52
FREE HEALTHY LIVING HEALTHY PLANET feel good • live simply • laugh more RETHINKING RECOVERY Holistic Ways to Heal Addictions Manly Foods Foods that Boost and Balance Testosterone NATURAL DADS How They Raise Conscious Kids June 2015 | Pensacola | NWFNaturally.com Escambia/Santa Rosa County GUTSY US How Our Stomach Dictates Our Mind and Moods Yoga for the Bros Men Find Yoga Builds Fitness

Natural Awakenings Pensacola June 2015

Embed Size (px)

DESCRIPTION

Our story “Rethinking Recovery” opens our minds to a holistic approach to healing addiction with variety of complementary healing tools to treat the mental, physical and spiritual disease. Rebecca Thomas and Gerald Perillo III recently opened Discovering the Solution, a holistic outpatient recovery center in Fort Walton Beach, with a positive philosophy that begins by looking for whatever brought the individual to this point in their life. Read more about their program in our Community Spotlight this month.

Citation preview

Page 1: Natural Awakenings Pensacola June 2015

1 Natural Awakenings of Northwest Florida www.NWFNaturally.com

FREE

H E A L T H Y L I V I N G H E A L T H Y P L A N E T

feel good • live simply • laugh more

RETHINKING RECOVERYHolistic Ways to Heal Addictions

Manly FoodsFoods that Boost and Balance Testosterone

NATURALDADS

How They Raise Conscious Kids

June 2015 | Pensacola | NWFNaturally.com Escambia/Santa Rosa County

GUTSY USHow Our Stomach Dictates Our Mind and Moods

Yoga for the Bros

Men Find Yoga Builds Fitness

Page 2: Natural Awakenings Pensacola June 2015

2 Natural Awakenings of Northwest Florida www.NWFNaturally.com

Learn more at EvergladesUniversity.edu

Ranked in the Top 30 Best Online CollegesTheBestSchools.org

Online Division855.723.9087

Bachelor’s Degree

ALTERNATIVE MEDICINE

The Herbal Medicine

Chest

TraditionalChineseMedicine

Nutrition& Aging

Herbology& Botany

“The tools I’ve learned gave me confidence and helped

me grow as a person and public figure.”

Laurianne Uhrich-Macdonald2014 Graduate

“Every professor was passionate about seeing me succeed. No matter what obstacle appeared, they were

always willing to help me.”Patricia C. Armour

2013 Graduate

“Today I am more confident than ever. Thank you, Everglades University,

for a great experience.”Edith Kaplan2013 Graduate

Page 3: Natural Awakenings Pensacola June 2015

3natural awakenings June 2015

850.797.4754 • www.eastofedenretreatandspa .com234 Dog Hobble Lane • Santa Rosa Beach , FL 32459

Our Treatments massages • facials • body treatments

hair services • yoga • acupuncturenaturopathy • emotional healing

dermal fi llers & botox injectiblesanti-aging laser treatments

Amenitieseducational workshops • vacation rentalsjuicing & fasting detox • wet steam room

traditional fi nnish sauna • aquatic therapyaroma & croma therapy

Experience...the return of your inner and outer

beauty in this peaceful oasis, hidden among the ancient oaks of historic Point Washington, Florida.

Our Treatments

Page 4: Natural Awakenings Pensacola June 2015

4 Natural Awakenings of Northwest Florida www.NWFNaturally.com

850-586-78181013 Mar Walt Drive • Suite C Close to Ft Walton Beach Hospital

Out Patient Services Only • Habla EspañolWe work with all major insurance providers such as

Cigna,Aetna,United Health Care,BCBS, Humana and more.

DiscoveringTheSolution.com

EVERYONEis unique and so are the answers!

Discovering The Solution helps you fi nd YOUR answers,

HOLISTICALLY!Comprehensive holistic and integrative care is the DTS

model for success and is based on individual treatment goals.

What brought you to this point is unique to you and not the same for everyone. Let’s fi nd the root cause

and heal from the inside

SERVICES OFFERED• Day or Night Substance Abuse Treatment• Recovery Coaching• Physician Services• Animal/Pet Therapy• Trauma Therapy• PTSD• Anger Management• Massage/Bodywork• Yoga/Meditation• Art Therapy• Recovery Coaching• Nutrition Education• The Nurturing Parenting Program • Family and Codependent Counseling

For more detailed info on the above services please see our web site.

CALL TODAYyour path

to wellness isshorter thanyou think!

Page 5: Natural Awakenings Pensacola June 2015

5natural awakenings June 2015

Save The Planet

(850) 439-0035Serving all of Northwest Florida

Since 1989

A non-credit score based program for

property owners that provides up to

100% of the project financing and is

repaid through the property taxes.

FREEESTIMATES

A PACE qualified Contractor

&Residential and Commercial Systems

• Solar Electric (Photovoltaics)• Solar Water Heating• Solar Pool Heating

Increase the value of your home and save thousands of dollars

each year on energy bills.

&&&&&Moneyat the

same time

CHECK OUT WWW.COMPASSSOLAR.COM FOR MORE GREAT INFORMATION!

Florida Certified Solar ContractorCVC 56688/56700

Federal and Private financing options

PLUS a 30% Federal tax credit

is still available

Page 6: Natural Awakenings Pensacola June 2015

6 Natural Awakenings of Northwest Florida www.NWFNaturally.com

contentsNatural Awakenings is your guide to a healthier, more balanced life. In each issue readers find cutting-edge information on natural health, nutrition, fitness, personal growth, green living, creative expression and the products and services that support a healthy lifestyle.

18 PEACEFUL PROTECTION Sensei John D. Lee Teaches Confidence,CourageandCalmness by Daralyn Chase

20 POSITIVE CARE ANewSubstanceAbuseCenter RevealstheSolutionstoRecovery by Karen Roganov

22 RETHINKING RECOVERY HolisticApproaches toHealingAddictions by Lisa Marshall

28 DON’T GET TICKED OFF NaturalWaystoAvoid andTreatLymeDisease by Linda Sechrist

30 NATURAL DADS HowTheyRaiseConsciousKids by Lane Vail

32 YOGA FOR THE BROS Men Find it Builds All-Around Fitness by Meredith Montgomery

34 THE TEENY-TINY VACATION OPTION Mini-DwellingsMake TravelaLark by Avery Mack

36 WALKING THE CAT HarnessaCuriousCat foraLivelyStroll by Sandra Murphy

38 MANLY FOODS BoostTestosterone withtheRightChoices by Kathleen Barnes

22

30

34

36

BEE-FRIENDLY PRODUCTS

NO MORE!

Satisfaction Guaranteed

or 110% Money Back

Now Available in Northwest Florida

Call today for your FREEestimate and consulation!

850-382-3820BestPestChoice.com

Residential & Commercial Applications

“Earth’s Choice is Your Best Choice”

Van MacSolutions Specialist

EARTH’S CHOICE PEST SOLUTIONS

• Concerns about Children and Pets

• Dangerous Chemicals

• Food Contamination and Overspray

• Dousing of Baseboards with Deadly Chemicals

• And Most of all...No More Bugs!

Services Offered:Termite Elimination • Mosquito Management

Fire Ant Control • Bed Bug Elimination • Gutter Cleaning

FREEMOSQUITO CONTROL

WITH ANYNEW SERVICE

Page 7: Natural Awakenings Pensacola June 2015

7natural awakenings June 2015

58HOW TO ADVERTISE Pricing is available online on our Advertising page. To advertise with Natural Awakenings call 850-687-0825 or email [email protected]. Deadline for ads: the 15th of the month.

EDITORIAL SUBMISSIONSEmail articles, news items and ideas to: [email protected]. Deadline for editorial: the 15th of the month.

CALENDAR SUBMISSIONSSubmit calendar entries online only at NWFNaturally.com. The links are on the left side of the web page. Deadline for calendar: the 15th of the month.

REGIONAL MARKETSAdvertise your products or services in multiple markets! Natural Awakenings Publishing Corp. is a growing franchised family of locally owned magazines serving communities since 1994. To place your ad in other markets call 239-449-8309. For franchising opportunities call 239-530-1377 or visit NaturalAwakeningsMag.com.

NWFNaturally.com

advertising & submissions

contents 10 newsbriefs

12 healthbriefs

14 globalbriefs

16 ecotip

20 community spotlight

27 inspiration

28 healingways

30 healthykids

32 fitbody

34 greenliving

36 naturalpet

38 consciouseating

40 wisewords

42 calendar

46 classifieds

46 resourceguide

14

16

12

Page 8: Natural Awakenings Pensacola June 2015

8 Natural Awakenings of Northwest Florida www.NWFNaturally.com

1 Natural Awakenings of Northwest Florida www.NWFNaturally.com

Natural LivingDirectory 2015

Emerald CoastOkaloosa/Walton County

NWFNaturally.com

H E A L T H Y L I V I N G H E A L T H Y P L A N E T

feel good • live simply • laugh more

Daralyn and Scott Chase

© 2015 by Natural Awakenings. All rights reserved. Although some parts of this publication may be reproduced and reprinted, we require that prior permission be obtained in writing.

Natural Awakenings is a free publication distrib-uted locally and is supported by our advertis-ers. It is available in selected stores, health and education centers, healing centers, public libraries and wherever free publications are generally seen. Please call to find a location near you or if you would like copies placed at your business.

We do not necessarily endorse the views expressed in the articles and advertisements, nor are we re-sponsible for the products and services advertised. We welcome your ideas, articles and feedback.

SUBSCRIPTIONSSubscriptions are available

by sending $36 (for 12 issues) to the above address or

order online at NWFNaturally.com.

Natural Awakenings is printed on recycled newsprint with soy- based ink.

contact usPUBLISHER

Daralyn Chase [email protected]

CO-PUBLISHER/ DIRECTOR OF ADVERTISING

Scott Chase, (ext. 702) [email protected]

EDITOR Martin Miron

GRAPHICS & LAYOUTCourtney Ayers

Michele Rose

CALENDAR EDITORThomas Masloski

NATIONAL AD SALES 239-449-8309

FRANCHISE SALES 239-530-1377

NATURAL AWAKENINGSEMERALD COAST850-460-3266, office

888-228-8238, toll free 888-370-0618, fax

P.O. Box 945Destin, Florida 32540

&

letterfrompublisher

I once had a psychology professor walk around the class-room holding up a glass full of water. When he finally addressed the class, I was expecting him to ask the typical

question, “Is the glass half empty or glass half full?” Instead, the professor asked, “How heavy is this glass of water I’m holding?” After many guesses, he replied, “Actually, the weight of this glass doesn’t matter, how long I hold it deter-mines how heavy it is. If just for a minute or two, or even an hour, it’s manageable. But after several hour or days, it would become uncomfortable and begin to hurt. IwasremindedofthisbyHypnotherapistMaiaRizziasshedescribedthemanyhurtsandpainfulexperiencesweholdontocon-sciouslyandsubconsciously.OverthepastsixmonthsIhaveindulgedinweeklyhypnotherapysessionsthathaveledtosmall,butamazingchanges.Inourattempttodealwithemotionalorphysicalpain,aswellasstressesandworries,wedon’talwaysmakethemosteffectivechoices. Whileasubstanceaddiction(anythingfromalcoholtofood)mightnotbepartofyourexperience,someotheraddictionmightbe,suchasanger,attention,victimhoodorguilt.Everysingleoneofushasdevelopedpatternsinourlivestoavoidhurtandsootheourselves. Thismonth’sfocusonaddictionremindsusofthemanychoiceswedohave.AsLouiseHayexpressessowell,“Noperson,noplaceandnothinghasanypoweroverus,for‘we’aretheonlythinkersinourmind.Whenwecreatepeace,harmonyandbalanceinourminds,wewillfinditinourlives.” Ourstory“RethinkingRecovery”opensourmindstoaholisticapproachtohealingaddictionwithvarietyofcomplementaryhealingtoolstotreatthemen-tal,physicalandspiritualdisease.RebeccaThomasandGeraldPerilloIIIrecentlyopenedDiscoveringtheSolution,aholisticoutpatientrecoverycenterinFortWaltonBeach,withapositivephilosophythatbeginsbylookingforwhateverbroughttheindividualtothispointintheirlife.ReadmoreabouttheirprograminourCommunitySpotlightthismonth. Movingyourlifeforward,nomatterwhat,takestremendouscourage,fromwalkingintoyourfirstAAmeetingtobeingbrutallyhonestwithatherapist.Ifwecanbehonest,open-mindedandwilling,removingthoseheavyburdenstowards,healingandrecoverycanbediscoveredbyall.

HappyFather’sDay!

Scott&Daralyn

Pick up our Annual Natural Living Directory wherever you find Natural Awakenings!

Page 9: Natural Awakenings Pensacola June 2015

9natural awakenings June 2015

Where You Can Mind Your Body

(850) 287-58362130 Summit Blvd. at Roger Scott Rec. Center

MOVEMENT THERAPYPilates Fitness & Rehabilitation, Yoga, Gyrotonic®, Spinning

MANUAL THERAPYMyofascial Release and Structural Integration LMT# MA64267

(850) 287-5836CORE TRAINING

BEFORE AFTER

Dunmire Village1310 B Dunmire l Pensacola

pilatescoretraining.com

Private sessions and group classes

#MA64267

MOVEMENT THERAPY • Pilates Fitness & Rehabilitation• GYROTONIC EXPANSION SYSTEM®

BOTH SYSTEMS IMPROVE:Posture • Balance • Joint Health • Body Awareness

Coordination - Both Mental and Physical Strength of Your Deep and Superfi cial Core Muscles

Overall Strength and Flexibility • Athletic PerformanceLung Capacity and Circulation • Body SymmetryAttention • Effi ciency and Grace of Movement

MANUAL THERAPY• Myofascial Release Approach• Rolf Method of Structural Integration

BOTH TECHNIQUES MAY IMPROVE:Back Pain • Neck Pain • Chronic Pain • Disc PainMigraines • Jaw Pain (TMD) • Scoliosis • Posture

Carpal Tunnel Syndrome • Sciatica • Sports InjuriesChronic Stress • Piriformis Syndrome • AdhesionsWhiplash • Pelvic Pain • Fibromyalgia • Asthma

FOR MORE INFORMATION ON THIS BREAKTHROUGH THERAPY

Chelation FindingsBuzz_Tact

Chelation Dr. Tammy Born

FORT WALTON BEACH: 913 MAR WALT DR • 2438229DESTIN: 36468 EMERALD COAST PKWY #8102 • 6509500

Call Today for Your FREE Initial Consultation

ALSO AVAILABLE AT DR. ZANT:• IV Infusions of Vitamins, Minerals, and Trace Elements •

• Myers “Cocktails” •

IV Chelation TherapyDr Eddie Zant, MDParticipating Physician in US National

Institutes of Health-Trial to Assess Chelation Therapy-(TACT) Study, a

7 year, double blinded Chelation Study.

This Exciting IV therapyis now available in

Okaloosa & Walton Counties

MEMBER FORT WALTON BEACH: 913 Mar Walt Dr • 243-8229

DESTIN: 36468 EMERALD COAST PKWY #8102 • 650-9500SEE WEBSITE www.flhbot.com

for Neurological testimonials from both military and civilian patients.MEMBER

FDA APPROVED FOR:Diabetic ulcers of the lower extremities

Post radiation issues • Chronic bone infectionsAcute hearing loss • Crushing injuries to extremities

Hyperbaric OXYGEN(O2) Therapy

CALL FOR YOUR FREE CONSULTATIONInsurance may be accepted for certain conditions

Dr. Eddie Zant, MD

Page 10: Natural Awakenings Pensacola June 2015

10 Natural Awakenings of Northwest Florida www.NWFNaturally.com

newsbriefs

A Bad Day of Fishing is Better Than a Good Day at Work

Nonprofit Heroes On The Water, based in Allen, Texas, has come to the Emerald Coast. They are

devoted to providing wounded warriors and all military personnel that have been wounded, injured or disabled the opportunity to experience the unique healing experi-ence of fishing as a therapeutic practice. This simple activity has proven to be powerful source of rehabilitation for thousands of warriors that have put their lives on the line for their country. Some have never fished before, while others rediscover what was assumed to be lost. This innovative form of physical and mental therapy shatters the perceived limits of those missing an arm or a leg. With volunteers as guides, they learn new skills and renew focus on what can be done, not what cannot. It provides a circle of fellowship among those that share common scars, both external and internal. This program is also great therapy for those that have wounds deeper than the skin, and provides a chance for victims of post-traumatic stress disorder, which is often very difficult to treat, a chance to begin healing from the inside out. For more information on how to participate, vol-unteer or donate, email [email protected] or visit Facebook.com/pages/Heroes-on-the-Water-Emerald-Coast-Chapter.

Mostpeoplehaveneverlearnedthatoneofthemainaimsinlife

istoenjoyit.~SamuelButler

Attend Live Public Radio Broadcasts in Pensacola

RadioLive is a monthly,

acoustic variety concert broadcast by WUWF Public Media on the first Thursday of each month at 6 p.m., in the Museum of Commerce on the historic Pensacola campus of the University of West Florida. Alan Rhody, Sally Barris and The Sarah Mac Band will appear on June 4; Bob Patterson, Flag-ship Romance and Lon & Lis Williamson on July 2; and Dana Cooper, Bob Livingston and Jen Coates on August 6.

Admission is free. Donations of non-perishable items for Manna Food Pantries are accepted at the door. Location: Historic Pensacola Village, 205 E. Zaragoza St., Pensacola. For more information about RadioLive concerts, visit WUWF.org/radiolive.

Phot

o C

redi

t: A

lan

Freh

m

Sally Barris

Resource Rangers Sustainability Summer Day Camp

The Environ-mental Educa-

tion Coordination Team will host a weeklong sum-mer day camp for children enter-ing first through fifth grades from 9 a.m. to 4 p.m., July 20 through 24, at the Roy

Hyatt Environmental Center, in Cantonment. Children will learn the importance of sustainable practices used to protect and preserve our valuable natural resources through hands-on lessons and activities.

Registration is $150/$75 for each additional child, and includes materials for activities, plus mid-morning and afternoon snacks. Location: 1300 Tobias Rd., Cantonment. RSVP online at eventbrite.com/event/16578573961. To make payment or for more information, call Traci Goodhart at 850-332-797, ext. 222, or email [email protected].

Page 11: Natural Awakenings Pensacola June 2015

11natural awakenings June 2015

eventspotlight

Hippies Dancing Just Like Back in the Day

The annual Hippie Festival Summer Solstice Celebra-tion will be held from 10 a.m. to 6 p.m., June 20,

at the Intuitive Spiritual Center, in Fort Walton Beach. On this day of music, storytelling, poetry, singing and mingling, participants are encouraged to wear their best hippie threads and dreads and bring stories, poem, pic-tures, songs, guitars, drums, tambourines and a white T-shirt to tie-dye; or make a $10 love offering and the center will supply one. The tie-dye workshop begins at 2 p.m., followed by a groovy threads contest at 4 p.m. Shintaedo dance, hula-hoop challenges, emotional release sessions, psychic readings and the John of God Light Bed are all highlights of the say’s festivities. Sponsored by Stone Soup Intuitive Spiritual Center, founders Jul’s Constantine and Jan Myers, were delighted with the participation and excitement from last years event. Myers says, “Folks have been asking about the next event all year, and we are thrilled to see many like-minded people come together to celebrate the peace, love and nostalgia of the hippie era.” No drugs or alcohol are allowed, and the festival is actively seeking additional vendors to participate in this classic event. Attendees under 18 must be accompanied by an adult.

Admission is by love offering, cost varies for vendor ser-vices. Location: Stone Soup ISC, 700 NW Pkwy., Unit D. Potential vendors and guests may call 850-533-6565 or visit IntuitiveSpiritualCenter.org.

HolisticMercury-Free Dentistry

Dr. Dayton Hart, DMD251-943-2471

225 W. Laurel Ave • Foley, AL 36535

DrDaytonHart.com

Mercury-Free, BPA-Free FillingsBio-Compatible Materials

Cosmetic Dental RestorationsMicroscopic Bacterial Analysis

Crowns In A Day - CEREC • ImplantsExtractions • Dental HomeopathyClear or Removable Orthodontics

Snoring Prevention • Teeth Whitening

NEW PATIENTSPECIAL:

FREE ConsultationFREE Exam

FREE Bitewing Xrays

FREE Nitrous

GENERAL, COSMETIC AND BIOLOGICAL

Hend-Rx Nutrition& Laboratories

Dr. Garry Hendricks, N.D.

850-736-5700205 Kelly Ave NE • Ste A • FWB

Early detection is Key

Screening with thermography can

detect abnormalities in the very earliest stages

cardiovascular • breast thyroid • hormonal

digestive • diabetes • TMJ

THERMOGRAPHY DOES NOT REPLACE OTHER DIAGNOSTIC DEVICES. THERMOGRAPHY DEVICESHAVE BEEN CLEARED BY THE FDA FOR USE AS AN ADDITIONAL TOOL FOR DETECTING BREAST CANCER.

Also offering personalized healthcare assessments and

organic botanical supplements

Page 12: Natural Awakenings Pensacola June 2015

12 Natural Awakenings of Northwest Florida www.NWFNaturally.com

healthbriefs

Hatha Yoga Boosts BrainpowerResearchfromWayneStateUniversity,inDetroit,has

foundthathathayogacansignificantlyimprovecognitivehealthinaslittleastwomonths.Researcherstested118adultswithanaverageageof62years.Onegroupengagedinthree,hour-longhathayogaclassesperweekforeightweeks,whiletheothergroupdidstretchingandstrengtheningexercisesforthesameduration.Theparticipantsunderwentcognitivetest-ingbeforeandaftertheeight-weekperiod.Attheendofthetrial,thehathayogagroupshowedsignificantimprovementsincognitioncomparedtotheother

group.Theyogagroupalsorecordedshorterreactiontimes,greateraccuracyinhigh-levelmentalfunctionsandbetterresultsinworkingmemorytests.

Source: JournalofGerontology

Acupuncture Treats Prostate EnlargementResearchfromChinahasfoundthatacombination

ofacupunctureandmoxibustion,aformofheattherapyinwhichdriedplantmaterialsareburnedonornearthesurfaceoftheskintowarmandinvigoratetheinnerflowofqi,orenergy, caneffectivelyreducethesymptomsofbenignprostateenlargement. Researcherstested128patientswithprostateenlargementforthreemonths,dividingthemintotwogroups.Onegroupwasgivenacupunctureandmoxibus-tion;theothertookatraditionalChineseherbalmedicationforprostateenlargementcalledQianliekangi.Thepatients’prostatesymptomsweretestedusingtheInterna-tionalProstateSymptomScore,maximumurineflowrateandresidualurinetests. Atthestudy’send,thepatientsgiventheacupuncture/moxibustiontreatmentreportedsignificantlyreducedlevelsinallthreetests—calculatedatan89percenttotaleffectiverate—comparedtotheherbalmedicationgroup.

