Lexicon of CanadianStratigraphy

Volume 4

Western Canada

Editor : D.J. Glass

Electronically Publishedby Flexys Systems

Lexiconof

Canadian StratigraphyVolume 4

Western Canada, IncludingEastern British Columbia,

Alberta, Saskatchewanand

Southern ManitobaEditor: D. Glass

Canadian Society of Petroleum Geologists

1990 Calgary, Alberta1997

ISBN 0-920230-23-7

Electronically Published in Canadaby

Flexys Systems

While every attempt has been made in the publishing of this lexicon to maintain the accuracy of the originalpaper version, Flexys Systems cannot accept responsibility or liability for any errors that may have occurredas a result of the OCR (optical character recognition) software utilized in digitizing the original.

Lexicons of Canadian Stratigraphy

Volume I - Arctic Archipelago (District of Franklin).

Volume 2 - Yukon-Mackenzie (Yukon Territory and District of Mackenzie).

Volume 3 - Western Cordillera (southwestern Yukon Territory and WesternBritish Columbia).

Volume 4 - Western Canada (eastern British Columbia, Alberta, Saskatchewanand southern Manitoba).

Volume 5 - Central Canada (Ontario, Quebec, northern Saskatchewan andManitoba and District of Keewatin).

Volume 6- Atlantic Region (New Brunswick, Prince Edward Island, NovaScotia and Newfoundland and Labrador).

PREFACE

The Lexicon of Canadian Stratigraphy, Volume 4, Western Canada (including eastern BritishColumbia, Saskatchewan and southern Manitoba) is the third lexicon to be published by theCanadian Society of Petroleum Geologists on stratigraphic units within the Western CanadaSedimentary Basin. The first, published in 1954 contained 196 names of stratigraphic units inAlberta. The Lexicon of Geologic Names in the Western Canada Sedimentary Basin and ArcticArchipelago, published in 1960 described 554 units.

Since 1960 the profusion of published and unpublished geological information has resulted in thecreation of many new names and an improved understanding of many earlier named units. Thecoverage of the 1960 lexicon has been divided into three regions for the present Lexicons ofCanadian Stratigraphy series; the first two volumes of which, on the Arctic Archipelago (District ofFranklin) and Yukon Territory and District of Mackenzie were published in 1981; the present volumecompletes the trio.

This volume contains 1178 entries ranging in age from Precambrian to Recent, arranged inalphabetical order. It includes formal, many informal, some obsolete and some local names definedin western Canada, but does not claim to include all of the geological unit names currently in use inone way or another in Western Canada. A list of the contents of the volume by geologic systemfollows the preface.

The area covered lies generally between 49N and 60N, from the Rocky Mountain Trench tooutcrops of the Precambrian Shield in Saskatchewan and Manitoba.

The lexicon is intended to provide an initial reference for those seeking information on specificstratigraphic units. Due to the scope of the volume however, some entries may be a little dated,but the extensive bibliography should lead researchers to further readings.

The entries in the lexicon reflect the efforts of at least the 121 contributors and reviewers listedbelow. The Canadian Society of Petroleum Geologists is grateful to these, and to the many otherswhose names do not appear in the list, but who also contributed their time and knowledge.

RNAJDALDAJMAHRBRKABGBGEBDRBAIBWGECMPCHAKCBICEACJECJJCWACDGCMPCJHC

R.N. AdairJ.D. AitkenL.D. AndriashekJ.M. AndrichukH.R. BelyeaR.K.A. BezysG. BloyG.E. BournsD.R. BramanA.I. BurnettW.G.E. CaldwellM.P. CecileH.A.K. CharlesworthB.I. ChiE.A. ChristiansenJ.E. ChristopherJ.J. ClagueW.A. CobbanD.G. CookM.P CoppoldJ.H. Craig

KLCWGCCDJADCEDRWELSEZFRPFPRFNRFWKFHGDWGLDGRGGASPGFMHHLHRLHG.H.

K.L. CurrieW.G. CutlerC. DawesJ.A. DolphC.E. DunnR.W. EdieL.S. EliukZ. FarshoriR.R FeatherstoneP.R. FermorN.R. FischbuchW. K. FooH. GabrielseD.W. GibsonL.D. GraystonR.G. GreggsLexicon 1960F.M. HaidlH.L. HalbertsmaR.L. HallG. Hassler

RJHBJHCMHHEHRYHLVHKEJTTZJDMKRWKJWKFFKLKKJLGBLMMLJFLMLGMSMKAM

R.J. HawesB.J. HayesC.M. HendersonH.E. HendryR.Y. HiggsL.V. HillsK.E. JacksonT.T.Z. JerzykiewiczD.M. KentR.W. KlassenJ.W. KramersF.F. KrauseL.K. KreisJ. LawG.B. LeechM.M. LerandJ.F. LerbekmoM. LomendaG. MacauleyS. MachielseK .A. McAdam

