellite television service available aboard 160 ships of the fleet and via the NavyWeb site at wwwnavymil Check your local DTS program schedule for air times AHU can also be seenthroughout the world on the American Forces Radio and Television Service
Video Headlines for Wednesday February15 2012
Submit StoryPhotos
Tools
Privacy amp Security
External Links
To sign up for updates or toaccess your subscriberpreferences please enter youre-mail address
This Day in Naval History - Feb 15
httpwwwnavymilsearchdisplayaspstory_id=355[20120216 114722]
Careers Info Index About Us Contact Us Home
gtgtgt Advanced Search US Navy Today About the Navy Navy Leadership Media Resources Links of Interest Information Index
This Day in Naval History - Feb 15 Related Content
This Day in Naval History - Feb 15Story Number NNS011213-26 Release Date 12132001 92800 PM 0 Comments
Font Size A A A 0 0
From the Navy News Service
1856 - USS Supply commanded by Lt David Dixon Porter sails from Smyrna Syria bound forIndianola Texas with a load of 21 camels intended for experimental use in the American desert west ofthe Rockies1898 - The battleship USS Maine mysteriously blows up in Havana Harbor in Cuba killing more than260 Sailors and Marines while injuring scores more The tragedy sparks the Spanish-American War
For more information about naval history visit the Naval Historical Center Web site atwwwhistorynavymil
No related content is currentlyavailable
Submit StoryPhotos
Tools
Privacy amp Security
External Links
To sign up for updates or toaccess your subscriberpreferences please enter youre-mail address
All Hands Radio News
httpwwwnavymilnavydataradioPlayaspid=5560[20120216 114758]
All Hands Radio News
null
2012
12003655
Navy News Service - Eye on the Fleet
httpwwwnavymillist_singleaspid=115665[20120216 114827]
Careers Info Index About Us Contact Us Home
gtgtgt Advanced Search US Navy Today About the Navy Navy Leadership Media Resources Links of Interest Information Index
Navy News Service
Current Collection Total Images 1
Thumbnail Description Options
120214-N-OY799-660 PACIFIC OCEAN (Feb 14 2012)Ships from the John C Stennis Carrier Strike Group transitthe Pacific Ocean during a photo exercise The John CStennis Strike Group is operating in the US 3rd Fleet areaof operations while on a seven-month deployment (USNavy photo by Mass Communication Specialist 3rd ClassKenneth AbbateReleased)
View
Download HiRes
SearchPhotos
All
Any
Exact
Eye on the Fleet
Featured Galleries
Submit Photo
Contact Us
Privacy amp Security
About This Site
Home
httpwwwnavymilmanagementphotodbphotos120214-N-OY799-660jpg[20120216 114839]
Navymil the Official Web Site of the United States Navy
httpwwwnavymil[20120216 114913]
Careers Info Index About Us Contact Us Home
gtgtgt Advanced Search US Navy Today About the Navy Navy Leadership Media Resources Links of Interest Information Index
Top Stories Get email updates
Navy Names Five New Ships
Secretary of the Navy Ray Mabus announced Feb 15the next five Navy ships three Arleigh Burke-classguided-missile destroyers USS John Finn USSRalph Johnson and USS Rafael Peralta and twolittoral combat ships (LCS) USS Sioux City and USSOmaha
gtgt MORE
RELATED MEDIA RELATED STORIES
View stories posted in the last days
Limit search to Breaking News and Top Stories Only
Get email updates
Navy Names Five New ShipsNavy Releases FY-12 Continuation Board Results to SailorsTransition Benefits NPC Officials to Discuss Post-ERB Matters in the PacificNorthwestFY-12 Aviation Officer Bonus Rates Released 1DoD Fiscal 2013 Budget Proposal ReleasedNavy Names Littoral Combat Ship Gabrielle Giffords 30Chafee and Tortuga Support 31st MEU at Cobra Gold 2012
ONR Works to Build a Diverse Future Force Through Outreach
Navy Warfare Development Command Announces Speakers for InnovationSymposium
Navy Marine Corps Publish Naval Aviation Vision January 2012
USS Mason Upgraded with New Chemical Agent Detection Capability
ONR Global Taking Off for Singapore Air Show 2012
USNS Comfort to Move to Naval Station Norfolk
Africa Partnership Station 2012 begins
NMCB 3 Relieves NMCB 5 of AFRICOM and EUCOM Seabee Operations
HSV 2 Project Handclasp On-load in GTMO