ANTIOXIDANT-RICH BERRIES THWART ALZHEIMER’SAninternationalteamofscientistshasconfirmed

thatconsumingberriessuchasstrawberries,blueberries,blackberries,blackcurrants,mulberriesandraspberriescansignificantlyreducetheriskofAlzheimer’sdiseaseandotherformsofdementia.Blueberries,inparticular,werefoundtobeassociatedwithincreasedmemoryandlearning. ResearchersfromWashingtonStateUniversity,theU.S.NationalInstitutesofHealth,India’sAnnamalaiUniversityandOman’sSultanQaboosUniver-sity’sCollegeofMedicineandHealthSciencesreviewedtwodecadesworthofresearchrelatingtoconsumingberriesanddementia.Theyfoundthatthemanybiochemicalscontainedinberriesprovideantioxidantprotectiontoneuronsandpreventtheformationofbeta-amyloidfibrilsfoundinthebrainsofAlzheimer’sdiseasepatients.

Dr Sheryl RoeNationally Certi� ed Acupuncture Physician

Registered Nurse for 25 Years

850-225-3460 • DrSRoe.com90 Beal Pkwy, inside 8th Element Wellness7552 Navarre Pky • Suite 44 • Navarre, FL

Causes of ED: Decreased circulation

Low libidoLow testosteroneDecreased energy

and even back pain.

Safe and effective Acupuncture protocol for Erectile Deficiency with

a simple and easy procedure...

Acupuncture can:increase circulation • increase or improve libido

increase energy• increase circulating testosteronerelieve all types of pain which may be

restricting desire or ability

NO DISCOMFORTNO-PAIN

HealingWithBodywork.com

Sharalee Hoelscher, RCST®

Certified Rolfer™Registered Craniosacral Therapist

850-450-8508Lic. # MA34039

Treat the SourceNot the Symptom

Imagination is more important

than knowledge.

~Sylvia Plath

Page 13: Natural Awakenings Pensacola June 2015

13natural awakenings June 2015

Stroke Risk Rises with Two Drinks a DayNewresearchpublishedintheAmericanHeart

Association’sjournalStrokehasdeterminedthatdrinkingtwoalcoholicbeveragesperdayduringmiddle-ageyearsincreasestheriskofstrokemore

thanotherknownfactors,includinghighbloodpressureanddiabetes. Thestudyfollowed11,644twinsfromSwedenfor43years,startingbetween1967and1970.Allbeganthetrialwhentheywereundertheageof60.Thescientistscomparedtheeffectsofhavinglessthanhalfadrink—classifiedasfourandtwoouncesofwineforamanandawoman,respectively—dailytodrinkingtwoormoredaily. Thestudyfoundthatconsumingtwodrinksperdayincreasedtheriskofstrokeby34percentcomparedtodrinkinglessthanhalfadrinkperday.Thosethatdownedtwoormoredrinksadayduringtheir50sand60shadstrokesanaverageoffiveyearsyoungerthanlightdrinkers.Theincreaseinstrokeriskwasfoundtobehigherthanthedangergenerallyposedbydiabetesandhypertension.

An Avocado a Day Keeps Bad Cholesterol AwayResearchpublishedbytheJournal of the American Heart Associa-

tionhasdeterminedthatjustoneavocadoadaycansignificantlyreducelow-densitylipoprotein(LDL),atypeofcholesterolcarrierknowntoincreasetheriskofhardeningofthearteries. Theresearcherstested45overweightadultsbetween21and70yearsoldthatfollowedanaverageAmericandietfortwoweeksbeforeadoptingoneofthreediets:alow-fatdiet,amoderate-fatdietthatincludedoneHassavocadoperdayoramoderate-fatdietwithoutanavocado. Afterfiveweeks,researchersfoundthattheadditionoftheavocadoreducedLDLsignificantlymorethanthedietsthatdidnotcontainthefruit.Whileboththelow-fatandmoderate-fatdietsreducedLDLlevels,themoderate-fatdietwithanavocadoreducedLDLbybetterthan60percentmorethanthemoderate-fatdietalone,andabove80percentmorethanthelow-fatdietalone.

PAIN AND DEPRESSION EBB WITH FLOTATION THERAPYNewresearchfromSwedenhasfoundthat

flotationtherapyhelpsincreasesleepquality,reducepainandrelieveanxietyanddepression.Flotationtherapy,sometimescalledisolationtherapy,consistsoffloatinginatankofwaterwithminimizedinterruptionsandsensorystimuli. ResearchersfromKarlstadUniversitydivided65peopleintotwogroups.Onegroupunderwent12,45-minuteflotationtherapysessionsforsevenweeks,whiletheothergroupdidnot.Bothgroupsweregivenabat-teryofphysiologicalandpsychologicaltestsbeforeandafterthetreatmentperiod.Thetherapywasconductedusingthreecommercialflotationtherapycentersthatprovidedsensoryisolationsystemstopromoterelaxationaspartofthetreatment. Comparedtothecontrolgroup,theflotationtherapygroupreportedsignifi-cantdecreasesinpain,anxiety,depressionandstresslevelsandbettersleepqual-ity.Theflotationgroup’saveragedepressionscoreswentfrom4.42to2.25,whilethecontrolgroup’sscoresbarelybudged.Theworstpainsamongtheflotationgroupdroppedfrom64to40onthescale.

$20OFF

• Color• Styling• Cuts• Smoothing

Treatments• Deep

Conditioning Treatments

Organic Concepts by Camy Kilker

your first service

Exp 3.31

COLOR LASTS 30% LONGER

COLOR LASTS

NO MORE CHEMICALS,

PLEASE!

your first serviceservice

Exp 3.31(850)[email protected] West Chase St • Pensacola

• NO AMMONIA • NO PARABENS• NO PLASTICS• NO THIOGLYCOLATES • NO SKIN IRRITATION OR

STAINING• NO HARSH CHEMICAL ODORS• LONGER LASTING TONAL VALUES• LESS EXPOSURE TO TOXINS

AND CHEMICALS• CLEANER BLONDES• LONGER LASTING MORE

VIBRANT REDS• SUPERIOR GREY COVERAGE

Page 14: Natural Awakenings Pensacola June 2015

14 Natural Awakenings of Northwest Florida www.NWFNaturally.com

globalbriefsNews and resources to inspire concerned citizens to work together in building a healthier, stronger society that benefits all.

Solar HarvestNew Technology Makes Windows Power Producers

SolarWindowTechnologies’newwindowcoatingsarea“firstofitskind”technologythatcouldturnthebuild-ingsweliveandworkinintoself-sufficient,minipowerstations.Theycangenerateelectricityonsee-throughglassandflexibleplasticswithcoloredtintspopularinskyscraperglass.Thecoatingcanbeappliedtoallfoursidesoftallbuildings,generatingelectricityusingnaturalandartificial

lightconditionsandevenshadedareas.Itsorganicmaterialsaresoidealforlow-cost,high-outputmanufacturingthatthetechnologyisalreadypartof42productpatentapplications. Whenappliedtowindowsontowers,it’sexpectedtogenerateupto50timesthepowerofconventionalrooftopsolarsystemswhiledelivering15timestheenvironmentalbenefits.Forexample,asingleSolarWindowinstallationcanavoidtheamountofcarbonemissionsproducedbyvehiclesdrivingabout2.75millionmilesperyear,comparedto180,000milesforconventionalrooftopsystems.

Farm TherapyVeterans Heal Through AgricultureOfthe19.6millionveteransintheUnitedStatesalone,approximately3.6millionhaveaservice-relateddisability,7.6percentareunem-ployedandtheycollectivelymakeup13percentoftheadulthomelesspopulation,accordingtotheInde-pendentVoterNetwork. Organizationsworldwidearehelpingveteranshealtheirwoundsthroughfarmingandagriculture.Thegoalistocreateasustainablefoodsystembyeducatingthemtobesustainablevegetableproduc-ers,providingtrainingandhelpingfamiliesrebuildwar-tornlives. EattheYard,inDallas,Texas,wasfoundedbyIraqWarveteransJamesJeffersandSteveSmithtocultivatefreshproduceincommu-nitygardens.Thetwobeganorganicfarmingintheirownbackyardsforboththerapeuticandfinancialrea-sons,andthenslowlybegantobuildmoregardensintheircommunity.Theynowselltheirproducetolocalrestaurantsandbusinesses. TheFarmerVeteranCoalition(FVC)isworkingwithveteransacrosstheU.S.totransitionthemintoagriculture.Thecoalitionpartnersveteranswithmentorsexperiencedinfarmingandbusiness,matchesthemwithagriculture-relatedjobopportu-nitiesandorganizesequipmentdona-tionsinIowaandCalifornia.FVCishelpingformermembersofthearmedforcesin48states.

Source: FoodTank.com/news/2014/11/veterans-day

Lost LandsSalinity is Eating Away Farmland WorldwideEverydayformorethan20years,anaverageofalmosteightsquaremilesofirrigatedlandinaridandsemi-aridareasacross75countrieshavebeendegradedbysalt,accordingtothestudyEconomics of Salt-Induced Land Degradation and Restoration,byUnitedNationsUniversity’sCanadian-basedInstituteforWater,EnvironmentandHealth. Saltdegradationoccursinaridandsemi-aridregionswhererainfallistoolowtomaintainregularperco-lationofrainwaterthroughthesoilandwhereirrigationispracticedwithoutanaturalorartificialdrainagesystem,whichtriggerstheaccumulationofsaltintherootzone,affectingsoilqualityandreducingproductivity.IntheColoradoRiverBasinalone,studiespegtheannualeconomicimpactofsalt-inducedlanddegradationinirrigatedareasat$750million. Thecostofinvestinginpreventingandreversinglanddegradationandrestor-ingittoproductivelandwouldbefarlowerthanlettingdegradationcontinueandintensify.Methodssuccessfullyusedtofacilitatedrainageandreversesoildegra-dationincludetreeplanting,deepplowing,cultivationofsalt-tolerantvarietiesofcrops,mixingharvestedplantresiduesintotopsoilanddiggingadrainordeepditcharoundsalt-affectedland.

Sola

rWin

dow

Tec

hnol

ogie

s, I

nc.

Page 15: Natural Awakenings Pensacola June 2015

15natural awakenings June 2015

Creature CrimeFeds Make Animal Abuse a Felony

InOctober,theFederalBureauofInvestigation(FBI)classifiedanimalcrueltyasaclassAfelonyanda“crimeagainstsociety,”onaparwithsuchseriouscrimesashomicide.TheFBIintendstoprosecuteintentionalabuseandtorture,grossneglect,sexualabuseandorganizedabuse,whichincludesdogfights.Also,theonsetoftrackinganimalabusecasesnationwidewillassistlocalpoliceandcounselorsinidentifyingandconnectingwithminorsthatshowanearlytendencytoabuse.FBIstudiesshowanalarmingconnectionbetweenanimalabusersandperpetratorsofextremelyviolentcrimesagainst

humans.Thegoalisthatearlydetectionandinterventionwillhelpcertainchildrengetthecounselingandsocialsupporttheyneedtoliveproductivelivesfreeofcrimeandabuse. “Regardlessofwhetherpeoplecareabouthowanimalsaretreated,people,likelegislatorsandjudges,careabouthumans,andtheycan’tdenythedata,”saysNatashaDolezal,adirectorfortheCenterforAnimalLawStudiesatLewis&ClarkCollege,inPortland,Oregon.

Source: EliteDaily.com

Euro SpaceForty Percent of Hamburg Will Be Green SpaceHamburg,Germany,namedEurope’s2011GreenCapitalbytheEuropeanUnion,isimplementinganambitiousplantocreateandlink27squaremilesofnewandexistinggreenspace,com-prising40percentofitslandarea.Theresultwillputnaturewithineasyreachofeveryresident,provideconnectivityforwalkingandbicyclingtoeliminateautomobiletrafficby2035andmakethecitymoreresilienttofloodingcausedbyglobalwarming.Themetroareapopulationcurrentlynumbers4.3millionasEurope’s10th-largestcity. Since2000,Germanyhascon-verted25percentofitspowergridtorenewableenergysourcessuchassolar,windandbiomass.Thearchitectsofthecleanenergymovementenergiewende,whichtranslatesas“energytransforma-tion”,estimatethat80percentto100percentofGermany’selectricitywillcomefromrenewablesourcesby2050. AngelikaFritsch,aspokeswomanfortheDepartmentofUrbanPlanningandtheEnvironment,says,“Themoreimportantresultmaybetheprovisionofgreeninfrastructuretoabsorbrainandfloodwaters.”Sealevelsintheportcityhaverisenby20centimetersoverthepast60yearsandareexpectedtoriseanother30centimetersby2100.

Source: Inhabitat.com

Plastics Ping-PongChina Reverses Its Recycling PolicyPlasticitemswecarefullyseparatefromtherestofthetrashandputinadistinctcontainermayhaveadubiousfate,accordingtoenvironmentalwatchdogQuartz.U.S.recyclingcompanieshavelargelystayedawayfromac-ceptingplastic,andmostofithasbeenshippedtoChina,whereitcanbeprocessedmorecheaply.ButChinahasannouncedanewGreenFencepolicy(Tinyurl.com/ ChinaGreenFence),prohibitingimportationofmuchoftheplasticforrecyclingthatitoncereceived. Plasticcategories#3through#7(shampoobottlestobuttertubs)maygointodomesticlandfillsagainuntilasolutionisfound,saysDavidKaplan,CEOofMainePlastics,apost-industrialrecycler. Chinacontrolsalargeportionoftherecyclingmarket,importingabout70per-centoftheworld’s500milliontonsofelectronicwasteand12milliontonsofplasticwasteeachyear.TheseChinesepolicychangeswillputpressureonWesterncoun-triestoreconsidertheirrelianceonthisformerlycost-effectivepracticeofexportingwasteandthenecessityforincreasingtheirdomesticrecyclinginfrastructure.

Please visit our NEW web site at:

www.MichaelDeMaria.comNew classes and trainings coming soon!

Just Released...

Michaels new album with Peter KaterHeart of Silence

Page 16: Natural Awakenings Pensacola June 2015

16 Natural Awakenings of Northwest Florida www.NWFNaturally.com

We Dry Clean Organically,at no additional cost

New customers

15% OFFValid only for 1st drop

Expires: 3/31/15

SERVICES AVAILABLE• Dry Clean & Laundry

• Wash & Fold, All Households

• Leather, Purse, Wedding Dress, Drapes

• All Uniforms

SERVICES INCLUDED, NO COST ADDED• Same day service

• Button replacement

• Service redo with no question asked if you not satisfi ed.

FREE PICKUP & DELIVERY SERVICES IN GULF BREEZE & PENSACOLA

Pensacola: Tue & Fri Gulf Breeze: Mon & Thu

*Drop off and Pickup onlywww.xclean.net

GULF BREEZE:1143 Gulf Breeze Pkwy850-932-2565

PENSACOLA: 2905 E.Cervantes*850-429-8001

NAVARRE:1970 Hwy 87*

850-939-8221

(NO PETROLEUM BASED OR PERCHLOROETHYLENE CHEMICALS USED)

Antisocial InsectsNatural Ways to Keep Crawling Critters AwayWithpicnicsandbarbecuesonthecalendar,summerisatimeforindoor/outdoorentertainingwithfamily,friendsandneighbors.Tokeepinvadingantsaway,hostswillwanttousenaturalmaterials,manyofwhichcanbefoundinthekitchen,insteadofchemi-calproductsthatmaybehazardoustohumans,petsandwildlife. Natural lines of defense. Applyinggroundcin-namonormixingsomeofthespicewithsugar,clovesandwaterintoathinpasteandusingacottonswabtodabitincracksandarounddoorsandwindowsillsout-sidethehousewhereantsmightentercanbeeffective.Thearomaistoostrongforthem,sothey’lleithersuccumborturnaway.AnothermethodrecommendedbytheMotherNatureNetworkistocleanfloorsandcoun-tertopswithasolutionofonecupeachofvinegarandwater,withtheoptiontoenhanceitwith15dropsoflemonoil. Try a simple spray. Anorganicinsecticideforapplicationingrassylocations,appliedtothelegsandsidesofthepicnictableorchairs,canhelpreduceintru-sionbyantsandotherpests.ChasingGreen.orgsuggestspouringone-and-a-halfcupsofwaterintoablenderandaddingtwobulbsofgarlic.Liquefytheingredi-entstoasmoothblend,strainouttheremainingpiecesofgarlic,dilutethemixturewithaboutagallonofwaterandfillaspraybottle. Organic pest control. Somemanufacturersspecializeineco-friendlyprod-ucts,includingtheExtremelyGreenGardeningCompany(ExtremelyGreen.com)thatoffersdiatomaceousearth,HastaLaVistaAnt!andBugShooterinsecticide.Otherchemical-freebugtrapscanbefoundatmanyhardwarestores. Avoid temptation. Keepfoodcontainerlidsandboxestightlyclosedindoorsandkeepfoodcoveredasmuchaspossibleoutdoors. Takingnaturalpreventivestepsnowistimelybecausemanyantspeciesarehighlyactiveinearlysummerastheyseektoincreasethefoodstoresfortheircolonies.

ecotip

To advertise or

participate in our

next issue, call

850-687-0825

HEALTHY EATING

STARTS WITH NATURAL FOODSAdvertise in

Natural Awakenings’ Food Democracy & Inspired Living

July Issue

Page 17: Natural Awakenings Pensacola June 2015

17natural awakenings June 2015

therapyspotlight

Thebrainproduceselectricalpatterns—beta,alpha,thetaanddelta,thatcanbedetectedand

recorded.Thesepatterns,orbrain-waves,differinfunctionfrombetawaves,whicharepresentwhenweareengagedinmentalactivityorarebeingproductive,todeltawaves,whichoccurduringdreamlesssleep. Brainwavepatternsthatappearatinappropriatetimesorplacesinthebraincaninterferewithcognitive,emotionalandevenmotorfunction-ing.Thescienceofneurofeedbackhasdevelopedtotreatsuchdysfunctions.Itisbasedonthesimplepremisethatifweknowwhatourbrainwavesaredo-ing,ourbraincanusetheinformationtocorrecthowitworks. Neurofeedbackmeasuresbrain-wavestoproduceavideoorsoundsignaltoteachself-regulationofbrainfunction.Itgivespositivefeedbackfordesiredbrainactivityandnegativefeed-backforundesirableactivity.Thegoal

istotransformanunhealthy,dysregu-latedbrainwavepatternintoanormal,healthy,organizedpattern. NeurofeedbackisnoninvasiveandisconsideredbytheU.S.FoodandDrugAdministrationtobesafe.Infact,ithasneverproducedaserioussideeffectsinceitwasfirstdiscoveredmorethan40yearsago,andsincethenhasbeenusedtotreatthesymptomsofbrainwavedysregulation.Studieshavedemonstratedthatawiderangeofneurologicalconditions,includingaddictions,ADD/ADHD,insomnia,panicattacks,memoryloss,autism,Aspergersyndrome,post-stoke,PTSD,headaches,migraines,fibromyalgia,traumaticbraininjury,anxietydisordersandlearningdisordersareassociatedwithbrainwavedysregulation. BrainCoreTherapyNeurofeedbackbeginswithaquantitativeelectroen-cephalogram(QEEG)evaluation,de-signedtoobjectivelyandscientificallyevaluateaperson’sbrainwavepatterns.

Theprocedureusesasnugheadcapembeddedwithin12smallsensorsthatmeasureandrecordtheelectricalactiv-ityofbrainwaves. ThedatafromtheQEEGiscom-paredtoalarge,sophisticateddatabaseandareportisgenerated.Thisassess-mentallowsthedoctortoobjectivelydeterminewhetheraclient’sbrainwavepatternsaredifferentthannormalandprovidesneurofeedbacktrainingproto-colsfortrainingsessions. Duringthetreatment,anindi-vidualishookeduptoacomputerandinformationabouttheirbrainwavesisdisplayedonamonitor.Computersoft-waredetectswhetherthebrainwavesareproperlyorderedandfeedsthatinformationbacktothepatientintheformofagame,movieorsound. Forexample,imaginethepatientiswatchingavideoofapuzzlebeingfilledinpiecebypiece.Aslongasthepatient’sbrainwavesaremovinginanorderlydirection,thepuzzlepiecesarefilledinproperly.Ifthepatternsmovefromanorderlyconfiguration,thepuz-zlestops.Thepatientisactuallycontrol-lingthecompletionofthepuzzlewithbrainwaves.Bydoingso,thepatient’sbrainislearninghowtoregulateitself. Justasweightliftingcanbuildmus-clestrengthandjoggingcanimprovecardiovascularfitness,neurofeedbackcannaturallytrainthebraintohavemorecontrolofitsbrainwaves.

Dr. Shawna Hogan is a doctor of chiro-practic at Regatta Chiropractic and La-ser Center. For more information about BrainCore Neurofeedback Therapy or to schedule a free consultation with Dr. Hogan, call Regatta Chiropractic and Laser Center at 850-424-7856.

A Natural, Non-Invasive Approach to Improve Mind-Related Ailments

by Shawna Hogan

Brain Function Therapy

Welcome to our World! We are committed to educating our customers on herbs and essential oils and the many ways

that you can use these wonderful gifts that God gave to us.

“THEIR FRUIT WILL BE FOR FOOD AND THEIR LEAVES FOR MEDICINE.” EZEKIEL 47:12

NOT JUST ANOTHER HERB STORE

• Herbs & Herbal Recipes • Detox programs and detox foot baths• Essential Oils & Hydrosols• Health

Evaluations• Gluten,Soy,Dairy

Free and Vegan products

• Infrared Sauna

WORKSHOPS:MotherBaby Group

Every Wednesday Morning 10am

��Herbal Hour

2nd Wednesday of every month

��For this months workshops go to:

www.oldthymeremedies.com

MON - FRI 10:00AM - 8:00PMSATURDAY 10:00AM - 6:00PM

2475 E. 9 MILE RD STE EPENSACOLA, FL 32514(850)912-6996

Page 18: Natural Awakenings Pensacola June 2015

18 Natural Awakenings of Northwest Florida www.NWFNaturally.com

localexpert

Peaceful ProtectionSensei John D. Lee Teaches

Confidence, Courage and Calmness by Daralyn Chase

John Lee joined the police

academy in 1995, became a police officer in March 1996 and has served in law enforce-ment ever since as a patrolman, field training officer, SWAT operator, crime scene investiga-tor and motor unit, supervisor. He has been a detective for five years now, with a main focus on violent crime. Lee has also been involved in martial arts for most of his life, more interested in the philosophies and ideals than specific styles, but more interested in practical application as grew older. His kajukenbo instruc-tor, Grandmaster Ron Pierce, studied directly under Sijo Emperado. In 2010, Lee created his own self-defense sys-tem called Calm Water. What led you to study the martial arts, and how have you applied it?I started searching for and studying martial arts as I could when I was young because I had an awful temper. It taught me discipline to control my emotional outburst. When I became a police officer, I understood the ad-vantages it gave me in the field when facing people that wanted to hurt me. Now as I teach, I watch the confidence it inspires in my students.

How does the current police/community atmosphere seem to you personally?Mostly, the community and police work together nicely. It’s those selfish few that use violence to fur-ther their own agenda that ruin it for everyone. I think for the most part, if this violence didn’t

sell so well in the press we would all move on quicker and safer.

As a combat instructor, what do you teach about stress, anger and fear?Everyone has fear. As long as you con-trol your fear, it makes you sharp. The definition of courage is not the absence of fear, but being afraid and doing what you must anyway. Stress and anger are killers. Find a way to control your anger and deal with your stress.

What do you do to find balance in your life?My life is dealing with violence. This darkness can consume anyone without an outlet. Balance is survival. My wife, my family and my faith are my anchors. I spend as much family time as possible to keep me in line with what is most impor-tant. I try to eat right and exercise daily. I try new things often to keep life invigorat-ing. Simply put, I choose to live a positive, happy life, regardless of the daily events.

John D. LeeDevelop Your

INTUITIONWeekend Workshop

August 15th & 16th • 9am-5pmNavarre Conference Center

You can use your Intuition and change your life, become the person you

have always wanted to be! Have you always had a curious mind and known things without being

told? Have you felt a little di� erent from other people? Have you watched

people on TV giving messages and thought that you would like to learn how to give messages to other people? After you complete this workshop, you will be able to do that and more! Discover & Develop Your Intuition. Learn How to Listen and Trust Your Intuition. Learn Meditation & How It Can Assist You. Learn How to Protect Yourself From Negative Energies. Learn How To Do Readings For Yourself or Other People. Learn To Use Di� erent Divination Tools.

Jul Constantine • 850-533-9448DevelopingMyIntuition.com

Page 19: Natural Awakenings Pensacola June 2015

19natural awakenings June 2015

What is the most important mes-sage about human nature that you would share?The secret of life is threefold: 1) survive, 2) be positive and 3) find your happy.Life is too short to be miserable; choose to be happy! Even at the lowest point of your life, choose to be positive and positive things will happen. It’s not always easy, but it is always worth it.

Lee’s Martial Arts Combat Academy is holding adult self-defense classes from 7 to 8 p.m. Thursdays and 10:30 a.m. to noon Saturdays. Child classes based in stranger danger and bully defense are offered from 4:45 to 6:45 p.m. on Monday, Wednesday and Friday. Both are taught by Sensei John D. Lee.

Location: 1605 N. Partin Dr., Nicev-ille. For more information, call 850-797-9429 or visit MartialArtsCombat Academy.com.

Everyone has fear. As long as you control your fear, it makes you sharp. The

definition of courage is not the absence of fear, but being afraid and doing what you must anyway.

ONE DAY of Music, Poetry, Singing, Mingling & Storytelling.

Hippie FestivalA Summer Solstice Celebration

June 20, 2015 • 10am-6pmSponsored by

Stone Soup

Wear your best Hippie threads

and dreads.Bring your stories, poem, pictures,

songs, guitars, drums, tambourines, a t-shirt to tie-dye.

(Vendor may have charges for products and services)

$

$

850-533-6565700 NW Beal Parkway,

Unit D, Fort Walton Beach

For more information check out IntuitiveSpiritualCenter.org

2nd Annual

• Tie-Dye Workshop 2PM• Grooves Threads Contest 4pm• Hula Hoop Challenges• Emotional Release &

Physical Healing • Shintaedo Dance• Psychic ReadingsJohn of God Light Bed(Under 18 must be accompanied by an adult)* No Drugs or Alcohol

Your Path to Self-Discovery & Personal WellnessYour Path to Self-Discovery & Personal WellnessYour Path to Self-Discovery & Personal WellnessYour Path to Self-Discovery & Personal Wellness

LAURIE AZZARELLA, LMT,CRR • [email protected] • www.laurie.marketingscents.com

Toxic Mold MeetsAn eff ective, clean, green and safe way to rid your home and your body of this

insidious perpetrator. Join us!JUNE 29 • 6:30PM • $5.00

AT UNITY FELLOWSHIP HALL716 N. 9th Ave • PNS

using hypnotherapy visualization • regression

Clinical Certified HypnotherapistSTATE LICENSED

Are you Stressed, Overwhelmed,seeking Support and Guidance?

Free Initial ConsultationMAIA RIZZI • BREAKTHROUGH HYPNOTHERAPY

850-291-8041 CALL NOW!

COMFORT AND RELIEF

There’s no point in saying anything but the truth.

~Amy Winehouse

Tough times never last, but tough

people do.~Robert H. Schuller

Page 20: Natural Awakenings Pensacola June 2015

20 Natural Awakenings of Northwest Florida www.NWFNaturally.com

communityspotlight

DiscoveringTheSolution,anewprivate,holisticsubstanceabusetreatmentcenterinFortWal-

tonBeach,usespositiveapproachesthroughthemind/body/spiritconnec-tiontohelppeoplereturntohopeandhealing.“Therehasbeenalotofsham-ingandnegativereinforcementhistori-callyinworkingwithaddiction,insteadofdiscoveringthetruepersonbehindtheaddiction,”saysRebeccaThomas,chiefexecutiveofficerandclinicaldi-rector.“Ourgoalistonotjusttostopaclient’sself-medicating,buttofindoutwhattheyareusingittomask.” Thomas’professionalstaffworkswitheachclient’sindividualmotiva-

tionsandlifepurposetoreplaceself-destructivebehaviorswithpositivecop-ingmechanisms,sotheycancontinueontheirjourney.“Noonedeservestoliveinpainanddespair,”saysThomas.“Youcanhaveawonderful,happylife,andherewecancoachclientsthroughthestepstohelpthemachievethat.” ThosestepscomeinavarietyofcoreandoptionalservicesofferedbyDiscoveringTheSolution.Theyin-cludedayornightintensiveoutpatientservices,recoverycoaching,traumatherapy,angermanagement,parentinggroups,physicianservices,individualcounseling,familyeducation,couple’scounseling,12-stepprogrammeetings,

POSITIVE CAREA New Substance Abuse Center

Reveals the Solutions to Recovery by Karen Roganov

nutritionaleducation,yogaclasses,massagetherapy,meditation,gymac-cess,personaltraining,pettherapy,arttherapyandalumniandaftercaresup-portgroups. Mandatoryurinalysisandbreatha-lyzertestingisprovidedon-siteforconvenience,andthecenteroffersSpanish-speakingservices,aswellasgroupmeals.Aftergraduatingfromatraditionalmonth-longresidentialpro-gram,Thomassaysmanypeoplerelapseinthosefirst30to45daysfollowingdischarge.“Whentheystepdownfromaresidentialprogram,wearehereforongoingcare,sotheydon’tgohomeandfallbackintooldpatterns.” DiscoveringTheSolutioncreatesacourseoftreatmentbasedonaperson’sindividualandfamilyneeds.“Theyaretheexpertoftheirownexperience,”saysGerardPerillo,III,thecenter’sdirectorofoperations.“Peopleneedownershiptofeelgood,sotheyhavethemotivationtokeepgoing.” “Whatstoppedapersonfromenjoyingafulllifeinthefirstplaceisoftenatrauma,”saysThomas.“Thetraumaaltersaperson’sneuralpath-ways,muchlikebraindamage.Thewordtraumaisusedtodescribeexperi-encesorsituationsthatareemotionallypainfulanddistressingandthatover-whelmpeople’sabilitytocope,leavingthempowerless.” Now,withaholistictreatmentoptioninthecommunity,peoplethatstrugglewithaddictionscancometoDiscoveringTheSolutionineffortstoachieveasuccessfulandlastingrecovery.

Most insurance is accepted. Discover-ing The Solution is located at 1013 Mar Walt Dr., Ste. C, in Fort Walton Beach. For appointments, call 850-586-7818 or visit DiscoveringTheSolution.com.

Karen Roganov is a Gulf Coast journal-ist and educator, as well as an Air Force Reserve officer. She lives with her hus-band and children in Mossy Head.

No one deserves to live in pain and despair. You can

have a wonderful, happy life.

Then you will love our spiritual commUNITY

If YoU lIke whaT These people are TeachINg…

sunday service10:00 a.m.

“A positive path for spiritual living.”

unitypns.org

Jamie sanders, Minister

Page 21: Natural Awakenings Pensacola June 2015

21natural awakenings June 2015

Meet the Staffof Discovering The Solution

Rebecca Thomas, chief executive officer, has spent the past eight years helping people struggling with opiate, alcohol and cocaine ad-dictions, as well as co-dependen-cy and abuse issues.

Dr. Jeffrey All-man, medical director, is a board-certified family practice physician with a caring passion for using the mind, body and spirit approach to help people.

Gerald Perillo, III, director of operations, is a Gulf Coast na-tive. He experi-enced addiction himself, leading him to be espe-cially on target with helping people through belief systems, fitness and nutrition.

Josh the Poo-dle, a therapy dog, works with Price-Williams and provides human animal interaction (HAI) to help people over-come some of life’s challenges.

Kara Price-Williams, an addiction ther-apist, speaks fluent Spanish and is practices animal-assisted psychotherapy to help people with addition and trauma.

John Barnes, an addiction therapist, is the Florida Alco-hol and Drug Abuse Associa-tion Clinician of the Year for the Northwest Florida Region, and puts his ex-pertise to use to enrich people’s lives.

Jessica Stilla, a board-certified art therapist, provides counseling and art thera-py to children, adults and families in the areas of trauma, life stressors and substance abuse.

This team of professionals, as well as experts from caregiving partner-ships in the community, stand ready to help people return to their true selves. “When you’ve either wit-nessed or experienced that miracle of change, it’s an awe-inspiring feel-ing,” says Thomas.

Visit DiscoveringTheSolution.com. See ad, page 4.

MA56836 (850)449-5572 MM24149

GentleCOLON HYDROTHERAPY

Gentle “SLO-fill” methodClean and comfortable office

• Colon Hydrotherapy• Massage Therapy• Reflexology

Pensacola Wellness Center, LLCBeverly North, LMT, CT

Now Accepting New Clients 945 West Michigan Ave., 6C

Pensacola FL 32505

Page 22: Natural Awakenings Pensacola June 2015

22 Natural Awakenings of Northwest Florida www.NWFNaturally.com

Through15yearsofalcoholandprescriptiondrugaddiction,oneprominentVirginiabusiness

ownertrieditalltogetclean:threeinpatientrehabcenters;talktherapy; AlcoholicsAnonymous(AA)andNarcoticsAnonymous(NA),spendingroughly$200,000intheprocess. “Iwouldfollowthroughforaboutayear,andthenstarttofeellikeIwasontopofthingsandgetcomplacent,”saysthe52-year-old,whoaskedthathernamenotbeused.She’dtreatherselfto“justonedrink”andsoonfindherselfinafa-miliardownwardspiral.ShelastrelapsedinOctober2012.Threemonthslater,shewasontheinterstateinthemorning,ahalf-emptyfour-packofminiwinebottlesonherfrontseat,whensheswervedandslammedhead-onintoasemi-trailertruck.Sheescapedherflattenedcarwithminorheadtrauma,gratitudethatherchildrendidn’thaveto“burytheirdrunkmother,”andarenewedwilltosoberupandrediscoverhappiness. Today,she’sdonejustthat,thankstoacomprehensive,holisticapproachthatincludedhiringalifecoachthatspecializesinaddiction,overhaulingherdiet,makingtimefordailyphysicalandspiritualexercisesandreframingheraddiction,notasadiseasesheiscursedwith,butasapredispositionshehasthepowertokeepatbay.

“Yes.Iwaspassedagenebymyalcoholicfather.YetthatonlybecomesathreattomewhenImakeachoicetoingestsomethingthatcutsthebeastloose,”shesays.“Iworkhardeveryday,usingawholebunchofdifferenttoolstokeepthatfromhappeningagain.” Sheisoneofagrowingnumberofalcoholicsandaddictsreachingbeyondthestandardtrifectaof28-dayrehabs,12-stepprogramsandpsy-chotherapytowardanapproachthataddressesmind,bodyandspirit.Morethan40millionAmericansovertheageof12(16percentofthepopula-tion)areaddictedtoalcoholordrugs,accordingtotheNationalCenteronAddictionandSubstanceAbuseatNewYorkCity’sColumbiaUniversity.Yetthestandardtreatmentsyieldless-than-stellarsuccessrates. Sixtypercentofaddictsreturntodrugusewithinayearafterrehab,accordingtotheNationalInstituteonDrugAbuse,andonly5percentofAAattendeescontinuewithmeetingsafter12months,accordingtoAAresearch.DavidEssel,aFortMyers,Florida,lifecoachwhospecializesinworkingwithsubstanceabusers,saysthatwhenexaminingallthedata,onlyaboutonein10addictsoralcoholicsthatusecon-ventionalmeansalonearestillcleanafteroneyear.Fortunately,because

peoplevarywidelyinemotionalneedsandphysiologies,othercomplementaryoptionsarealsocatchingon.

MendingBrainandBodyEnteragroupmeetingforrecoveringad-dictsoralcoholicsandchancesaretherewillbeapotofblackcoffee,plusdonutsorcookies.“Havingpooreatinghabitsisaprimarycontributingfactortorelapse,”saysRegisteredDietitianDavidWiss,founderofNutritionInRecovery.com,whichprovidesnutritionconsultingforrecoveryprogramsinLosAngeles.Be-causesubstanceabusecandeadenappe-titeandmanyofthesameneurologicalcircuitsthatdrugsandalcoholstimulatearealsoactivatedbysaltyorsugar-ladenfoods,newlyrecoveringaddictstendtoberavenousanddrawntojunkfood.“Af-ter30daysintreatment,peoplecangain10to30pounds.Theyoftenturnbacktoaddictivesubstancesthey’veabusedtogettheirappetitebackundercontrol,”saysWiss.(Becausesmokingdeadenstastebuds,drawingpeopletoseekoutmoreintensesaltyorsugaryflavors,itexacerbatestheproblem.) Inasubconsciousattempttogetmaximumstimulationofnow-neglectedrewardcentersinthebrain,usersofteneatlittlemostoftheday,thenbinge later,leadingtoerraticbloodsugarlevelsthatcanimpactmood,furthersabotagingrecovery.Afteryearsofabuse,addictsalsotendtosufferdefi-cienciesofproteinsandgoodfats—keybuildingblocksofahealthybrain. “Thebrainhasbeenrewiredduetotheuseofsubstances.Withoutheal-ingit,youcanattendallthemeetingsintheworldandyou’llstillstrugglewithcravings,”reportsEssel.Hestartsnewclientswith500milligrams(mg)dailyofthedietarysupplementDL-phenylalanine,anaminoacidprecursortofeel-goodneurotransmitterssuchasnorepinephrine.Healsogivesthemtyrosine,anenergizingaminoacidsaidtoquellsugarcravings.Forrelievingacravinginprogress,herecommends500to1,000mgofglutamine,placedunderthetongue. Wisssayshegenerallyrecommendsfoodoversupplements,yetaskingnewlyrecoveringaddictstoalsorevamptheirdietscanbetough.“Iwouldn’texpectanyonetomakeabignutritionalchangeintheirfirstweekofsobriety,”hesays.

RETHINKING RECOVERY

Holistic Approaches to Healing Addictionsby Lisa Marshall

Page 23: Natural Awakenings Pensacola June 2015

23natural awakenings June 2015

Afterthat,heencouragessmallsteps:Drinkeightglassesofwaterperday.Eatthreemealsandthreesnackstokeepbloodsugarstable.Loaduponfiber,whichcanhelphealthegutandreplen-ishitwithhealthybacteria.Eatplentyofleanproteintopromoteproductionoffeel-goodbrainchemicals.Loaduponnuts,seeds,fattyfishandotheromega-3fattyacidsthatsuppressinflammationinthebrainandhavebeenshowninsomestudiestoquelldepression. DailyexerciseisalsokeyasWissnotesthatit“circulatesourbloodandgetsallthosehealthynutrientsinto ourbrain.” Physicalactivitiescanalsohelpfillthevoidandevenprovideanewsenseofidentityforsomeonewhoseself-esteemhasbeenshattered,saysScottStrode,founderofDenver,Colorado’sPhoenixMultisport,whichhostsgroupcycling,runningandclimbingoutingsforrecoveringaddictsandalcoholics. Strodekickedhisowncocainehabit18yearsagobyimmersinghimselffirstinboxing,thenclimbingandtriathlons.HefoundedPhoenixin2007tohelpfillwhatheseesasagapingholeinrecoverysupportservices—aplacewherepeople

withsimilarpastscangatherandtalkwithoutdwellingexclusivelyontheirdependenceissues.Hehassinceserved15,000peopleinColorado,California,andBoston,offering60freeoutingsaweekforanyoneatleast48hourssober. “Bybeingpartofsomethinglikethis,youcanletgooftheshameofbeingtheaddict,thejunkieortheonethatletdownthefamily.Nowyouaretheclimberorthemountainbiker,”saysStrode.HestressesthatPhoenixpro-gramsaren’tintendedtoreplacetreat-ment.Still,“Forsome,justthatredefin-ingofselfmaybeenough.Forothers,it’sapowerfultoolinabroadertoolbox.”

BeyondAACo-foundedin1935byanalcoholicnamedBillWilson,AlcoholicsAnony-mousnowhas2millionmembersandhasplayedanimportantroleinmanysuccessfulrecoveries.However,itsGod-basedapproach(fiveofthe12stepsrefertoGodorHim),acredothatalcoholicsmustadmit“powerless-ness”anditsemphasisonalcoholismasadefiningdiseasearen’tforevery-one.Naysayerspointtoa2006findingbythenonprofitCochraneCollabo-rationthatstates,“NoexperimentalstudiesunequivocallydemonstratedtheeffectivenessofAAor12-stepap-proachesforreducingalcoholdepen-denceorproblems.” Suchconcernshavepromptedsomealternativerecoveryfellowships,includingModerationManagement(Moderation.org),whichhelpspeoplethatwanttodrinkless;andSmartRe-covery(SmartRecovery.org),whichsup-portsanethosofself-empowermentviacognitivebehavioraltherapy,nutritionalchangesandgroupdiscussions.Otherprogramsfocusonrenewingthesoulbyapplyingmetaphysicalpracticestothetraditional12steps.

Physical activities can also help fill the void and even provide a new sense of identity for someone whose self-esteem has been shattered, says

Scott Strode, founder of Denver, Colorado’s Phoenix

Multisport.

Page 24: Natural Awakenings Pensacola June 2015

24 Natural Awakenings of Northwest Florida www.NWFNaturally.com

communityspotlight

“Theconventional12stepstalkaboutahigherpoweroutsideofyou,”saysEsterNicholson,asinger,authorandaddictionscounselor.InherbookSoul Recovery: 12 Keys to Healing Addiction,shedescribesadescentintocrackcocaineaddictionbeginninginherteens,andthelongclimboutofit. Atfirst,shesays,the12stepshelpedherbreakfreeofwhatshecallsthe“spiritualmalady,mentalobsessionandphysicalallergy,”thatisaddiction.Butafteradecadeofbeingclean,fol-lowedbyanear-relapse,shediscoveredmeditationandotherspiritualpractices.“Irealizedthatthishigherpowercanrestoremetosanity,butthehigherpowerisactuallywithinme.Ifoundthiswonderfulbridgebetweenthe12stepsanduniversalspiritualprincipals,anditisrockingmyworld.” PattiLacey,54,anEsselclient,like-wisefoundlastingsobrietybyextendinghertoolbox,learningtofocusnotonly

Earacupuncture: Since 1974, ad-diction specialists have used an ear

acupuncture needling protocol to ease cravings, decrease anxiety and improve sleep during withdrawal. Numerous published studies in The Lancet, the Ar-chives of Internal Medicine and others support its efficacy. More than 1,000 U.S. programs now use it, according to the National Acupuncture Detoxifica-tion Association (AcuDetox.com). Neurofeedback: AlsoknownasEEGbiofeedback,thistechniqueuseselectroencephalographysensorsattachedtotheheadtoenablesomeonetoob-servetheirownbrainwaveactivityonacomputerandlearntointentionallyalteritviavisualizationandrelaxationtechniques(isnr.net). Aromatherapy: LifecoachDavid Esselrecommendsthreearomatherapyoilstoclientsinrecovery:lavender,arelaxant;lemongrass,forenergy;andfrankincense,amood-balancer. Ibogaine: ThispsychoactivebrewderivedfromtheWestAfricanshrubTabernanthe ibogahasbeenusedcer-

Complementary Healing Toolsby Lisa Marshall

emoniallyforcenturies.Inthe1960s,anopioidaddictaccidentallydiscov-eredthatafterexperiencinganintense,four-to-eight-hourdreamlike“trip”,hiscravingsforheroinceased.DeborahMash,Ph.D.,aprofessorofneurologyandmolecularandcellularpharmacol-ogyattheUniversityofMiami,traveledtoAmsterdamintheearly1990stoseeiftherewasanytruthtosuchcases. “Isawamanthatwasonheroinandcocaineandaddictedtobenzo-diazepinesundergodetoxwithnowithdrawalsigns,andin36hourslooklikeanewperson,”sherecalls.Shehasbeenstudyingiteversince.Thedrugisbelievedtoserveasanaddictioninter-rupter,actingonopioidreceptorsinthebraintoquellwithdrawalsymptoms.Somedescribeitas“resettingthebrain”toapre-addictedstate. IbogaineisillegalintheU.S.Someoffshoreclinicsareprovidingit,butMashwarnsthatsomeareunscrupulous,sobuyerbeware.(ClearSkyIbogaine.com offersmedicallysupervisedIbogainetherapyinCancun,Mexico).

onpastpain,butonbringingforthherbestself.AccordingtotheInternationalCoachFederation,whichreportsanuptickininterestinrecoverycoaching,acoachhelpstoestablishindividualgoalsandmapajourneytosuccess. Twoyearsintorecovery,Laceystilltakeshersupplementsdaily,risesatdawntomeditate,attends12-stepmeetingsandispartofanondenomi-nationalchurchcommunity.Shealsoregularlymeetswithhercoachtoreportprogressandupdategoals,includinggettingahandleonherfinances,afre-quentcasualtyofaddiction.“Everybody’sjourneyisdifferent,”Laceyconfirms.“WhatIneededwassomeonetotellmeexactlywhattodointhebeginning,andthenbearoundtoholdmeaccount-able.Thatchangedeverything.”

Lisa Marshall is a freelance health writer in Boulder, CO. Connect at LisaAnnMarshall.com.

Natural Awakenings’ healthy living, healthy

planet lifestyle app has a new look and

more features.• Updated every month with new content• Search the healthy products in our

National Directory• Find your local magazine• Read feature stories En Español• Sign up for Promotions and Newsletters• So much more!• And it’s FREE!

IT JUSTKEEPS

GETTINGBETTER!

Search “Natural Awakenings”

and download

Page 25: Natural Awakenings Pensacola June 2015

25natural awakenings June 2015

In her book, Soul Recovery: The 12 Keys to Healing Addiction, Ester

Nicholson offers a metaphysical take on the 12 steps. Here’s a look. You are the Power. Through my conscious union with the infinite uni-versal presence, I am powerful, clear and free. Through the realization that God is within me, expressing as me, my life is in divine and perfect order. Restored to wholeness. Through my conscious connection with the one power, I reclaim my spiritual dominion and emotional balance. I am restored to my original nature of clarity, peace and wholeness. I am restored. Complete surrender. I turn my life over to the care of the God I under-stand, know and embody as love, harmony, peace, health, prosperity and joy. I know that which I am surrender-ing to, and I do so absolutely. Knowing that this power is the very essence of my being, I say with my whole heart and mind: Thy will be done. An examined life. Through my absolute surrender and conscious con-nection to the one power and presence, I courageously, deeply and gently search within myself for all thought patterns and behaviors that are out of alignment with love, integrity, harmony and order. Living out loud. I claim the cour-age and willingness to share the exact nature of my mistakes with another spiritual being. I am heard with com-passion, unconditional love and wisdom. In this loving vibration, clarity, peace and balance are restored. Honoring the inner child. I am now ready to release all thought patterns and behaviors

unlike my true nature, which is whole-ness. I free-fall into the loving presence of spirit within, and allow it to heal every known and unknown false belief. I am transformed by the renewal of my mind. Never give up. In loving compas-sion for every aspect of my being, I humbly surrender to the love of spirit. I know myself as a perfect expression of life. I surrender all, and I am restored to the life I am created to live. Willingness. I acknowledge the people I have offended based on false beliefs, fear, doubt and unworthiness. I am willing to go to any lengths to clean up my side of the street. Cleaning up the wreckage. Backed by all the power of the universe, I lovingly, directly and honestly make amends in a way that supports the highest good of all concerned. Spiritual maintenance. I am in tune with my inner self. With integrity, love and self-compassion, I acknowl-edge my mistakes and continue to clean up the mistakes of my past and present. Conscious contact. Through daily prayer and meditation, I deepen my conscious connection to the divine and experience the fullness of the uni-versal presence as the dynamic reality of my life. Loving service. Through my awakened consciousness, I am now prepared to carry the message of truth out into the world. I am now a clear channel to support the awakening

of others to their true identity of wholeness.

Recovery at the Deepest Soul Level

We Have an Inalienable Right to Know What We’re

Eating

Advertise in Natural Awakenings’

July Food Democracy and Inspired Living

Issue

To advertise or

participate in our

next issue, call

850-687-0825

Page 26: Natural Awakenings Pensacola June 2015

26 Natural Awakenings of Northwest Florida www.NWFNaturally.com

No person, no place, and no thing has any power over

us, for “we” are the only thinkers

in our mind. When we create peace, harmony

and balance in our minds, we will find

it in our lives.

~Louise L. Hay

Addiction always runs the show. It takes up space in an

individual’s life until their vitality has all but vanished and inevitably takes a toll on the lives of those that are involved with the ad-dict. Addiction spreads out wider and wider, wherever there is a vacuum to fill. The recovery process requires in-depth work with tools such as therapy, 12-step programs or support groups. In this phase, the recovering individual is able to shed their old skin and create a new life. As crucial as it is to go through this process thoroughly, it is also indispensable to develop a vision to point one’s compass. In paral-lel to recovery, another process has to begin: the process of discovery. As the addiction is being weeded out, it leaves a new vacuum. It is labori-ous for a recovering addict to resist the call of addiction if that vacuum persists. Voltaire said, “Let us cultivate our garden.” During the process of recovery, the garden is made ready for new plants. There starts a fresh phase of exploration and selection. Where and when should the new seeds be planted? What flowers? This novelty and a new freedom may often be daunting, and is threatening to those whose lives had

revolved around the addic-tion. The discovery pro-cess at first may appear less demanding. It requires a great deal of support and dedication—friends, a coach or a group of people, that share common interests and help create structure and accountability to fill the vacuum. This requires

the individual to step into uncharted territory and out of their comfort zone. Joining a gym, making new friends or starting different activities have their own challenges. Nurturing practices are the seeds to a new life. During this phase, the new habits and behaviors take root, the person gains self-esteem, adopts positive thoughts and feels their en-ergy level increase. There is joy in the process of discovery, for it is here the blooming is found.

Florence Doisneau is a certified life coach providing tools and practices to realize a meaningful, joyful and authen-tic life. She holds a master’s degree in management and bodywork therapies; is in training as a NLP practitioner; and is a 200-hour certified yoga teacher. Contact her at [email protected] or RealizeUnlimited.com.

BEYOND ADDICTIONRe-Root Through Discovery

by Florence Doisneau

Florence Doisneau

Page 27: Natural Awakenings Pensacola June 2015

27natural awakenings June 2015

The essential promise of consumer-ism is that everything fulfilling or needed in life can be purchased—

from happiness to healing, from love to laughter and from raising a child to caring for someone at the end of life. What was once the task of relatives and neighbors has been outsourced, cost-ing the family its capacity to manage traditionally provided necessities. The community, which once provided an extended support system, is no longer viable, replaced by paid professionals and technology. Until the 20th century, the basic philosophy of rearing children was that they become effective grownups by connecting with productive adults and learning the community’s skills, tradi-tions and customs from them. Youth had jobs to do: caring for the elderly and young, doing household chores and helping with food. When they be-came adults, they were thus equipped to care both for the next generation and for those that had cared for them. Today, the most effective com-munities are those in which neighbor-hoods and residents have reclaimed their traditional roles. The research on this point is decisive. Where there are “thick” community connections, there is positive child development. Health

inspiration

HIDDEN TREASURESNeighbors Discover Their

Wealth of Resourcesby John McKnight and Peter Block

improves, the environment is sustained and people are safer and have a stron-ger local economy. We too, can decide to shift our at-tention toward rebuilding the functions of our family and neighborhood. We have the gifts, structures and capacities to substitute for our habit of consump-tion. Here’s an example of how it works. Neighbors Naomi Alessio and Jackie Barton were talking about fam-ily challenges when Alessio noted her son Theron’s encouraging turnaround after he met Mr. Thompson, who had a metalworking shop in his garage. The old man invited him in and something clicked. Theron began to stop by every day, proudly bringing home metal pieces he’d learned to make. Alessio could see Theron change and finally stopped worrying about what he was doing after school. Barton admitted that her son Alvin was in trouble, and asked Alessio if there might be someone in the neigh-borhood whose skills would interest him. They decided to ask all the men in the neighborhood about their interests and skills. In three weeks, they found men that knew about juggling, barbe-cuing, bookkeeping, fishing, hunting, haircutting, bowling, investigating crimes, writing poems, fixing cars,

weightlifting, choral singing, teaching dogs tricks, mathematics, praying and how to play trumpet, drums and the saxophone. They discovered enough talent for all the kids in the neighbor-hood to tap into. Three of the men they met—Charles Wilt, Mark Sutter and Sonny Reed—joined Alessio, Barton and Thompson in finding out what the kids on the block were interested in learn-ing. Also, why not ask the kids what they knew? They found 22 things the young people knew that might be of interest to some adults on the block. The six neighbors named them-selves the Matchmakers and began to connect neighbors that shared the same interests, from gardening to job opportu-nities. They created a multiuse neighbor-hood website. Many neighbors formed a band, plus a choir led by Sarah Ensley, an elder who’d been singing all her life. Charles Dawes, a police officer, formed an intergenerational team to make the block a safe haven for everyone. Then Lenore Manse decided to write family histories with photos and persuaded neighborhood historian Jim Caldwell and her best friend, Lannie Eaton, to help. Wilt suggested that the Matchmakers welcome newcomers by giving them a copy of the block history, and then updating it with information about each new family. Three years later at the annual block party, Barton summed up the neighborhood’s accomplishment: “All the lines are broken; we’re all connect-ed. We’re a real community now.” These local connections can give the modern family what the extended family once provided: a functioning community with a strong culture of kin, friends and neighbors. A regenerated community emerges, yielding essential qualities of a satisfying life: kindness, generosity, cooperation, forgiveness and the ability to nurture families that have reclaimed their function.

Adapted from an article by John McKnight and Peter Block for YES! Magazine that appears in its anthology, Sustainable Happiness. They are co-authors of The Abundant Commu-nity: Awakening the Power of Families and Neighborhoods (Abundant Community.com).

Page 28: Natural Awakenings Pensacola June 2015

28 Natural Awakenings of Northwest Florida www.NWFNaturally.com

In1977,twoYaleSchoolofMedicinescientistsidentifiedtheinfectedblack-leggeddeertickcarryingthebacterium

Borrelia burgdorferiasthedisease-trans-mittingorganismofLymedisease.Since1982,thismostcommonlyreportedvector-bornediseaseintheU.S.hasgainednotoriety,withitsownresourcebook,Disease Update: Science, Policy & Law;researchcenter(Columbia-Lyme.org/index.html);InternationalLymeandAssociatedDiseasesSocietywebsite,il-ads.org;Lyme Timesprintjournal(Lyme-Disease.org);andnationalinformationalorganization,theTick-BorneDiseaseAlliance(TBDAlliance.org). Thesurgeofactivityappearsjus-tifiable.AccordingtoscientistsattheCentersforDiseaseControl,approxi-mately300,000casesarediagnosedannuallyinthiscountryalone. AmyTan,authorofThe Joy Luck Club,isapost-treatmentLymediseasepatientandco-founderofLymeAid 4Kids(Tinyurl.com/LymeAid4Kids) thatfundsthediagnosisandtreatmentofuninsuredchildrenwithLyme. She disagreeswithphysiciansthatdown-playlate-stagecasesandinsistthatthediseaseiscuredwithasimpleroundofantibiotics,asdoes KatinaMakris,aclas-sicalhomeopathfromNewHampshireandhostofLyme Light Radio.

healingways

Afterexperiencingmysterioussymptoms,MakrisspentfiveyearssufferingfromdebilitatingsymptomsfamiliartoindividualswithLyme—un-diagnosed,relapsingfevers,lingeringfatigue,jointpain,headaches,neuro-logicalsymptomsandcognitiveimpair-ment.“ThenIfinallybeganmy10-yearhealingjourney,”shesays.HerbookOut of the Woods: Healing from Lyme Disease for Body, Mind, and Spirit, is arecoverymemoirandresourceguideforalternativemedical,emotionalandspiritualsupport. Lymeevadesdetectionbystandardbloodtestsforbacterialantigensandantibodies.“TheELISA[enzyme-linkedimmunoassay]testisonlyaccuratebe-tweentwoweeksandtwomonthsafterthebite,”saysMakris,whonotesthattheWesternBlottestissomewhatmoreac-curate,whiletheIGeneXLaboratorytestissuperior.Shebelievesthebestlabora-toriesfortestingareClongenLaborato-riesandIGeneXLaboratoryServices. Dr.RichardHorowitzhastreatedmorethan12,000Lymediseasepa-tientsasmedicaldirectoroftheHudsonValleyHealingArtsCenter,inHydePark,NewYork.Theauthorof Why Can’t I Get Better? Solving the Mystery of Lyme and Chronic Disease raisesanotherredflagregardingdetection.

Don’t Get Ticked OffNatural Ways to Avoid and

Treat Lyme Diseaseby Linda Sechrist

JANUARYwhole systems healthplus: energy boosters

FEBRUARYenlightened relationships

plus: healing griefMARCH

animal rightsplus: new healthy cuisine

APRILnature’s wisdomplus: healthy home

MAYbreast health

plus: natural birthJUNE

healing addictionplus: balanced man

JULYfood democracy

plus: inspired living AUGUST

parenting with presenceplus: creativitySEPTEMBERagelessness

plus: yoga benefitsOCTOBER

working togetherplus: natural antidepressants

NOVEMBERtrue wealthplus: beautyDECEMBER

prayer & meditationplus: holiday themes

editorial calendar2015

Page 29: Natural Awakenings Pensacola June 2015

29natural awakenings June 2015

TestingforcoinfectionsfrequentlytransmittedalongwithLymeisunreli-able.Horowitz,whowillconductaworkshopwithMakrisatNewYork’sOmegaInstituteforHolisticStudies,inRhinebeck,andonline,fromJune26to28,counselsthatantibioticsarenotef-fectivebecausetheydon’taddressalloftheinfectingorganismsnowfrequentlyfoundinticks. StephenHarrodBuhner,ofSilverCity,NewMexico,anindependentscholarandcitizenscientistandauthorof Healing Lyme Disease Coinfections, saysthatthebacteriahavejumpedspeciesandfoundnewhoststhatliveinhabitatsformerlyoccupiedbywildanimals:“Theyhavelearnedtoexistinhumansandareteachingeachotherhowtoresistantibioticsandmoreeas-ilyinfectus.Whattheydotogetherinthebodyisagreatdealmorecomplexthanwhattheydoalone,makingthemdifficulttotreat.Bartonellaspeciesutilizetheimmunesystemofwhatevermammaltheyinfectaspartoftheirinfectionstrategy.Anyexistinginflam-mationinthebody,suchasarthritis,facilitatesthegrowthofBartonella.”

Theweakerormorecompromisedone’simmunesystem,themorelikelyadebilitatingcourseofillnesswilloc-cur.Animprovedimmunesystemcanidentifytheoutermembraneproteinsoftheoffendingbacteriaandcreatecounteringantibodiesinfourtoeightmonths.“Oncetheimmunesystemcre-atestheproperantibodies,thebacteria

Essential Oils to Repel Ticks

1 cup distilled water2 drops geranium essential oil2 drops Palo Santo essential oil1 drop myrrh essential oil4 drops grapefruit essential oil1 drop peppermint essential oil1 drop Thieves hand soap or castile soap

Placeallingredientsinaspraybottleandshake.Spritzonsocks,sneakers/hikingboots,anklesandlegsatamini-mumandconsiderotherexposedskin.

aretheneliminatedfairlyrapidly,”advisesBuhner. Makrisisgratefulthatshesawanu-tritionisttrainedinfunctionalmedicine.“Heworkedslowlyandmethodicallytoreducetheinflammation,buildupmyimmunesystemandrestoremydiges-tive,endocrineandnervoussystemsbe-forekillingthebacteriaandopeningupnaturaldetoxificationpathwaystoflushoutthebacteriaandtheirendotoxins.Weusedweeklyacupunctureappoint-ments,goodnutritionandhomeopathicformulas,plusvariousherbs,vitaminsandmineralsupplements,”saysMakris. Ticksinhigh-vegetationareaswaitforapassinghost.Toavoidthesehitchhikers,wearlight-coloredlongpantstuckedintosocks.Ashirtshouldalsobetuckedin.Later,stripdownandsearchhair,underarms,legs,behindthekneesandears,andinthebellybutton.Ascommercialtickrepellantscontaintoxicingredients,atargetedmixture oftopicallyapplied,therapeutic-gradeessentialoilsispreferred.

Linda Sechrist is the senior staff writer for NaturalAwakenings.

Featuring weekly workshops taught by knowledgeable local specialists on a variety of topics including

sustainable gardening, aromatherapy, herbal medicines, beekeeping, soap making, kombucha, and ke� r.

PLEASE READ OUR CALENDAR LISTINGS FOR MORE DETAILS AND HOW TO REGISTER FOR THE WORKSHOPS.

Featuring:Over 210 bulk herbs always in stockOver 40 loose teas and herbal coff ee

Cross contamination free gluten free foodsLarge selection of therapeutic grade essential oilsGluten free, raw beauty and body care products

PARTNERSHIP WITH MOSIER FARMS FORBIWEEKLY RAW MILK AND GRASS FED BEEF

Esther’s Garden of Healing8184 Navarre Parkway“Directly next to ACE Hardware in Navarre”[email protected]

Encouraging our Local Community toLive a Natural Life

SPECIALIZING IN ONEONONE PERSONAL CARE

BEFORE YOU POP THAT PILL

6/9/2015 • 6:30 – 8:30pm • FREE

OVERVIEW TO HERBAL MEDICINE6/12/2015 • 6:30 – 8:30pm • $25/person

KING OF OILS – FRANKINCENSE6/23/2015 • 6:30-8:30pm • FREE

COOKING FOR INFLAMMATION & VITALITY 6/27/2015 • 12:00 – 2:30pm • $20/person

Page 30: Natural Awakenings Pensacola June 2015

30 Natural Awakenings of Northwest Florida www.NWFNaturally.com

Fathersaremoreinvolvedintheirchildren’slivesthaneverbefore,embracingtheirrolesofleader,

nurturerandprotector,andthey’rereap-ingextraordinarybenefits.Accordingtoa2014studypublishedintheAcademy of Management Perspectives,fathersthatspendmoretimewiththeirkidsarebothhappierathomeandmoresatisfiedatwork.Today,manymindfuldadsengagedinanaturallifestyleapplythatsamehealthconsciousnesstotheirparenting. Support Mama. Naturalfathering beginsduringpregnancy,withaninformedbirthplan.“Supportwhat-everbirthingdecisionthewomanfeelswillprovideherthemostcomfortandrelaxation,”advisesDr.JohnDouillard,anayurvedicchiropractorandauthorofsixbooks,includingPerfect Health for Kids.Holdherhand,rubherback,advocateforherrightsandafterthebirth,supporthereffortstobreastfeedwhenever,whereverandhoweverlongshewants. “Fathersshouldrecognizethattheburdenofcareisclearlyonthemotherforatleastthefirstyear,soheropinionsandwishesdeservespecialconsider-ationandrespect,”saysBenHewitt,fatheroftwo,homeunschoolerandauthorofThe Nourishing Homestead. Embrace physical closeness. Bond-ingthroughnurturingtouchispowerfulandrewardingforfatherandchild.ArecentstudypublishedintheJournal of Perinatal Education foundthatfathersthatpracticedinfantmassageexperiencedsig-nificantstressreleaseandbondingwiththeiroffspring.Wearingababyortoddler

Natural DADSHow They Raise Conscious Kids

by Lane Vail

healthykids

inasling,wraporcarrierisanothercom-fortingwaytospendtimetogether. Co-sleepinghelpsfosteramorenaturalsleeprhythmwithanocturnallyhungrybaby,whilealsoofferinganotherwaytoconnect.“Anystressmyfamilymayhaveexperiencedduringthedaydissipatedwhenwereconnectedatnight-time,”Hewittattests.“Lookingback,Ican’timaginehavingmissedoutonthatopportunitytobesoclosewithmykids.” Feed healthy habits. NaturaldadsareeducatedaboutbothnaturopathicandWesternmedicinetomakeinformedchoicesregardingpreventionandinter-vention.Douillardappliestheayurvedicprincipleofseasonaleatinginordertobolstertheimmunesystemsofhissixchildrenandclients.Coolingfoodslikefruitsandvegetablesinsummerpreventoverheating;warmingfoodslikesoups,nutsandmeatsinwinterlubricatemucusmembranesandfacilitatefatandproteinstorage;lightfoodslikeleafygreensinspringdetoxifythebody.Hisexperienceisthatwhenkidswithrobustimmunitycatchtheoccasionalmalady,itsseverityanddurationarereduced,andnaturalherbsoftenprovideagentlefirststeptowardrecovery. Douillardtreatscoldswithaspoonfulofequalpartsturmericandhoneymixedintoapaste.“Turmericisapowerfulanti-inflammatoryandantiviralherbthatalsohelpsliquefymucusintherespiratorytract,”hesays.Fortummytroubles,hesuggestsofferingkidsanherbalteaofcumin,corianderorfennel. Aboveall,parentsmustexemplifygoodhealthhabits.“Eatbetter,exercise

regularly,changeyourdietwiththelocalseasonandyourkidswillfollowalong,”saysDouillard. Impart green morals. Earth-con-sciousparentsteachtheirchildrenhowtoleaveafaintecologicalfootprintbysupportinglocaleco-friendlycompa-nies,reducingthepresenceoftoxicchemicalsinthehomeandconsumingandwastingless.However,waggingafingerandimploringkidstobeeco-friendlyisnotenough;modelhelpfulbehaviorsandillustratetheimplicationsoftheirchoices.“Insteadofsaying,‘Youshouldrecycle,’showkidsonlinepic-turesofthegiantflotillasofplasticspol-lutingtheoceans,”saysHewitt.Maintainanexperientialdialogueaboutrespect-ing,preservingandenjoyingnature. Encourage adventure and resource-fulness. “Historically,”saysHewitt,“childrenlearnedalongsidetheirparentsandcommunity,immersedintheirenvi-ronment,anarrangementthatallowedthemcontinualopportunitiestoprovetheirownresourcefulness.”Alldads,likehomeschoolers,willfindsatisfyingfuninsharingproblem-solving,hands-onproj-ectswiththeirkids,likebuildingadebrisshelterinthewoods,plantingagarden,orusingrepurposedmaterialstoengi-neersomethingwithformandfunction.Learningdoesn’thavetobeahierarchicalactivity,whereindadsteachchildren,saysHewitt.“Theopportunitytolearnandexploretogetherispowerful.” Play. Hewittencouragesdadstolookforopportunitiestorelievekidsoftheiroftenoverwhelmingandscatteredschedules.“It’sincrediblyimportantforkidsandadultstosetasidetimeforfreeplayandexploration,”hesays. “Gooutsidewiththem,”says Douillard.“Makeupgames,goofoff,runaround,rollaroundandjustbewiththem.Itmakesaworldofdiffer-enceintheirlives.”

Lane Vail is a freelance writer in South Carolina and blogger at Discovering Homemaking.com.

When dads are calm and present, they become a

calming presence.

~Hal Runkel

Page 31: Natural Awakenings Pensacola June 2015

31natural awakenings June 2015

Cool Daddyby Lane Vail

Intermsofdiscipline,naturalfatheringisneithertoughnortimid,punish-ingnorpermissive.Themindfuldadiscalm,connectedandcapable.He’sabletoharnessintrospectionandob-servehimselfasheparents,becausehefocusesmoreonmanaginghisownbehaviorthanthatofhiskids. “Fatheringisaleadershiprole,notamanagementrole,”saysHalRunkel,alicensedmarriageandfamilytherapistandauthorofthebestsellerScreamFree Parenting.“IfImanagemyselfwithcalmnessandclarity,Icanleadmychildrentolearntomanagethemselves.” Runkelsaysthefirststepis“committingtocool.”Findananxi-ety-oranger-managingtechniquethatfeelsnatural,suchasmeditation,yoga,deepbreathing,visualiza-tion,prayerorcountingbeadsonabracelet,andcallonthatskilltomaintaincoolnesswhenchallengedbyachild,advisesRunkel. It’samisconceptionthatemo-tionsneedtobereleasedortheywillconsumeus,hesays.“Emotionsjustare;it’sthethoughtsaboutemo-tionsthatdriveuscrazy.”Learningtoname,tameandbefriendfeelingsthroughintrospectionandmindfulexercisesallowsspaceforcalmcon-versationswithchildrentoemerge. “Wefathershaveaspecial responsibilitytoleadwithcalm becausewearephysicallyimposinginchildren’seyes,”hesays.“The approachabledadhasteachablekids,andheletsnaturalandlogicalconsequencesdotheteaching.”

Manmaintainshisbalance, poiseandsenseofsecurity onlyasheismovingforward.~MaxwellMaltz

WHAT IS D’OXYVA®? D`OXYVA® is designed to signifi-cantly increase sustained oxygen-rich microcirculatory blood flow locally, and throughout the body.

HOW DOES IT WORK?D`OXYVA®'s proprietary, patent-pending method of increasing mi-crocirculation is attained through a transdermal delivery system unique to D`OXYVA®.

Mainly due to the unmatched increase in blood circulation, cel-lular oxygenation, tissue perfusion in the microvessels, and neural signal activation, based on years of user feedback and various high quality research that includes a four-month-long study on dozens of people at Penn State University, D`OXYVA® has shown significant improvements of cardiovascular activity, leading to much improved physical activity, which as part of a healthy lifestyle, may help signifi-cantly reduce the risk of high blood pressure, hypertension, cholesterol and diabetes in just two or three months with an average use of five minutes a day five times a week.

Optimize Microcirculation for Health, Beauty & HappinessPoor circulation is a gateway for a litany of ailments: slow healing, depression, poor complexion, sores and slow metabolism.

WHAT ARE THE HEALTH BENEFITWhen used daily, D`OXYVA® users have reported a number of health and beauty benefits, including but not limited to:

• Relief from symptoms of microvas-cular complications.

• Significantly increased cardiac function, physical fitness, endur-ance and strength, muscle size, body tone, faster recovery from sports injuries and surgical trauma.

• Improved self-esteem via pro-moting healthy and radiant skin, complexion, dry skin relief, and acne reduction.

• Significant reduction in downtime from other skin treatments and cosmetic procedures when used in combination, reduction in the appearance of scars, cellulite, fat, spider veins and stretch marks.

• Promoting and maintaining a healthy weight, improving general mobility and a deeper, more restful sleep.

• Significant improvement of mental acuity; concentration, problem solv-ing, multitasking, eye-hand coordi-nation, heightened stamina, energy and focus while managing stress.

• Improved vitals across the board dur-ing checkups with zero adverse event reports after years of regular use by people with various health, demo-graphicand ethnic backgrounds.

---Advertorial---

www.DOXYVA.com

Page 32: Natural Awakenings Pensacola June 2015

32 Natural Awakenings of Northwest Florida www.NWFNaturally.com

The United Nations has declared June 21 the

International Day of Yoga, co-sponsored

by 175 countries including the United States.

fitbody

Five thousand years ago, most yoga teachers and students were men. Today, of the 15 million American

practitioners, less than a third are males. However, this figure has increased in the past decade, with teachers in some areas reporting a balanced ratio of men and women in their classes. Yet, even as professional athletes add yoga to their training regimen, Power Yoga founder Bryan Kest, in Santa Monica, California, points out, “To the mainstream man, yoga is not masculine. You see men in ballet performances, but it doesn’t mean men are at-tracted to ballet.” Eric Walrabenstein, founder of Yoga Pura, in Phoenix, agrees. “To achieve the widest adop-tion of the practice, we need to shift away from the notion that yoga is a physical exercise primarily for women, to one that em-braces yoga’s holistic physi-cal, mental and emotional benefits for anyone regardless of gender.”

Life Benefits Physically, yoga can comple-ment traditional workout rou-tines by increasing flexibility, strength and balance, and also play a role in pain management and injury prevention. Kest says, “Yoga is the best fitness-related activity I know of, but the tone and shapeliness that results is a byproduct. The focus is on bal-ance and healing.” He encourages students to challenge themselves without

being extreme. “The harder you are on anything, the faster you wear it out. If our objective is to both last as long and feel as good as possible, it makes no sense to push hard. Instead we should be gentle and sensitive in our practice.” Men will do well to learn how to stop what they’re doing and breathe, says Kreg Weiss, co-founder of My Yoga Online (now on Gaiam TV), from Vancouver. He emphasizes the impor-tance of modifying poses as needed during classes and notes that doing so takes vulnerability that doesn’t come naturally to most men. “If you find yourself shaking while holding downward dog, allow yourself to go down to the floor without wor-rying about what others will think.” Societal pressures of mascu-linity sometimes dictate who a man thinks he should be. Breaking through such barriers enables a

man to be relaxed with himself and unafraid as, “It changes what goes on off the mat, too,” observes Weiss. Bhava Ram (née Brad

Willis), founder of the Deep Yoga School of Healing

Arts, in San Diego, points out, “Men need yoga be-cause it helps us deal better with

stress and emotional issues. When we have more inner bal-ance, we show up better for ourselves, spouses, friends and loved ones.”

Therapeutic BenefitsAs modern science begins to document yoga’s healing effects, it’s being used in treatment plans for conditions ranging from addiction and trauma to multiple sclerosis and cancer. Ram was a Type A

Yoga for the BrosMen Find it Builds All-Around Fitness

by Meredith Montgomery

Letyourlife lightlydance ontheedges oftimelike

dewonthetip ofaleaf.

~RabindranathTagore

Page 33: Natural Awakenings Pensacola June 2015

33natural awakenings June 2015

aggressive reporter and network war correspondent and, “Like many men with similar personality types, I struggled with anger and control issues. I had no interest in yoga; it seemed strange and unnecessary to me,” he recalls. After a broken back, that ended his journalism career, failed surgery, advanced cancer and dependance on prescription drugs, he found himself facing death. Inspired by his young son to take control of his health, he em-braced yoga as a healing way forward. After two years of dedicated practice, Ram says he turned 80 pounds of physical weight and 1,000 pounds of emotional toxins into gratitude, for-giveness and loving kindness. “I left 90 percent of my back pain behind and the cancer is gone.” Kest explains that yoga’s sig-nificant therapeutic value is based on its capacity to reduce stress and its effects, while teaching and strengthen-ing techniques to cope with it. “Ninety

Yoga Helps Vets Healby Meredith Montgomery

According to the In-ternational Journal of

Yoga Therapy, an essential aspect of recovering from trauma is learning ways to calm down, or self-regu-late. As suicide, divorce, domestic violence, drug abuse, homelessness and violent behavior continue to plague veterans and members of the military, yoga is being regarded as a promising treatment or adjunctive therapy for addressing symptoms associated with trauma and post-traumatic stress disorder (PTSD). Numerous studies indicate that veterans that practice yoga (including postures, breath work, guided visualiza-tion and affirmation) can better cope with PTSD and other emotional chal-lenges, and realize enhanced physical and mental stability. Former war correspondent Bhava Ram founded Warriors for Healing (W4H). Launched online and through trained teachers this year, “We want

percent of the stress we put on our bodies originates in the stress we put on our minds,” he says. “If you want to be healthy, you have to look at mental fitness, not just the size of your biceps or the strength of your cardiovascular system. It’s calmness and peacefulness of mind that matter.”

Tips for First-TimersWeiss urges men new to yoga to take time to find the right class. “When men that can’t touch their toes walk into some preconceived notion of a class full of women Om-ing, they feel apprehensive and the experience does them no ser-vice.” Regardless of one’s state of fitness, it’s important to start slowly, with a focus on the breath. “If you don’t have a good foundation, you can miss a lot of yoga’s benefits. Seek teachers with a solid yoga background educated in anatomy.” Walrabenstein recommends that first-timers find a class that meets their expectations of targeted benefits. “Re-

member that yoga is supposed to serve you in enabling your best life possible. If for you that means a vigorous work-out, go for it. Even the most physically-oriented yoga styles can carry profound mental and spiritual benefits—and can lead to a deeper, more rewarding prac-tice over time.” Arrive early to class to get settled and talk with the teacher about physi-cal status, potential limitations or other concerns. Yoga is practiced barefoot and clothing should be loose and com-fortable, allowing the body to sweat and move. Walrabenstein reminds men to have fun. “Yoga, like anything, can be awkward at first. Make space for your learning curve and remember, no one in class is judging you.”

Meredith Montgomery, a registered yoga teacher, publishes Natural Awakenings of Mobile/Baldwin, AL (HealthyLivingHealthyPlanet.com).

to spread the word that yoga science is proven to be extremely effective for coping with PTSD and life-based trauma,” he says. The intention is to help people unlock their inherent power to heal, and to assist in a journey of self-empowerment as they establish new lives. W4H and its foun-

dation partners provide resources for veterans and their families to imple-ment yoga’s transformational lifestyle practices, including nutrition, philoso-phy, breath work and postures. Studies from leading institutions including the University of California, Harvard Medi-cal School and Massachusetts General Hospital have shown that these prac-tices can change the organism that is us down to the level of our genomes. “We’re not stuck where we are,” says Ram. “My own history illustrates this, and I’ve seen many others heal from remarkable challenges.”

Bootstrap, an online yoga system specific to the challenges of military du-ty-related stress, has distributed 70,000 yoga sessions to troops and veterans and their families since 2013. Designed to fill the many gaps left by traditional treatment strategies, it’s tailored to empower users to manage stressors and stressful episodes in a productive and ongoing way. Founder Eric Walrabenstein, a former U.S. Army infantry officer, notes that the program is curriculum-driven. Beyond breath and body postures, its 10-week structure makes it accessible to those that wouldn’t necessarily step into a studio. “The multimedia program has been clinically proven to derail chronic stress caused by military service in less than one hour per day,” he says. Bootstrap is presented as a stress-management program that just happens to use yoga techniques. “We did this because many men tend to self-select themselves out of the practice,” he says. “We wanted to avoid that as well as the idea that yoga is primarily about pos-tures, when that’s only a small fraction of what the practice is.”

Visit WarriorsForHealing.org and BootstrapUSA.com.

Page 34: Natural Awakenings Pensacola June 2015

34 Natural Awakenings of Northwest Florida www.NWFNaturally.com

phot

o co

urte

sy o

f Pa

t C

apoz

zi

greenliving

Mostofusareorientedtoatypi-calAmericanhouseaveraging2,300squarefeet,makingit

achildlikehoottostepintothepetitefootprintofatinyhouseone-tenththesize.Vacationrentalsof“tinies”areavailablenationwideinallshapesandstyles—includingtreetopaeries. Treehousesrangefromrustictoluxurious.MartiMacGibbonandherhusband,ChrisFitzhugh,spentaroman-ticweekendattheOut‘n’AboutTree-houseResort,inCaveJunction,Oregon.“ThePeacockPerchisafavorite,”saysMacGibbon.“Italsohelpsmeovercomemyfearofheights.” InHawaii,SkyePetersonbuiltatreehousefromrecycledmaterialsinfivena-tiveohiatreesoutsideHawai’iVolcanoesNationalPark.Theeco-friendly,solar-powered,passive-energyvacationhomeenchantsguestswithfirelightatnightandbreakfastinthemorning. Forthosethatpreferground-levelvacationing,glamorouscamping,orglamping,offersanoutdoorexperience

withthecomfortsofhome.YellowstoneNationalPark’sYellowstoneUnderCan-vashassummeroptionsforeverybudgetthroughSeptember7,includinganonsitegourmetrestaurant.Tipisofferthebasics,whilearoomiersafaritentaddsawood-burningstovewithcomplimentaryfirewood.Adeluxesuitewithprivatebathsleepsafamilywithking-sizeandsofabeds.Allfacemajesticviewsofmountains,waterandwildlife.RusticKarenville,eightmilesfromIthaca,NewYork,isn’tonanymap.OwnerandbuilderKarenThurnheerandherhusband,RobertWesley,liveina270-square-footcabinamidstasmallvillageoftiniesnexttothe9,000-acreDanbyStateForest.Thelittlebuildingsdon’thaverunningwater;somehavewoodstoveheat,electricityifthegen-erator’srunningandthere’sacompost-ingouthouse.“Thehousesaresillyandfun,”shesays.“There’sfreshairandatnightamillionstars.” SarahandJohnMurphywelcometravelerstoenjoyurbanlifewith

THE TEENY-TINY VACATION OPTIONMini-Dwellings Make Travel a Lark

by Avery Mack

Tiny vacation cottages offer a simple, cozy setting for taking time off together and spell crazy fun—ahuge improvement over sterilemotelrooms.

YesAcupuncture works on pets , too!

One of Pensacola’s ONLYCertified Veterinary Acupuncturists

TreaTing: Dogs • CaTs

Chris Lewis, DVM,CVACertified Veterinary Acupuncturist

Located at HiLLman Veterinary cLinic2101 N Palafox St • PeNSacola

[email protected]

• Pain Management

• arthritis• anxiety• Hip Dysplasia• Skin Problems• appetite issues

Also offering traditional Veterinary medicine

Laser Therapy avaiLabLe

Lettin’ the cat outta the bag is a whole lot

easier ‘n puttin’ it back in.~Will Rogers

Page 35: Natural Awakenings Pensacola June 2015

35natural awakenings June 2015

phot

o co

urte

sy o

f O

ut ‘N

’ Abo

ut T

rees

ort

amenitiesintheheartofMusicCityviaNashville’stiniestguesthouse.Withacompletekitchenandbath,conditionedairandWi-Fi,its200squarefeetcanaccommodatefour. RhodeIsland’sArcadeProvidencehistoricshoppingmalltookahitfromInternetshopping.Nowit’svibrantlyaliveasmicro-apartments(bedroom,bathandkitchenin300squarefeet)fillthesecondandthirdlevels,whilefirst-floorstorescatertoresidentsanddestinationshoppers.The“novacancy”signisregularlypostedforapartmentsactingasdormsorpied á terres. OntheWestcoast,nearthe150-acreLilyPointMarinePark,inPortRoberts,Washington,asecludedgin-gerbreadcottageaffordsagasfireplace,

Tiny Houses to GoArcadeProvidence.com

MiniMotives.com

MtUnderCanvas.com

MusicCityTinyHouse.com

TinyHouseHotel.com

TinyHouseTalk.com/Karenville

Tinyurl.com/Out-N-AboutTreesort

Tinyurl.com/SheSheds

Tinyurl.com/TinyGingerbreadCottage

VolcanoTreehouse.net

After stays in guesthouses and hotel rooms, a tiny house felt spacious, so I decided to build my own

as a home base.

~Lauren Juliff, professional travel blogger

solariumandupstairsdeckforviewingwildlife.“It’srelaxingandromantic,”saysownerPatCapozzi. Artsyandtrendy,CaravanisthefirsttinyhotelintheUnitedStates.Since2013,guestshaveenjoyedachoiceofitssixtinyhousesinPortland,Oregon’sAlbertaArtsDistrict. Simple-livingstudents,retireesandevenfamilieswithsmallchildrenandpetsareembracingtheconceptlonger-term.“Thebestpart,”saysMacyMiller,aBoise,Idahoarchitectwhobuiltherowntinyofrecycledmaterialsatacostof$12,000,“isnomortgage.”Toavoidlocalminimum-sizezoningrequirements,herhouseismountedonaflatbedtrailer.The196-square-footspaceisalsohometoherboyfriendJames,toddlerHazel,andDenver,a150-poundgreatdane.Recently,Millerblogged,“I’mdesign-ingwhatmaybethefirsttinynurseryasweexpectbabynumbertwo!” AsThurnheerobserves,“Therearelotsofsillypeoplelikemewholovelivingtiny.”

Connect with freelance writer Avery Mack at [email protected].

Areas Only Full Scale Juice Bar

with FreshWheat Grass and Ginger Shooters

Areas Only Farm to Table RestaurantFeaturing Local, Organic Produce, Grass Fed Beef, Poultry and Dairy, Gluten Free, Vegetarian and Vegan Options

850.865.4919120 Miracle Strip Pkwy, SESynergyOrganicCafeFWB.com

Owned and Operated byLongtime Local Chefs and

Holistic Nutrition and Lifestyle Specialists

Now Open in Historic Downtown Section of Fort Walton Beach

Open Tues- Saturday 8am-6pm

Nutritional and Holistic Life Style Programs for Groups and Individuals by AppointmentCooking, Juicing, Detox Classes and Workshops

120 Miracle Strip Pkwy, SENow Open in Historic Downtown

Cooking, Juicing, Detox Classes and WorkshopsCooking, Juicing, Detox Classes and Workshops

Free Wi-Fi

Areas Only Full Scale Juice BarScale Juice Bar

and Ginger Shooters

Featuring Local, Organic Produce, Grass Fed Beef, Poultry and Dairy, Gluten Free, Vegetarian and Vegan OptionsFeaturing Local, Organic Produce, Grass Fed Beef, Poultry and Dairy, Gluten Free, Vegetarian and Vegan Options

Areas Only Full Scale Juice BarScale Juice Bar

and Ginger Shooters

Yoga ClassesEVERY MONDAY 6PM AND TUESDAY 9AM

WITH AMY LIKINS AT NORTHWEST BALLET ANNEX

1st Friday of the MonthART WALK • OPEN TIL 8PM • DRINK AND FOOD SPECIALS

2nd SaturdaysFARMERS MARKET • 81PM • DOWNTOWN FWB

EXTENDED HOURS: 8AM6PM, TUESSAT. JUICE BAR HAPPY HOUR: 46PM DAILY!

This Month at Synergy

Amy Likins and Christian EcheleCall for class

times and schedule!

Learn the art of Juicing and Whole Food Meals

with Amy Likins

Use Vitamix Free Shipping Code: 06-007109

Page 36: Natural Awakenings Pensacola June 2015

36 Natural Awakenings of Northwest Florida www.NWFNaturally.com

Phot

o co

urte

sy o

f B

est

Frie

nds

Ani

mal

Soc

iety

naturalpet

Catslivelongerthesedays,duetoimprovedfood,regularveterinarycareandindoorliving,butthere’sanotheras-pectofhealthtoconsider.Tothrive,catsneedmentaland

physicalstimulation,whichoutdooradventuresnaturallydeliver. “Leashwalking’sagreatwayforcatstogetfreshair,exerciseandexplore,”saysUtica,NewYork,VeterinarianDebraM.Eldredge,authorofCat Owner’s Home Veterinary Handbook.Kitty’ssensesareactivatedinsuchexpanded horizons.Fortripsoutsidetheyard,Eldredgeadvises,“Chooseyourplacesandtimes;youdon’twanttominglewithjoggersandskateboarders.” Catshavedefinitepreferences.“Jaggerwalksaroundtheblockwithmyhusband,Rob,”saysAnnaEasteden,anactressinLosAngeles.Jaggerhasnoproblemswithdogshemeets,butnotallcatsaresotolerant.“Starwalksonlyintheyard,companionedbyFuzzyandBoots.”Allfouraremicro-chippedincaseofanescape. CarrieAulenbacher,ofErie,Pennsylvania,authorofThe Early Bird Café, firstgothercatDaisyusedtoaharnessindoorsbeforeventuringoutside.“Nowherunstothedoorandmeowstogoout,”shesays.Daisy’sbeenhikingfor10years.ViewsomeofhisadventuresatTinyurl.com/DaisyTheHikingCat. Bostoninsuranceunderwritingassistant,catbloggerandartistKoshkaKohroutinelywalksherAbyssiniantherapycat,Jake.“Wecan’thurry.Peopleaskquestionsandwanttopethim.Theysay,‘Iwishmycatcoulddothat.’”

Good to Know TipsTheBestFriendsAnimalSociety,inKanab,Utah,averages625catsinresidenceandSocietyManagerMichelleWarflesupportsanenrichedenvironment.“Weteachasmanycatsas

Walking The CatHarness a Curious Cat

for a Lively Strollby Sandra Murphy

Order online today atShopNaturalAwakenings.com

or call: 888-822-0246

A Few Drops Can Change Your Life!

You could feel better, lose weight or increase energy and mental clarity with a few drops of Natural Awakenings DETOXIFIED IODINE daily when used as directed. The supplementation of iodine, an essential component of the thyroid, has been reported to give relief from depression, hyperthyroidism, hypothyroidism, radiation, viruses and more.

$19.99 plus $5 shipping • 1 btl. = 6-8 week suply

Like us on Facebook at Natural Awakenings Webstore

Order online today atShopNaturalAwakenings.com

or call: 888-822-0246

Have a Stubborn Skin Disorder and

Tried Everything Else?Finally, there’s a solution: try Natural Awakenings’ DermaClear, a natural, affordable, skin repair salve.

DermaClear brings comforting relief to sufferers of many skin irritations. The cooling and soothing calcium mortmorillonite/calcium bentonite clay has been proven to be effective against:• SHINGLES • RASHES• PSORIASIS • ECZEMA• BURNS • JOCK ITCH• STINGS & MORE

4-oz jar $29.99 + ONLY $5 for shipping

Like us on Facebook at Natural Awakenings Webstore

Page 37: Natural Awakenings Pensacola June 2015

37natural awakenings June 2015

possibletoleashwalk,”shesays.Hertipsinclude:Don’tprog-resstooquickly,keepwalksfunanduseaharness,not thecollar.Warfle’sowncat,Earl,hikesabouttwomilesbeforetiring.Abackpack-likepetcarrierletsafelinetakeabreak. Adaptthewalk’slengthorlocationtoapet’sageandphysicallimitations,suchasarthritis.“JabezalwayslovedtowalkonVentura’swetsandybeaches,”saysCalifornianKacYoung,anaturopathwithaPh.D.innaturalhealth.“HissecondchoicewasatriptoHomeDepottorideinthecart.”Now18,Jabezdoesn’ttravelasoften. Routinelycheckkitty’sneck,tail,stomachandinnerthighstopickofffleasandticksafteranoutingbeforetheybecomeabiggerproblem.(Foraninfestationoffleas,combthecatwithnaturaldishwashingdetergentandwatertodrownthemandrinsekittyafterward.)Pet-gradediatoma-ceousearthissafetorubintoherfurandbedding. Consideryardplantslikemint,lemongrass,sageandlavendertorepelbugs.Multiplestudiessuggestcatnip,whichkittycanrollin,maybeanevenmoreeffectivemosquitore-pellantthanthetoxicDEET(mosquitoesspreadheartworm). Catcompanionsagreethatwhenkittyexploresabladeofgrassorpouncesonablowingleaf,itpresentsadelightfulopportunitytobeinthemoment.Achangeofpacebenefitsthoseonbothendsoftheleash.

Connect with Sandra Murphy at [email protected].

Cat Walk Savvyby Darlene Arden

n Catsneedtogetusedtoanideabeforeembracingit.Proceedslowly.

n AcollarisforIDtags,notwalking—acatcanwiggleoutofacollar.Aharness,properlyfittedatthepetsupplystore,isbest.Designateacomfortable,padded,widerharnesssolelyforwalking,nottorestrainthecatinthecar(acrateissafer).

n Letacatseeandsmelltheharnessbeforeputtingiton.Smalltreatshelp.Don’tletthecatbatitlikeatoy.Puttheharnessonforshortspanseachdayuntilhe’susedtoit—catstendtofallover,“paralyzed”,whenit’sfirstintroduced.

n Aftertheharnesshasbeenworncomfortably,addtheleashandlethimdragitaroundinanenclosedoutdoorspace.Neveruseaflexi-lead/retractableleash.Asix-footbungee(stretchy)orwovenleashallowsspacetoexplorewithout gettingtangledinabushorbeyondreach.

n Leashwalkaroundthehousewithoutpulling,yankingordragging—justdosomepet-pacedwalking.

n Don’tforcethenextstep,becausetheoutdoorscanbeabig,scaryplace;mostcatsneedtoobservefirstbeforeexploring.

n Uselotsofpraiseandtreats.

Darlene Arden is a certified animal behavior consultant from Bos-ton and author of TheCompleteCat’sMeowand BeautifulCats.

June is Adopt-a-Cat Month

EVER’MAN COOPERATIVE GROCERY & CAFEExpect our food and products to be:

All-natural • Organic • Locally sourced

Our cafe also serves breakfast, lunch and dinner daily.Choose from buff et-style meals or ready-to-heat and serve prepared foods.

• CAFE • • GROCERY • • PRODUCE • • EDUCATION •CENTER

MEAT• SEAFOOD •• WELLNESS •

NATURAL • ORGANIC • LOCAL

Monday- Saturday: 7:00AM - 9:00PMSunday: 9:00AM - 8:00PM

315 W. Garden StreetPensacola, Florida 32502

850.438.0402 · everman.org

Page 38: Natural Awakenings Pensacola June 2015

38 Natural Awakenings of Northwest Florida www.NWFNaturally.com

consciouseating

JohnsHopkinsSchoolofMedicineepidemiologistsestimatethat18.4percentofallAmericanmenover

theageof20,totaling18million,havereportedexperiencingerectiledysfunc-tion.TheCentersforDiseaseControlandPreventionreportsthat7.5percentofallsexuallyexperiencedmenunder45,ormorethan4million,havecon-sultedafertilitydoctor,suggestingit’saseriousproblemamongyoungermen. “Botherectiledysfunctionandinfer-tilityreflectelementsoflifestylechoices,especiallyobesity,smokingandexposuretoenvironmentaltoxins,”saysNaturo-pathJamesOcchiogrosso,ofFortMyers,Florida,authorofYour Prostate, Your Libido, Your Life: A Guide to Causes and Natural Solutions for Prostate Problems andProstateHealthNaturally.com. He saystherearemanywaystoaddresslowtestosterone,afactorinbothissues,andahealthydietiscrucialforhealthysexualfunctioninbothmenandwomen. Somefoodscanhelp,whileotherscanhinderaman’ssexualvitality,advisesCraigCooper,ofNewportBeach,Cali-fornia,founderoftheCooperativeHealthnetworkofmen’shealthwebsitesandauthorofYour New Prime: 30 Days to Better Sex, Eternal Strength, and a Kick Ass Life After 40.Heidentifieskey

no-nosthatdecreasetestosteroneaseatingexcesssugar,drinkingexcessivealcoholandbeingsedentary.Herearethebestfoodsforincreasingtestosterone. Shrimp:Likefattyfish,thistinycrustaceanisoneofnature’sfewfoodsourcesofvitaminD,whichHarvardSchoolofPublicHealthresearchcon-firmsislinkedtotestosteronelevels.Fourouncesofshrimpcontain162IU(internationalunits),about40percentofrecommendeddailyintake. Oysters, red meat and pumpkin seeds:Allofthesearerichsourcesofzinc,whichCoopernoteshasadirectlinktohighertestosteronelevels.Hecautions,however,thattoomuchzinccancauseitsabsorptiontodiminish.Menneed11milligrams(mg)ofzincaday.Oystersareconsideredafoodofloveforareason:Oneshelledoystercontains12.8mgofzinc.Pumpkinseedsarezincpowerhouseswith7mgin3.5ounces.Bycomparison,3ounc-esofbeefliverordarkchickenmeatdeliver4.3mgand2.4mg,respectively. Lean, grass-fed beef, tuna and nuts:Thesearehigh-qualitysourcesofomega-3fattyacids.“Withoutobtainingatleast20percentofourdailycaloriesfromfat(nolessthan15percent)wecan’tfunctionatoptimumcapacity,ashormonesareproducedthroughthecomponentsofdietaryfats,includingthesexhormonesliketestosterone,”advisesVirginiaBeach,Virginia,Reg-isteredDietitianJimWhite,aspokes-manfortheAcademyofNutritionandDietetics.“Adiethighincarbohydratesandtoomuchdietaryfat—morethan35percent—willcauseagaininbody

MANLY FOODSBoost Testosterone with the Right Choices

by Kathleen Barnes

Today’s rates ofmale infertility and

sexualdysfunction suggest that low

testosterone is rapidly becoming a

nationalproblem.

Join for FREE atNaturalAwakeningsSingles.com

Make Summer

MemoriesMeet Your True Love!

J oin the largest database of health- conscious and eco-minded, spiritual singles for FREE and manifest an extraordinary relationship!

J

Page 39: Natural Awakenings Pensacola June 2015

39natural awakenings June 2015

fat,whichcandecreasetestosteronelevels.Balanceisthekey.” Broccoli, cauliflower and cab-bage:Cruciferousvegetablesarerichsourcesofindole-3-carbinol,whichhelpsbothbalancetestosteroneandestrogen,andneutralizeexcessestro-geninmenandwomen,saysOcchio-grosso.Yes,menhaveestrogen,too,justlessthanwomen,andtoomuchblockstestosteroneproduction. Red grapes:Thiswholefoodisagoodsourceofresveratrolandproa-nythocyanidin,whichblockharmfulestrogenproduction,saysWhite.Excessestrogenproductionspurredbyeatingfoodslikesoyandflaxandthegrowthhormonescontainedinbigagriculture’smeatanddairyproductslowerstestos-teroneproductioninmen. Strawberries:Duetotheircortisol-loweringvitaminC,allberrieshelpreducestress,includingwhenhormonesarereleasedduringaheavyworkoutthatcanhampertestosteronepro-duction.OnestudypublishedintheInternational Journal of Sports Medi-cineconfirmsthatmorecortisolequals

lesstestosterone;anotherintheWorld Journal of Men’s Healthshowsthathighcortisollowerssexdriveandresultsindelayedejaculation.Plus,twoBrazilianstudiesshowedanimalswiththehigh-estvitaminCintakehadthehighestspermcountsamongstudysubjects.Anothergoodcortisolfighteristhe alliciningarlic. Pomegranates:Occhiogrossolikespomegranatesforbuildingtestosteronelevels.AnimpressivestudyfromtheInternational Journal of Impotence Re-searchshowedthattheperformanceof47percentoftheimpotentmalestudyparticipantsimprovedafterconsumingadailyglassofpomegranatejuiceforfourweeks. “FoodisalwaysthefirstchoicewhenI’mtreatingmenwithtestoster-oneandfertilityissues,”saysOcchio-grosso.“It’softeneffectivewithoutthedangersoftestosteroneinjections.”

Kathleen Barnes is the author of numer-ous health books, includingFoodIsMedi-cine:101PrescriptionsfromtheGarden. Connect at KathleenBarnes.com.

Body Building Doesn’t Build TestosteroneManypeoplethinkthatbodybuildersdefinehe-manmusclesbyproducing

hugeamountsoftestosterone.Notso,saysNaturopathJamesOcchiogrosso,whospecializesinmen’shealth.“Bodybuildersconsumehugeamountsofproteintobuildmuscles,”hesays.“Whenaman’spumping100to150gramsofproteinintohisbodyeveryday,hewillactuallyproducelesstestosterone.”Forhealthytestosteronelevels,herecommendsthatamanderiveamaximumof25percentofhisdailycaloriesfromprotein.

PERSONAL HORMONE PROFILE

HealthcounselorJamesOcchio-grossosaysit’sessentialtoknow

aman’sentirehormoneprofile,notjusttestosteronelevels,tounderstandthebestwaytotreatproblems.

Ahormonepanelshouldincludebloodand/orsalivatestsofthefollowing:

4Testosterone

4Freetestosterone

4SHBG(sexhormone bindingglobulin)

4Progesteroneandestradiol(hor- monesnotonlypresentinwomen)

4DHEA(dehydroepiandrosterone), aprecursor,orfoundational hormone,thatproducesboth estrogenandtestosterone

RadioLiveW U W F P U B L I C M E D I A P R E S E N T S

FEATURING ADMISSION:Suggested donation of non-perishables for Manna Food Pantries.

Museum of Commerce in Historic Downtown Pensacola

ALAN RHODYAMY SPEACETHE SARAH MAC BAND BOB PATTERSONFLAGSHIP ROMANCELON & LIS WILLIAMSON

6/4

7/2

8/6

Visit wuwf.org or call 850.474.2787 for more information.

DANA COOPERBOB LIVINGSTONMARTHA'S TROUBLE

Page 40: Natural Awakenings Pensacola June 2015

40 Natural Awakenings of Northwest Florida www.NWFNaturally.com

wisewords

The Gut-Mind ConnectionDavid Perlmutter on How Stomach

Microflora Affect Brain Healthby Linda Sechrist

Dr. David Perlmutter, a board-certified neu-rologist and recipient

of the Linus Pauling Award for his innovative approach-es to addressing neurologi-cal disorders, has recently released Brain Maker, the latest in a series of books on brain health. This medical advisor to the Dr. Oz Show demonstrates how brain problems can be prevented by adopting lifestyle changes that nurture the bacteria living in the digestive system. Why did you begin your book with the quote, “Death begins in the colon,” rather than “Brain health begins in the gut”?I wanted to draw attention to the real life-or-death issues mediated by what goes on inside the gut. Individuals with an immediate concern for their heart, bones, immune system or brain must recognize that the health of these parts and functions are governed at the level of commensal gut bacteria, the normal microflora that eat what we eat. This re-lationship is the most powerful leverage point we have for maintaining health.

How were you led to expand from studying the nervous sys-tem and brain to investigating gastrointestinal medicine?Early on in my career, I was taught that everything that goes on in the brain stays there. But leading-edge research now reveals that seemingly disparate organs are in close communication, regulating each other’s health. As scientific literature began support-ing the notion that gut-related issues

have a huge bearing on brain health, and specifi-cally on brain disease, it became important to me to be able to leverage deep knowledge of this empowering information in terms of being able to treat brain disorders.

What is the Human Microbiome Project (HMP)?

HMP, launched in 2008 by the National Institutes of Health, is a $115 million exploration of the gut microbiome. In the ongoing research project involving genetic and DNA assessment, research-ers are looking at the microbiome array in the gut of individuals suffering from various diseases. They are drawing cor-relations between emerging patterns in the abnormalities of gut bacteria and specific diseases. For example, autism correlates with an overabundance of the Clostridia species. In diabetes, there are more Firmicutes than Bacte-roidetes, which we also see in obesity characteristic of the Western cosmo-politan diet. This is paving the way for inter-ventions designed to restore a normal balance of gut bacteria. An example in my book is Dr. Max Nieuwdorp’s research at the University of Amster-dam, in which he discovered an array of abnormal bacteria that characterize Type 2 diabetes. In the more than 250 individuals diagnosed with diabetes that he treated in a double-blind study, he was able to reverse the disease by inserting a series of fecal material transfers from healthy, lean donors into diabetic patients.

What is the most eye-opening information about the roles played by gut organisms?More than 100 trillion bacteria live in our gut. Plus, there are viruses, yeast species and protozoa. When we factor in their genetic material, it means that an astonishing 99 percent of the DNA in our body is bacterial. It’s humbling to realize they influence all manner of physiology, from our immune system to our metabolism, making vitamins, maintaining the gut lining and control-ling inflammation, the key mechanism involved in Alzheimer’s, Parkinson’s, multiple sclerosis and any number of brain degenerative disorders. They also exert influence over the expression of our 23,000 genes, in effect regulating the expression of the human genome. The latest startling discovery—which is so new that it’s not in the book—is that bacterial DNA sequences have now been found in the human genome, meaning we are partly bacte-rial. It reveals the most sophisticated symbiotic and intimate relationship at the deepest level imaginable. It turns the previous way of thinking about who we are upside-down. Our perceptions of the world, moods, hunger or satiety, even our metabolism, are dictated by gut bac-teria, which deserve careful stewarding. They don’t deserve, for example, to be bombarded by the capricious use of anti-biotics whenever we have the sniffles.

How can we reestablish good gut health?Better food choices bring about signifi-cant changes in our body’s microbiome. By incorporating prebiotic foods such as Jerusalem artichokes, dandelion greens, garlic, leeks, onions, jicama or Mexican yam, as well as fermented foods such as kimchi, kombucha tea, yogurt and kefir, individuals can reestablish good gut health that helps them gain control over inflammation, the cornerstone of all degenerative conditions. Inflammation originates in the gut. Balancing bacteria and reducing intestinal permeability, which allows substances to leak through the lining of the small intestine into the bloodstream, can reduce it.

Visit Linda Sechrist’s website, ItsAllAbout We.com, for the recorded interview.

Page 41: Natural Awakenings Pensacola June 2015

41natural awakenings June 2015

Turn Your Passion Into a Business

Own a Natural Awakenings Magazine Our publishers ranked us among the highest

in franchise satisfaction for our Training, Support, Core Values and Integrity!

For more information, visit our website NaturalAwakeningsMag.com/mymagazine

or call 239-530-1377

Natural Awakenings is now expanding into new markets across the U.S. Contact us about starting a magazine in a community of your choice or acquiring an existing pub-lication for sale highlighted in red below.Natural Awakenings publishes in over 95 markets across the U.S. and Puerto Rico. • Huntsville,AL• Mobile/Baldwin,AL*• Phoenix,AZ*• Tucson,AZ• EastBayArea,CA• SanDiego,CA• Denver/Boulder,CO• FairfieldCounty,CT• Hartford,CT• NewHaven/

Middlesex,CT• Washington,DC• Daytona/Volusia/

Flagler,FL• NWFLEmerald

Coast• Ft.Lauderdale,FL• Jacksonville/

St.Augustine,FL• Melbourne/Vero,FL• Miami&the

FloridaKeys*• Naples/Ft.Myers,FL• NorthCentralFL*• Orlando,FL*• PalmBeach,FL• PeaceRiver,FL• Sarasota,FL• Tampa/St.Pete.,FL• FL’sTreasureCoast• Atlanta,GA• HawaiianIslands• Chicago,IL• ChicagoWestern

Suburbs,IL• Indianapolis,IN• BatonRouge,LA• Lafayette,LA• NewOrleans,LA• Portland,ME• Boston,MA• AnnArbor,MI• EastMichigan• WayneCounty,MI• WesternMI• Minneapolis/

St.Paul,MN• Charlotte,NC• LakeNorman,NC*• Triangle,NC• Central,NJ• HudsonCounty,NJ• MercerCounty,NJ

• Monmouth/Ocean,NJ

• NorthNJ• NorthCentralNJ• SouthNJ• SantaFe/Abq.,NM• LasVegas,NV• Albany,NY• Buffalo,NY• CentralNY• LongIsland,NY• Manhattan,NY*• Queens,NY• Rochester,NY• Rockland/

Orange,NY• Westchester/

PutnamCo’s.,NY• CentralOH• Cincinnati,OH• Toledo,OH• OklahomaCity,OK• Portland,OR*• Bucks/Montgomery

Counties,PA• Harrisburg/York,PA• Lancaster,PA• LehighValley,PA• Pocono,PA/

WarrenCo.,NJ Scranton/

Wilkes-Barre,PA• RhodeIsland• Charleston,SC• Columbia,SC• GrandStrand,SC*• Greenville,SC• Chattanooga,TN• Knoxville,TN*• Memphis,TN• Austin,TX• DallasMetroplex,TX• Dallas/FWMetroN• Houston,TX• SanAntonio,TX*• SETexas• Richmond,VA• VA’sBlueRidge• Seattle,WA• Madison,WI• Milwaukee,WI• PuertoRico

Natural AwakeningsrecentlywontheprestigiousFBR50FranchiseSatisfactionAwardfromFranchiseBusinessReview.Tolearnmore,visitFranchiseBusinessReview.com

• Meaningful New Career

• Low Initial Investment

• Proven Business System

• Home-Based Business

• Exceptional Franchise Support & Training

As a Natural Awakenings publisher, you can enjoy learning about healthy and joyous living while working from your home and earn a good income doing something you love!

No publishing experience is necessary. You’ll work for yourself but not by yourself. We offer a complete training and support system that allows you to successfully publish your own magazine.

“I am impressed by the range of support provided to franchisees; it seems all the bases are more than covered to provide an owner the ability to be success-ful. Together with my experience, drive and desire to make a difference, it feels like a good fit.”

~ Holly Baker, Tucson, AZ

“Each month, the content is enriching, beneficial and very often profound. We are a source of true enrichment and nourishment for so many. We are bringing light and understanding to millions of people.” ~ Craig Heim, Upstate NY

“There’s such strength in this business model: exceptional content from the corporation paired with eyes and ears on the ground here locally. We rock!“

~ Tracy Garland, Virginia’s Blue Ridge

“We are an amazing group; it’s getting better all the time! We are America’s Leading Healthy Living Magazine.”

~ Susie Q Wood, Ft. Lauderdale, FL

* Existingmagazinesforsale

Page 42: Natural Awakenings Pensacola June 2015

42 Natural Awakenings of Northwest Florida www.NWFNaturally.com

Radiant heat Radiant life

/hotyogaom

/thehealingclinicfwb Downtown FWBMM31394

. .NOW OPEN IN FORT WALTON BEACH

GRAND OPENING CELEBRATION JUNE 12TH

WWW.HOTYOGAOM.COM

MASSAGE SPECIALTherapeutic Massage

60 minutes

Transformational Healing :: Massage TherapyMyo-fascial Release :: Reiki Therapy & TrainingsAngel Readings :: Young Living Essential Oils

Promo Code: NewAt THE Healing Clinic of FWB

*transformational healing & myofascial release not included

58$

FEATURING FAR INFRARED HEATFIRSTCLASSOpening Specials $5

5 CLASS PASS OR1 MONTH UNLIMITED$10 OFF

/dragonflyyogalauratyreeDowntown FWB

Page 43: Natural Awakenings Pensacola June 2015

43natural awakenings June 2015

fitbodyspotlight

Whenmenthinkoffitness,theymayimagineapowerliftingroutineorheavyweighttraining,withloadsofprotein,creatineandcaffeinethatmay

givethembuffedmuscle,butalsoleadtonaggingmusclein-juriesandfeelingsluggishandsicktherestoftheday.Manymaydismisstheirgym’syogaclassasapracticemoresuitedforwomen,similartodanceandgymnastics—alessintenseoptionthatcertainlywon’tgetthemintothesameshapeastheirbarbellsandsquatmachines. However,thebenefitsofhotyogatakeitalltothenextlevel.Newpractitionersareoftensurprisedathowfasttheircorestrengthcanbeincreasedandtheamazingvibranthealththatisrapidlyachievedthrougharegularhotyogapractice. In500B.C.,theGreekphysicianParmenidesbelievedthatifhecouldcreatefever,hecouldcureallillness.Ithasbeenknownforcenturiesthatheattreatmenthasbeenbeneficial,anditsfirstdocumentedusedatesbackto400B.C.,withHippocrates.HotyogaoriginatedfromapracticeknownasBikramyoga,createdintheearly1970sbyBikramChoudhury.Unlikeotherstyles,Bikramcomprisesthesame26poses,orasanas,butispracticedinaroomheatedtoatemperatureof100degreesormorefor90minutes. Nowadays,hotyogaispracticedinmanyforms,and

theresultisaworkoutlikenoother.Hotyogahasbeenembracedbythousandsofpeople,fromsportsenthusiaststothosesufferingailmentsorthatjustwanttostayfit.Weightcontrol,muscletone,healthy-lookingskinandreducedstressaresomeofthemanyrewardsofhotyoga. HunterPateisakite-boardinginstructorandextremesurferinHawaii.Afterfallingalmost40feetfromtheskyandcrushingbonesinbothfeet,hediscoveredhotyogaasapracticethatofferedimmediatesoothingandrelaxationtohistight,inflamedmusclesandjoints.Heexplainsthatthispracticeallowedhimtogetthemaximumbenefitsfromyogaforcompletebodyhealing.Patesayshewasbackupandrunningandearningalivingdoingwhathelovesbestinlessthansixmonths,andbecauseofthat,heisgratefulforthehealingheattributestohotyoga. Inhotyoga,internalorgansandglandsaregentlymas-sagedandtheheatedroomensuresthatparticipantssweat,helpingthemtoflushtoxinsoutoftheirsystem.Inthisintensecardiovascularworkout,fresh,oxygenatedbloodisbroughtintoeverypartofthebody,cleansingandrejuvenat-ingtheentiresystem.Theheatitselfisaformofcardiovascu-larconditioning.Pateexplainsashedemonstratesacertainpose,“Ittookmeseveralyearstobeabletotouchmyheadtomykneeinthisposture,butifyoucangetthattoeventful-lyhappen,ithelpflushesthetoxinsfromyourpancreasandliver,whichaidstodecreasetheinflammationandhelpedmehealthatmuchquicker.” FeliciaMcQuaidandLauraTyreerecentlyopenedtheOmHotYogaStudio,inFt.WaltonBeach,withastrategyofcombiningless-intense,morerelaxingyogawiththebenefitsofinfraredheat. Additionalresponsestotheheatincludestimulationofwhitebloodcellproductionandboostingtheimmunesystemforanincreaseinhealinginjuriesanddecreaseindiseasesymptoms.ResearchbytheAmericanCancerSocietyshowsthebenefitsofincreasingbodyheat,orhyperthermia,whenthebody’stemperatureisraisedto100degrees. Theabilityofthesehightemperaturestodestroyasmallareaofcellssuchasatumoriscalledlocalhyperther-mia,orthermalablation.Thetemperatureofonepartofthebody(orevenwholebody)israisedtoahigherthannormallevel—nothotenoughtokillthecellsdirectly,butabletoallowothertypesofcancertreatments,suchasradiationtherapy,immunotherapyorchemotherapy,toworkbetter.Thisisknownaseitherregionalhyperthermiaorwholebodyhyperthermia. "Ifyoufeelemotionalincamelpose,that'sverygood.Thereasonisthatyouareopeningandstretchingyourheartmuscle,”saysPate.Also,experiencingintenseeuphoriaafterfinishingahotyogasessionisnotunusual.Moremenarediscoveringthatacommittedhotyogapracticeenhancestheirstability,improvesbalanceandflexibilityandleavesthemstronger,healthier,moreenergizedandcentered.

For more information, visit HotYogaOm.com or call 850-217-2771. See ad, page 42.

When You’re Hot, You’re Hot

Hot Yoga Resonates with Men

by Daralyn Chase

Page 44: Natural Awakenings Pensacola June 2015

44 Natural Awakenings of Northwest Florida www.NWFNaturally.com

Tues - Sat916 W Michigan Ave.

Suite CPensacola, FL 32505

Tues - Sat

Present this coupon and receive up to

10% OFF Any Mens Supplement, Toiletry Item,

Organic Beer or Wine. Expires June 30th.

Keep Dad Healthy this Father’s DayAND EVERYDAY!

Any Mens Supplement, Toiletry Item, Organic Beer or Wine. Expires June 30th.Organic Beer or Wine. Expires June 30th.

850-433-8583 • PENSACOLANATURALFOODS.COM

calendarofeventsAll calendar events must be received by the 15th of the month prior to publication.

Limited to approximately 50 words. See exact character count on website. Submit

from our website at NWFNaturally.com. $10 per regular listing. $50 Save the Date ad.

MONDAY, JUNE 1Personality Analysis Through the Feet – 9am-5pm. Learn how your feet reflect your personality and emotions, how toes relate to parts of your life, and how your feet fit your chosen profession; with Bobbie Warren, reflexology instructor. $310. Bay Branch Estates, 28347 Turkey Branch Dr, Daphne. 619-469-1694. TheFootLadies.com.

THURSDAY, JUNE 4Double Discount Day – 17th anniversary celebra-tion. Receive 20% off supplement purchases with your discount card. Samples and door prize drawings (need not be present). Jim and Angel will be taking assessments that day as usual. Alternative Health Food Store, 5533 Hwy 90, Pace. Details: 850-994-3606. AlternativeHealthFoodStore.com.

Pure Pilates’ Balanced Body Teacher Training – The Balanced Body Instructor Certification Course taught by Susan Clark, owner, will cover Mat I & II, Reformer I, II, & III, Apparatus I, II, & III. Cost depends on training module selected. See website. Pure Pilates, 221 Gulf Breeze Parkway, Gulf Breeze. 850-932-3424. PurePilatesPensacola.com.

SATURDAY, JUNE 6Advanced Ascension Work – 9:30am-12:30pm. Ongoing bi-monthly work. Understand the pathway

to your spiritual growth and the ongoing planetary changes. Supportive of personal and global trans-formation. Teleconference with Alice McCall. $55. Reservations: 850-585-5496. [email protected]. HealingPath.info.

If the Christ or Buddha Returned Would You Recognize Him – 2:30-3:30pm. He has returned and will inspire humanity to see itself as one family, and to rebuild the world so that it works for everyone. Presentation and literature. Free. Pensacola Main Library, 239 N Spring Street, Rm C, Pensacola. 850-293-6750. Share-International.us.

THURSDAY, JUNE 18If the Christ or Buddha Returned Would You Recognize Him – 2:30-3:30pm. He has returned and will inspire humanity to see itself as one fam-ily, and to rebuild the world so that it works for everyone. Presentation and literature. Free. Gulf Breeze Library, 1060 Shoreline Dr, Gulf Breeze. 850-293-6750. Share-International.us.

SATURDAY, JUNE 20Summer Solstice with Alice McCall – 9:30-11am. In guided meditation, experience the profound spiritual and healing gifts that the Summer Solstice has to offer. Teleconference with Alice McCall. $20. Reservations: 850-585-5496. [email protected]. HealingPath.info.

Needing Your CE Hours?SynergeticTM Myofascial Strategies

@ Soothing Arts School of Massage & Skin care

August 7 • 2-9 PM August 8-9 • 9AM-4PM Lumbar, Sacrum, Neck, Spine, Chest, Hips & Pelvis Shoulder, Arms and Hands 6 CE Hours 12 CE Hours

At Soothing Arts Massage School12605 Emerald Coast Pkwy #2, Miramar Beach

(850)269-0820

For more information please visit www.MindAndBodyinc.comCall (601)500-0337 or email: [email protected]

Magnus Eklund LMT, BCSI INSTRUCTOR

Massage Therapy Approved CE: Florida 50-9284, AL,LAP 122 (Louisiana), NCBTMB 450063-06, MAP 29 (MS)

Magnus Eklund LMT, BCSI Magnus Eklund LMT, BCSI

SATURDAY, JUNE 27Reflexology Proficiency Workshop – 7:45am-5pm. Advanced foot techniques and pathologies, as well as hand reflexology, for Phase III IIR Reflexology Students. Prerequisites include Phase I and II and 50 case studies. $350/pre-registered. Bay Branch Estates, 28347 Turkey Branch Dr, Daphne. 850-380-4943. [email protected].

MONDAY, JUNE 29Toxic Mold Meets Thieves – 6:30-8:30pm. Laurie Azzarella explains how using the one true thieves essential oil can alter your health and wellbeing and assist in removing mold and mildew from your home and body. $5. Unity of Pensacola Fellowship hall, 716 North 9th Ave, Pensacola. 850-380-4943. [email protected].

TUESDAY, JUNE 30If the Christ or Buddha Returned Would You Recognize Him – 2:30-3:30pm. He has returned and will inspire humanity to see itself as one family, and to rebuild the world so that it works for everyone. Presentation and literature. Free. Panera Bread, 700 Gulf Breeze Pkwy, Gulf Breeze. 850-293-6750. Share-International.us.

TUESDAY, JULY 7Chakra Event with Alice McCall – 6-7:30pm. Ac-tivate and tune your 9th chakra to access your soul’s blueprint. Powerful energy work; important for spiritual growth. Teleconference with Alice McCall. $20. Reservations: 850-585-5496. [email protected]. HealingPath.info.

Make your community a little

GREENER...Support our advertisers

For every $100 spent in locally-owned business, $68 returns to

the community

source: the350project.net

Page 45: Natural Awakenings Pensacola June 2015

45natural awakenings June 2015

ongoingevents

dailyAerial Movement Classes – Hang from the ceiling with us. Gulf Breeze class is Thurs 10am. Down-town Pensacola classes are Wed 1pm and 6:30pm and Friday 9am. $24/drop in, $20/in class package. Pure Pilates, 221 Gulf Breeze Parkway, Gulf Breeze. 850-932-3424. [email protected]. PurePilatesPensacola.com.

Barre Classes – Gulf Breeze classes are Mon 5:30pm and Wed 7am. Downtown Pensacola classes are Mon 12:15pm and 5:30pm, Tues 12:15pm, Wed 9:30am and 5:30pm, Thur 12:15pm, and Sat 1:30pm. $12/drop in, $100/package of 10. Pure Pilates, 221 Gulf Breeze Parkway, Gulf Breeze. 850-932-3424. Info@pure pilatespensacola.com. PurePilatesPensacola.com.

Equipment Classes: Mon/Wed/Fri – 8:30-9:30am. Progressive, advanced and intermediate classes. 9:45am modified for those needing it. Limited to 6 participants each class. $30/drop-in, $25/account basis. Pilates Core Training, 1310 B Dunmire, Dunmire Village, Pensacola. 850-287-5836. PilatesCoreTraining.com.

Pilates Mat Classes – Gulf Breeze classes are Mon 8:30am, Wed 9am and 5:30pm and Sat 9am. Downtown classes are Tues 10:15am and 1:15pm, Wed 8:30am, Thurs 10:15am and 1:15pm and Sat 10:30am. $12/drop in, $100/package of 10. Pure Pilates, 221 Gulf Breeze Parkway, Gulf Breeze. 850-932-3424. [email protected]. PurePilatesPensacola.com.

sundayScience of Mind Spiritual Principles Study Group – 11am. Cantonment. Info, directions: 850-637-4488. [email protected].

Transmission Meditation – 7pm.Transmission Meditation: World service group Meditation. Simple, potent & always free. Free. Warrington. TransmissionMeditation.org.

monday

Myo/Gyro/Mat Class – 5:15-6:15pm. Class be-gins with Pilates mat exercises to warm up and strengthen our core, then moves into myofascial release stretches and body rolling, and finish with some gyrokenisis spinal articulation. $15/drop-in, $10/account basis. Pilates Core Training, 1310 B Dunmire, Dunmire Village, Pensacola. 850-287-5836. PilatesCoreTraining.com.

In the Flow Yoga with Dr. Michael DeMaria – 5:30-6:30pm. For beginners to advanced prac-titioners, flow from rhythmic movement and laughter to flowing yogic postures and meditative stillness, all accompanied by live music. Bring a

All calendar events must be received by the 15th of the month prior to publication. Limited to approximately 25 words. See exact character count on website. Submit from our website only at NWFNaturally.com. $10 per entry.

yoga mat. $10. Sanders Beach Community Cen-ter, 913 South I St, Pensacola. 850-436-5198. [email protected]. Ontos.org.

Pranic Healing for the Public – 6:30pm. 1st Mon. Pranic healing is effective in helping the body to heal itself of pain, inflammation, inju-ries, stress and emotional issues such as grief, anxiety and PTSD. Sessions on a walk-in basis. The Center for Pranic Healing and Wellness, 206 B Center Rd, Gulf Breeze. 850-380-0561. Pranic HealingAndWellness.com.

tuesdaySMART Recovery Meeting – 12-1pm. SMART Recovery - Self Management for Ad-diction Recovery – is the leading self-empow-ering support group. Learn recovery based on scientific research and participate in free, self-empowering, science-based mutual help groups. Free. The Bindu Institute in the Group Room, 1913 Highway 87, Navarre. 850-692-9824. [email protected].

Truth on Tap – 6-7pm. Last Tues. Rev Jamie Sanders leads an evening of lively spiritual discussion over food and drinks. Participants responsible for cost of their food and drink. Free attendance. Ozone Pizza Pub, 1010 N 12th Avenue, #111, Pensacola. 850-438-2277. [email protected]. UnityPns.org.

Yin Yoga with Connie Williams – 6-7pm. Dive deeply into relaxation and deep stretches that go down to the bones with yin yoga. A must for any

‘body’, especially those over 40. Reclaim your body. Connie has 16 years of yoga experience and became a yoga teacher in 2001. $15/$10. The Center for Pranic Healing and Wellness, 206 B Center Rd, Gulf Breeze. 850-380-0561. [email protected]. PranicHealingAndWellness.com.

Herbal Hour with Old Thyme Remedies – 6-7:30pm. 1st Tue Monthly. Join us for a commu-nity discussion group on herbal remedies and herbal information. Come and share your experiences and ask your questions. Bring any remedy you need help finishing; our remedy making tools will be available for you to use. $5. Old Thyme Remedies, 2475 E. Nine Mile Road, Suite E, Pensacola. 850-912-6996. [email protected]. OldThymeRem-edies.com.

Free “Twin Hearts” meditation and Healing Clinic – 7:15-8:15pm. Promoting stress reduction and general wellness. Protocols for most physical and emotional ailments. Thanks for bringing food for Manna. EverMan’s Natural Foods Community Room, 315 W. Garden St, Pensacola. Pranic Healing Central Gulf Coast, Lorraine Graves, Ph. D., 850-433-2042. [email protected]. PranicHealingCentralGulfCoast.com

wednesday

Learn Pranic Healing: Flex Schedule – Through Jun. 9am-1pm. Pranic Healing Level 1 taught in a 4-week format by Vicki Fairleigh, RN. $325/advance, $350/day of. Center for Pranic Healing and Wellness, 206 B Center RD, Gulf Breeze. 850-291-3613. Register: [email protected]. PranicHealingAndWellness.com

Beginning Yoga – 5:30pm. Ric Kindle leads begin-ning yoga on the second and fourth Wednesdays of each month. $8. Unity of Pensacola, Fellowship Hall, 716 North 9th Ave, Pensacola. 850-438-2277. UnityPns.org.

Peace Within Healing Meditation – 5:30-6:30pm. Guided healing meditation with sound healing proven to help with PTSD, anxiety, depression, chronic pain and many other challenges. Bring mat, cover, pillow for a lying down meditation. $10. Sanders Beach Community Center, 913 South I St, Pensacola. 850-436-5198. [email protected] Evening Equipment Class – 6pm. Taught by Beth Bradford. . $30/drop in, $25/account; 6 participants per class. Pilates Core Training, 1310 B Dunmire, Dunmire Village, Pensacola. 850-287-5836. [email protected] PilatesCoreTraining.com.

Transmission Meditation – 7pm.Transmission Meditation: World service group Meditation. Simple, potent & always free. Free. Warrington. TransmissionMeditation.org.

saturdaySaturday Equipment Classes – 7:45am, 9am. Starting your weekend with a equipment class will assist you in feeling energized and ready for the weekend. Limited to 6 in each class. $30/drop-in, $25/account basis. Pilates Core Training, 1310 B Dunmire, Dunmire Village, Pensacola. 850-287-5836. PilatesCoreTraining.com.

Page 46: Natural Awakenings Pensacola June 2015

46 Natural Awakenings of Northwest Florida www.NWFNaturally.com

classifiedsSubmit classified entries online only at NWFNaturally.com. The submission form is located on the Advertising web page at NWFNaturally.com. $20 for 20 words, $1 per extra word.

HELP WANTED

FREE HELP WANTED CLASSIFIED POSTINGS – Natural Awakenings is com-mitted helping our community find work and employment. Post your help wanted listing, up to 20 words, free of charge in 2015. Deadline is the 15th of the month prior to the month published. We reserve the right to edit, accept or reject all submissions based on suitability.

PRODUCTS

ESSENTIAL OILS BY YOUNG LIVING – provide the best in organic, pure oils. Extracted through careful steam distillation and cold press-ing, only unadulterated essential oils are used in our products. Essential Oils for Wellness, Es-sential Oils for Beauty, Essential Oils for Bal-ance. Call Laurie Azzarella 850-380-4943, [email protected] or visit laurie.market-ingscents.com

SOLAR POWER – Compass Solar provides Solar Electric( Photovoltaic), Solar Water Heating, Solar Pool Heating and Solar Attic Fan. Since 1989, Compass Solar Energy has the newest technology that harnesses the Sun’s Power and provide clean energy efficient power. Free Estimates. 850-530-5076, State License # CVC56688/CVC56700

SERVICES

BE MORE COMFORTABLE IN YOUR BODY! – Find relief from injuries, pain, move-ment restrictions and postural/structural imbal-ances with ROLFING. Sharalee Hoelscher, Certified Rolfer™, RCST®, (Lic. #MA34039). 850-450-8508. HealingWithBodywork.com.

ACUPUNCTUREDR SHERYL ROE Acupuncture PhysicianNavarre • FWB850-225-3460 • DrSRoe.com

Acupuncture works. Learn how it can work for you at the Navarre, Destin or Mary Esther. Treating all types of pain, addiction, sleep disorders, stress, fibromyalgia, PTSD. Feel better soon. See ad, page 12.

ACUPUNCTURE FACELIFTDR SHERYL ROE Acupuncture PhysicianNavarre • FWB850-225-3460 • DrSRoe.com

Acupuncture works. Learn how it can work for you at the Navarre, Destin or Mary Esther. Treating all types of pain, addiction, sleep disorders, stress, fibromyalgia, PTSD. Feel better soon. See ad, page 12.

ACUPUNCTURE VETERINARIANCHRIS LEWIS DVM, CVACertified Veterinary Acupuncturist 2101 N Palafox St • [email protected]

Specialized in acupuncture for animals to treat issues involving pain management, arthritis, anxiety, hip dysplasia, skin and other conditions not responding to conventional Veterinarian Medicine as well as providing traditional Veterinarian medical support. See ad, page 34.

AIR CONDITIONINGEMERALD AIR SERVICES, L.L.C. HEATING & AIR CONDITIONING112 Beal Pkwy SW, FWB850-244-2665 • EmeraldAirFWB.com

To greatly improve system e ff i c i ency, equ ipmen t performance, and longevity, eliminate filter-changing inconveniences and provide you home with the purest,

healthiest air. Choose Everclean Green.

AYURVEDAEMERALD COAST FUNCTIONAL FAMILY MEDICINEPeter Kozlowski, M.D.850-830-7517 • [email protected]

Emerald Coast Functional Family Medicine offers food sensitivity testing, functional medicine and healthy aging consultat ions, hormone replacement therapy, medical detoxification, nutrition, prenatal care, primary care, pediatrics, second opinions and specialized testing.

BARRE CLASSESPURE PILATESGulf Breeze Proper221 Gulf Breeze Pkwy • 850-932-3424Downtown Pensacola426 S Palafox • 850-607-2772PurePilatesPensacola.com

Come strengthen and stretch with Pure Pilates’ Barre class. Barre is a body changing workout set to music and designed to be fun without stressing or

straining the body. See ad, page 7 and 13.

BEAUTYORGANIC CONCEPTS BY CAMI KILKER609 West Chase St, Pensacola850-582-0177 • [email protected]

Providing an organic solution to beauty in a world full of chemicals. Organic Salon Systems gives you clean and healthy hair with ammonia free hair color and chemical free styling products. See ad, page 13.

BREAST SCREENINGHEND-RX NUTRITION & LABORATORIESDr. Garry Hendricks, N.D. 205 Kelly Ave NE, Ste A, FWB850-736-5700 • [email protected]

Screening with thermography can detect abnormalities in the v e r y e a r l i e s t s t a g e s cardiovascular, breast thyroid, hormonal digestive, diabetes, TMJ. Also offering personalized healthcare assessments and

organic botanical supplements. See ad, page 11.

communityresourceguideConnecting you to the leaders in natural healthcare and green living in our community. To find out how you can be included in the Community Resource Guide email [email protected] to request our media kit or call 850-687-0826.

When you pay atten-tion to boredom it gets

unbelievably interesting.

~Jon Kabat-Zinn

Page 47: Natural Awakenings Pensacola June 2015

47natural awakenings June 2015

CHELATION DR. EDDIE ZANT, MD913 Mar Walt, FWB • 850-243-822936468 Emerald Coast Pkwy, # 8102 Destin850-650-9500

ACAM Certified Chelation provider . A Par t ic ipat ing physician in the successful clinical trial.gov/NIH TACT chelation study. Providing IV infusions and M y e r s “ C o c k t a i l ” . F r e e Consultation. See ad, page 9.

COACHING/COUNSELINGREALIZE UNLIMITED Florence Doisneau954 826 [email protected]

Florence Doisneau is a Certified Life Coach encouraging clients towards self-actual izat ion. Providing tools/practices for a meaningful/joyful life. Masters Mgmt/Bodywork Therapies; in training NLP Practitioner; 200hrs CYT. See ad, page 18.

COLONIC THERAPYPENSACOLA WELLNESS CENTER, LLCBeverly North, LMT, CT945 W Michigan Ave, 6C, Pensacola850-449-5572 • MA 56835 • MM24149

Wellness requires a state of b a l a n c e . We o f f e r c o l o n hydrotherapy, ref lexology, massage therapy and other alternative modalities to help you achieve/maintain your wellness model. See ad, page 21.

SKINDEEP CLINIC WELLNESS CENTRECindy Butler, Owner/Therapist4012 Commons Dr W, Ste 120, Destin850-269-1414 • SkinDeepDestin.com

Colonics, ionic footbaths, infrared saunas. Organic non-surgical facelift, weight loss (lose 20 lbs in 40 days), body wraps, massage, teeth whitening, airbrush tan, makeovers.

CRANIOSACRAL THERAPYSHARALEE HOELSCHER, RCSTCertified Rolfer (MA34039)Registered Craniosacral Therapist850-450-8508HealingWithBodywork.com

Get out of pain once and for all. Treat the source, not the symptom. Enjoy moving freely in a more organized, comfortable and balanced body. See ad, page 12.

DENTISTRYDR DAYTON HART, DMDIAOMT Protocol225 W Laurel Ave, Foley, AL251-943-2471 • DrDaytonHart.com

Free book: Mercury Free Dentistry. Ozone, laser no-suture gum surgery, test for compatible materials, cavity-causing bacteria. Examine for gum disease bacteria. Laser cavity diagnoses, saliva, ph check, oral galvanic screening; no fluoride. See ad, page 11.

DETOXIFICATIONEMERALD COAST FUNCTIONAL FAMILY MEDICINEPeter Kozlowski, M.D.850-830-7517 • [email protected]

Emerald Coast Functional Family Medicine offers food sensitivity testing, functional medicine and healthy aging consultations, hormone replacement therapy, medical detoxification, nutrition, prenatal care, primary care, pediatrics, second opinions and specialized testing.

DININGSYNERGY ORGANIC JUICE BAR AND CAFÉ120 Miraclestrip Pkwy SE850-865-4919SynergyOrganicCafeFWB.com

Juice Bar and Café offers f a r m - t o - t a b l e m e a l s prepared with regionally sourced organic produce and pantry items; gluten-free, dairy-free. Whole

food cooking, juicing, gluten-free, vegetarian, vegan and raw food classes are available. See ad, page 35.

EMOTIONAL HEALINGBACK TO BASIC WELLNESSSusan Giangiulio, MEd, CECP, CLP850-240-2279Back-To-Basic-Wellness.com

Certified Lifeline Technique™ and an Emotion Code Practitioner applying kinesiology, known as muscle testing, to communicate with subconscious thoughts. Release t rapped emotions, eliminate personal obstacles and limiting behaviors..

ENERGY CONSERVATIONEMERALD AIR SERVICES, HEATING & AIR CONDITIONING112 Beal Pkwy SE, FWB850-244-2665 • EmeraldAirFWB.com

To greatly improve system efficiency, equipment p e r f o r m a n c e , a n d longevity, eliminate filter-changing inconveniences and provide you home with

the purest, healthiest air. Choose Everclean Green.

FLORIDA PACEVeronica CrossOutreach Coordinator 866-558-3180 • FloridaPace.gov

Florida PACE program is a sustainable energy funding program that provides up to 100% financing for energy saving efficient projects based on property equity

and repayment through tax rolls.

ESSENTIAL OILSLAURIE AZZARELLA, LMT, CRRYoung Living Educator, Sponsor #[email protected] WellnessPurposeAbundance.com/YL/123

Experience the healing, uplifting and detoxifying benefits of therapeutic-grade essential oils and supplements. Contact us for personal consultations, in-

home classes, household products, health supplements, diffusers, group presentations and business training. See ad, page 19.

Choose a job you love, and you will never have to work a day in your life.

~Confucius

Page 48: Natural Awakenings Pensacola June 2015

48 Natural Awakenings of Northwest Florida www.NWFNaturally.com

FUNCTIONAL MEDICINEEMERALD COAST FUNCTIONAL FAMILY MEDICINEPeter Kozlowski, M.D.850-830-7517 • [email protected]

Emerald Coast Functional Family Medicine offers food sensitivity testing, functional medicine and heal thy aging consultat ions, hormone replacement therapy, medical detoxification, nutrition, prenatal care, pr imary care, pediatrics, second opinions and specialized testing.

GEOTHERMALEMERALD AIR SERVICES, HEATING & AIR CONDITIONING112 Beal Pkwy SE, FWB850-244-2665 • EmeraldAirFWB.com

To greatly improve system efficiency, equipment p e r f o r m a n c e , a n d longevity, eliminate filter-changing inconveniences and provide you home with

the purest, healthiest air. Choose Everclean Green.

GREEN CLEANINGXCLEAN CLEANERSOrganic Dry Cleaner & Laundry 1143 Gulf Breeze Pkwy, Gulf Breeze850-932-2565 • XClean.net

No petroleum based or pe rch lo roe thy lene chemicals used. Dry clean and laundry, wash and fold, all households linens, leather, purse, wedding dress, drapes, uniforms. Free pick up

and delivery in Pensacola and Gulf Breeze. See ad, page 16.

HEALING ARTS MICHAEL BRANT DEMARIA, PHD Psychologist, Yoga/Meditation Teacher Sound Healing Artist, Speaker, [email protected] • MichaelDemaria.com

Free meditation series at Youtube.com/MBDemaria; upcoming events at PeaceWithinNow.com. Ongoing meditation/yoga classes at Sanders Beach Community Center. 850-436-5198. Healing music available on iTunes, Amazon.com, CDbaby.com.See ad, page 15.

HEALING PATH, ALICE MCCALLTransformational Energy Healer/CounselorBS Psychology, MBA, Hypnotherapist850-585-5496 • HealingPath.info

Phone sessions to heal serious health issues, unwanted patterns, and more. Authored Wellness Wisdom on natural health and healing; inspired by her journey with cancer.

HERBAL MEDICINEOLD THYME REMEDIES Theresa Ellis and Beth Workman2475 E 9 Mile Rd, Ste E, Pensacola850-912-6996 • OldThymeRemedies.com

Offers more than 200 varieties of loose herbs, top brands of essential oils, tools and accessories, herbal formulas and homeopathics, ionic foot detox and infrared sauna.

Kangen water is also available. See ad, page 17.

HYPNOSISDESTIN HYPNOSISTom Mueller, CMC, CHt850-865-0285 • DestinHypnosis.comFacebook.com/DestinHypnosis

Certified hypnotherapist and master life coach. Hypnosis is powerful anytime a change in feeling, thinking or behavior is desired. My mission is your success. Call today.

MAIA RIZZI, CCHTGraduate of State Licensed SchoolClinical HypnotherapistPensacola • [email protected]

Life is often challenging...Experi-ence Hypnosis, dreamwork, regres-sions, inner personality dynamics, spiritual counseling. Reduce stress and anxiety; re-establish self em-powerment. See Monthly articles in Bella Magazine; Monthly presenta-tions at Everman’s. Call for free consultation. See ad, page 19.

FOODS & SUPPLEMENTS

ALTERNATIVE HEALTH FOOD STORE5533 Highway 90850-994-3606AlternativeHealthFoodStore.comAlternative Health Food Store Since 1998.

Educated and friendly Staff, Quality Vitamins & Supplements.Essential O i l s f o r a h e a l t h y lifestyle. Natural Health Assessments: Iridology

Tongue and Fingernail Assessment, Reflex Nutrition Assessment. By appointment, $50. See ad, page 51.

ESTHER’S GARDEN OF HEALING, LLC8184 Navarre Pkwy • [email protected]

A unique establishment specializing in 150+ bulk herbs , 40+ loose teas , homeopathic remedies and our herbal skincare line. Find us on Facebook for an updated

schedule of our weekly workshops. See ad, page 29.

OLD THYME REMEDIES Theresa Ellis and Beth Workman2475 E 9 Mile Rd, Ste E, Pensacola850-912-6996 • OldThymeRemedies.com

Offers more than 200 varieties of loose herbs, top brands of essential oils, tools and accessories, herbal formulas and homeopathics, ionic foot

detox and infrared sauna. Kangen water is also available. See ad, page 17.

PACE WELLNESS CENTER Katie Lastinger, Owner850-994-5656 • PaceWellnessCenter.comFacebook/The-Wellness-Center

Offers supplement/herbal wellness; assessment practices: iridology, tongue/fingernail/pulse analysis, glandular body typing. Healing therapies: ionic footbath, hot house, chi machine, and massage therapy.

PENSACOLA NATURAL FOODS, INC916 W Michigan Ave, Unit C, Pensacola850-433-8583 PensacolaNaturalFoods.com

15% off v i t amins , he rbs , homeopathics. 10% off groceries for military. Natural and organic groceries; wheat-, dairy-, gluten-free foods; nitrate-free meats, poultry; low-carb foods; organic wine, beer; locally-made jewelry, soaps, candles. Bulk discounts. See ad, page 44.

Page 49: Natural Awakenings Pensacola June 2015

49natural awakenings June 2015

MASSAGE THERAPYEAST OF EDEN RETREAT AND SPA 234 Dog Hobble LnSanta Rosa Beach, FL 32459850-797-4754EastOfEdenRetreatAndSpa.com

The ultimate destination for health and beauty in Northwest Florida, provides a wide range of spa services and holistic treatments to revitalize your body, mind and spirit. Massages, facials, advanced anti-Aging skin care, hair styling & makeup,

naturopathy and acupuncture are offered in synergy to make your inner & outer beauty shine through. See ad, page 3.

MYOFASCIAL RELEASEBARBARA BRUNI Pilates Core TrainingNew Location: 1310 B Dunmire, Dunmire Village, Pensacola850-287-5836 • BarbaraBruni.com

Myofascial release treats the entire myofascial mind/body complex, eliminating the pressure of the restricted myofascial system (the straight-jacket) that causes painful symptoms. LMT # MA64267. See ad, page 9.

NATURAL HEALTH CAREOLD THYME REMEDIES Theresa Ellis and Beth Workman2475 E 9 Mile Rd, Ste E, Pensacola850-912-6996 • OldThymeRemedies.com

Offers more than 200 varieties of loose herbs, top brands of essential oils, tools and accessories, herbal formulas and homeopathics, ionic foot detox and infrared sauna.

Kangen water is also available. See ad, page 17.

NATUROPATHY HEND-RX NUTRITION & LABORATORIESDr Garry Hendricks, ND205 Kelly Ave NE, Ste A, FWB850-736-5700 • [email protected]

Screening with thermography can detect abnormalities in the v e r y e a r l i e s t s t a g e s cardiovascular, breast thyroid, hormonal digestive, diabetes, TMJ. Also offering personalized healthcare assessments and

organic botanical supplements. See ad, page 11.

INTEGRATIVE MEDICINEJIM’S HERB & VITAMIN SHOP850-607-2364MyNSP.com/floridaD’Oxyva, Iridology, Reflexology

Holistic counseling, iridology, reflexology, bio-feedback, vitamin deficiency testing, ear candling, Nature’s Sunshine, far infrared detox, foot detox and live blood cell analysis, herbs, and vitamins.

JUICE BARS

SYNERGY ORGANIC JUICE BAR AND CAFÉ120 Miraclestrip Pkwy SE850-865-4919SynergyOrganicCafeFWB.com

Juice Bar and Café offers f a r m - t o - t a b l e m e a l s prepared with regionally sourced organic produce and pantry items; gluten-free, dairy-free. Whole

food cooking, juicing, gluten-free, vegetarian, vegan and raw food classes are available. See ad, page 35.

LIFE COACHSUSAN JOHNSTON, CCHT Intuitive Life Path CoachDunmire Village, Pensacola850-910-4048 • SusanJohnstonCHT.com

Lifelong intuitive empath and healer, guide, coach and mentor. C e r t i f i e d C l i n i c a l a n d Transpersonal Hypnotherapist, trained in traditional and holistic approaches, custom-tailored for individuals of all ages. Office and telephone appointments.

LOSS AND SEPARATIONMAIA RIZZI, CCHTGraduate of state licensed instituteClinical HypnotherapistPensacola • [email protected]

Lett ing go of someone or something we love or depend on can cause us to experience serious separation reactions ranging from anger and anxiety to grief and fear. Hypnosis gent ly promotes acceptance and recovery. A complimentary CD comes with sessions. See ad, page 19.

NEUROFEEDBACK REGATTA CHIROPRACTIC AND LASER CENTERShawna Hogan, DC850-424-7856RegattaChiropractic.com

Offering Chiropractic Care, Massage Therapy, BrainCore Neurofeedback Therapy, and Zerona and Verjú laser body slimming systems. Call to schedule your complimentary consultation today. See ad, page 23.

ORGANIC FOODSYNERGY ORGANIC JUICE BAR AND CAFÉ120 Miraclestrip Pkwy SE850-865-4919SynergyOrganicCafeFWB.com

Juice Bar and Café offers f a r m - t o - t a b l e m e a l s prepared with regionally sourced organic produce and pantry items; gluten-free, dairy-free. Whole

food cooking, juicing, gluten-free, vegetarian, vegan and raw food classes are available. See ad, page 35.

OXYGEN THERAPY DR. EDDIE ZANT, MDHYPERBARIC MEDICINE913 Mar Walt, FWB850-243-822936468 Emerald Coast Pkwy, # 8102 Destin850-650-9500HyperbaricMedicineOfFlorida.com

Providing Hyperbaric Oxygen Therapy for diabetic ulcers of the lower extremities, post radiation issues, chronic bone infections, acute hearing loss, crushing injuries to the extremities. See ad, page 9.

PAIN MANAGEMENTMAIA RIZZI, CCHTGraduate of state licensed instituteClinical HypnotherapistPensacola • [email protected]

Unrelieved pain can be debilitating; no one should have to experience that every day. Hypnosis is regarded by many in the scientific commu-nity as a scientific approach for pain management which is entirely safe. It cannot harm you and best of all, it has no side effects, other than feeling better. See ad, page 19.

Page 50: Natural Awakenings Pensacola June 2015

50 Natural Awakenings of Northwest Florida www.NWFNaturally.com

PEST CONTROL-ORGANICEARTH’S CHOICE PEST SOLUTIONS 850-382-3820 • [email protected]

Natural and organic pest solutions. State certified with 14 years of experience. Child and Pet friendly. No dousing baseboards

with pesticides. 110% Money Back Guarantee. See ad, page 6.

PILATES STUDIOSPILATES CORE TRAININGBarbara Bruni, OwnerNew Location: 1310 B Dunmire, Dunmire Village, Pensacola850-287-5836 • PilatesCoreTraining.com

Mat, yoga, cycle, gyrokensis and equipment classes, or private sessions for a personalized e x p e r i e n c e . We b s i t e l i s t s instructors, class schedule and prices. See ad, page 9.

PURE PILATESGulf Breeze Proper221 Gulf Breeze Pkwy • 850-932-3424Downtown Pensacola426 S Palafox • 850-607-2772PurePilatesPensacola.com

Join us at Pure to experience the largest Pilates studio on t h e c o a s t . Va r i e t y o f equipment and mat classes are offered 6 days a week. Tone your core with Pure. See ads, page 7 and 13.

PRANIC HEALING THE CENTER FOR PRANIC HEALING AND WELLNESS206 - B Center St, Gulf BreezePranicHealingAndWellness.com

A school for yoga, m e d i t a t i o n , spirituality, energy

healing. Facilitate greater health, conscious living, and spiritual development. Spirituality, meditation, yoga and Pranic Healing coursework. Some with CE hrs.

RETREATSEAST OF EDEN RETREAT AND SPA234 Dog Hobble LnSanta Rosa Beach 32459850-797-4754EastOfEdenRetreatAndSpa.com

Spend a few days of decompressing, away from the noise of the daily life. Explore our three comfortable short-term rental accommodations on our website. Complimentary sauna, wet steam room, salt-water pool. Discounted spa services & daily yoga classes are available to our retreat guests. See ad, page 3.

WIND CREEK ATMOREYour Spa Destination855-393-7227 303 Poarch Rd, Atmore, AL [email protected] WindCreekAtmore.com

Experience our lavish full-service spa offering you an abundance of amenities to awaken, de-stress and beautify you inside and out.

ROLFINGSHARALEE HOELSCHER, RCSTCertified Rolfer (MA34039)Registered Craniosacral Therapist850-450-8508HealingWithBodywork.com

Get out of pain once and for all. Treat the source, not the symptom. Enjoy moving freely in a more organized, comfortable and balanced body. See ad, page 12.

SOLAR POWERCOMPASS SOLAR ENERGYServing NW Florida850-439-0035CompassSolar.com

Since 1989 Compass Solar has provide the area with reliable solar electric, solar water heating, solar pool heating and

solar attic fans powered solely by the Sun. An approved PACE funding contractor. See ad, page 5.

SPA TREATMENTS EAST OF EDEN RETREAT AND SPA 234 Dog Hobble LnSanta Rosa Beach 32459850-797-4754EastOfEdenRetreatAndSpa.com

The ultimate destination for health and beauty in Northwest Florida, provides a wide range of spa services and holistic treatments to revitalize your body, mind and spirit. Massages, facials, advanced anti-Aging skin care, hair styling & makeup, naturopathy and

acupuncture are offered in synergy to make your inner & outer beauty shine through. See ad, page 3.

WIND CREEK ATMOREYour Spa Destination855-393-7227 303 Poarch Rd, Atmore, AL [email protected] WindcreekAtmore.com

Experience our lavish full-service spa offering you an abundance of amenities to awaken, de-stress and beautify you inside and out.

SPIRITUAL CENTERUNITY OF PENSACOLAJamie Sanders, Minister716 N 9th, Pensacola850-438-2277 • UnityPNS.com

Unity of Pensacola offers spiritual teachings that empower abundant and meaningful living. We

provide philosophy that is spiritual, not religious, and love-based, not fear-based. See ad, page 20.

THERMOGRAPHYHEND-RX NUTRITION & LABORATORIESDr. Garry Hendricks, N.D. 205 Kelly Ave NE, Ste. A, FWB850-736-5700 • [email protected]

Screening with thermography can detect abnormalities in the v e r y e a r l i e s t s t a g e s cardiovascular, breast thyroid, hormonal digestive, diabetes, TMJ. Also offering personalized healthcare assessments and

organic botanical supplements. See ad, page 11.

My father gave me the greatest gift anyone could give another person—he believed in me.

~Jim Valvano

Page 51: Natural Awakenings Pensacola June 2015

51natural awakenings June 2015

VETERINARIANCHRIS LEWIS DVM, CVACertified Veterinary Acupuncturist 2101 N Palafox St • [email protected]

Specialized in acupuncture for animals to treat issues involving pain management, arthritis, anxiety, hip dysplasia, skin and other conditions not responding to conven t iona l Ve te r ina r i an Medicine as well as providing traditional Veterinarian medical support. See ad, page 34.

WEIGHT-MANAGEMENT NUTRIMOST NICEVILLEScott Ewing, DC705 W John Sims Pkwy844-441-THIN (8446)EmeraldCoastFatLoss.com

Renee Lost 54lbs!

Because of Our Technology

LEARN ABOUT THIS UNIQUE FAT LOSS SYSTEM THAT IS CUSTOM PLANNED JUST FOR YOU!

Scott Ewing, DC, NutriMost Niceville705 West John Sims Parkway

Niceville, FL 32578 844.441.THIN

CALL 844-441-THIN AND START TODAY!

“Using NRF TECHNOLOGY,

We will create a

custon weight loss plan

JUST FOR YOU!

How would you like to

lose 20 or more pounds,

have more energy, feel great

and begin a healthier lifestyle

in the next 40 Days?"

Scott Ewing, DC

LOSE 20-40+ POUNDSin 40 Days

www.EmeraldCoastFatLoss.comVisit our website to see how you can start losing weight today!

BEFORE

AFTER

No strenuous dieting. No hunger or cravings. No radical changes in your lifestyle.Target hormonal imbalances and raise metabolism to solve your weight-loss challenges!

BURNS FAT | RAISES METABOLISM | DOCTOR SUPERVISEDTARGETS BELLY, BUTT, HIPS, THIGHS

Using NRF Technology to create a weight loss plan just for you. Lose 20-40 lbs in 40 Days. No strenuous dieting, no hunger, no cravings. Target hormonal imbalance and raise metabolism. Get started today. See ad, back cover.

WELLNESS PRODUCTINVISIDERM HEALTHCARE790 E, Colorado Blvd, 9th Fl, Pasadena CA, 91101626-244-8090/[email protected]@MyInvisiDerm.comMyInvisiDerm.com/DOXYVA.com

InvisiDerm is an emerging mult inat ional leader in proprietary circulatory and non-invasive applications focused on significantly improving blood flow in the m i c r o c i r c u l a t i o n w i t h oxygenation. See ad, page 31.

YOGA STUDIOPURE PILATESGulf Breeze Proper221 Gulf Breeze Pkwy • 850-932-3424Downtown Pensacola426 S Palafox • 850-607-2772PurePilatesPensacola.com

We have yoga for everyone at Pure. Basic, Flow and Fusion will leave you feeling stretched and centered to take on the rest of your day. Inquire about variety and times. See ads, page 7 and 13.

Alternative Health Food Store Since 1998• Educated and friendly Staff • Quality Vitamins & Supplements• Essential Oils for a healthy lifestyle.

Natural Health Assessments:Iridology

Tongue and Fingernail AssessmentRefl ex Nutrition Assessment

By appointment, $50.

850-994-3606 • AlternativeHealthFoodStore.com

Quality Vitamins & SupplementsEssential Oils for a healthy lifestyle.

Alternative Health Food StoreMon-Fri 9-6 • Sat. 9-35533 Hwy 90 • Pace, FL“Where healing comes naturally”

Restore Your Skin to its Natural, Youthful Beauty with our new Advanced Healing Skin Cream

Like us on Facebook at Natural Awakenings Webstore

Order online todayShopNaturalAwakenings.com

or call: 888-822-0246

You’ll love Natural Awakenings’ therapeutic cream’s clean, fresh botanical fragrance. Discover what our amazing skin cream can do:• Provides Ultra-Hydration of Skin• Enhances Anti-Aging and Skin Renewal• Soothes Dry, Itchy, Cracked Skin• Relieves Most Burns Including Sunburn• Comforts Wounds and Sores

MANUKA HONEY is produced by bees that pollinate New Zealand’s

Manuka bush. Advocates tout its antibacterial properties.

4-oz jar $21.99 plus $5 shipping

Page 52: Natural Awakenings Pensacola June 2015

52 Natural Awakenings of Northwest Florida www.NWFNaturally.com

Renee Lost 54lbs!

Because of Our Technology

LEARN ABOUT THIS UNIQUE FAT LOSS SYSTEM THAT IS CUSTOM PLANNED JUST FOR YOU!

Scott Ewing, DC, NutriMost Niceville705 West John Sims Parkway

Niceville, FL 32578 844.441.THIN

CALL 844-441-THIN AND START TODAY!

“Using NRF TECHNOLOGY,

We will create a

custon weight loss plan

JUST FOR YOU!

How would you like to

lose 20 or more pounds,

have more energy, feel great

and begin a healthier lifestyle

in the next 40 Days?"

Scott Ewing, DC

LOSE 20-40+ POUNDSin 40 Days

www.EmeraldCoastFatLoss.comVisit our website to see how you can start losing weight today!

BEFORE

AFTER

No strenuous dieting. No hunger or cravings. No radical changes in your lifestyle.Target hormonal imbalances and raise metabolism to solve your weight-loss challenges!

BURNS FAT | RAISES METABOLISM | DOCTOR SUPERVISEDTARGETS BELLY, BUTT, HIPS, THIGHS