HRMJGMMRMAMRLMJRMMEMRDMDHMNCMDKRMPAMPFMDWMGDMEWMMRMBSNAWNDKN

H .R. McCabeJ.G. McCamisM.R. McDonoughA. McGuganR.L. McKellarJ.R. McLeanM.E. McMechanR.D. McMechanD.H. McNeilN.C. Meijer DreesK.R. MilnerP.A. MonahanP.F. MooreD.W. MorrowG.D. MossopE.W. MountjoyM.R. MudgeB.S. NorfordA.W. NorrisD.K. Norris

DWODFPAEHPEEPDGPGGPDAPLLPRAPDCPPEPRARBCRBRJWRLSRNWRHSWWSFS

D.W. OrganD.F. PatersonA.E.H. PedderE.E. PelzerD.G. PennerG.G. PhippsD.A. PounderL.L. PriceR.A. PriceD.C. PughP.E. PutnamR.A. RahmaniB.C. RichardsB. RottenfusserJ.W. RowlingL.S. RussellN.W. RutterH. SabryW.W. ShepheardF. Simpson

CSSKSAMacSSCRSFASDFSGCTLTBDRTJAVJHWIWJWJAWEPWGKWRdeWFGYGZ

C. SinghS.K. SrivastavaA. MacS. StalkerC.R. StelckFA. StoakesD.F. StottG.C. TaylorL. Ter BergD.R. TurnerJ.A. VonhofJ.H. WallI. WeihmannJ. WendteJ.A. WestgateE.P. WilliamsG.K. WilliamsR. deWitF.G. YoungG. Zolnai

The Society also expresses its appreciation to P.A.. Monahan for the early planning of the lexicon in1978 and for serving as committee chairman until 1984. Thanks are also due to J. Grassby, whoheaded the project from 1984 to 1986, and to all those who served on those committees.The contribution of Canterra, Gulf Canada and CN Exploration, who housed the accumulating filesof data; Core Laboratories for providing the Stratigraphic Correlation Chart; Federal and Provincialgeological institutions, Universities and Industry, which provided contributors to the project was, asalways indispensible. Deanna Dunne, of the C.S.P.G. office, expertly typed and sorted thereference list.

The present Lexicon Committee, with D.J. Glass as Editor completed the project in 1990.

Andre ChowPaul FrydlCarl HughsonJeff McLeanChristian Buck, Chairman

CONTENTS OF LEXICON BY SYSTEM

QUATERNARYAikins TillAlbertan FormationArran FormationAssiniboine Valley SedimentsAthabasca TillBalzac TillBaseline TillBattleford FormationBedford FormationBelair DriftBighill Creek FormationBonnyville FormationBow Valley TillBridge River TephraBrocket TillBronson Lake FormationBuffalo Lake TillCalgary SiltCanmore TillCartwright TillChain Lakes Clays and SiltsColeharbor MemberCondie TillCrossfield TillCypress Hills FormationCypress Hills LoessDeserters Canyon TillDrystone Creek TillDrywood SoilEcho Lake GravelEdson TillEisenhower Junction TillElkwater DriftEmpress Group (Formation)Ernst TillErratics Train TillEthel Lake FormationEtzikom DriftExpanse FormationFloral FormationFurman TillGlacier Peak TephraGlenwoodville DriftGrand Centre FormationGrunthal Formation

Hazel FormationHidden Creek TillHummingbird TillIrvine Bed (Glacier PeakTephra)Jackfish Creek TillKennedy DriftKimball DriftLabuma TillLac du Bonnet FormationLake Agassiz ClaysLamoral TillLargs FormationLeinan TillLennard FormationLenzie SiltLethbridge DriftLibau DriftLochend TillLowland GravelManyberries Volcanic AshMarchand FormationMarguerite TillMarie Creek FormationMarlboro TillMarsh Creek TillMarysville SandsMaunsell TillMayberne TillMaycroft TillMazama Tephra (Galata Ash,Bighill Spring Ash)Midnapore SiltsMinnedosa FormationMisty TillMitchell Bluff FormationMorley TillMount St. Helens Set YTephraMuriel Lake FormationObed TillOldman DriftPakowki DriftPekisko TillPorcupine Till

Portage Mountain TillPrelate Ferry PaleosolQuAppelle AlluviumRaven Creek TillRegina ClayRiddell MemberRoaring River ClayRosa FormationRoseau FormationRouleau ClaySand River FormationSaskatoon GroupSt. Malo FormationSaskatchewan GravelsSenkiw FormationSheep River Silts and ClaysShell FormationSouris Sand and GravelSprague FormationSpy Hill TillStimson Creek TillStrathcona Sand and SiltStuartburn FormationSutherland GroupSylvan Lake TillTableland GravelTee Lakes FormationTimber Creek TillTofield SandTolstoi FormationTwin Cliffs FormationVita FormationWalsh DriftWascana Creek Ash(Pearlette Tephra)Wellsch Valley TephraWhitemouth Lake FormationWhiteshell FormationWhoop up FormationWildhorse DriftWolf Island SedimentsWoodmore FormationWymark TillZelena Formation

TERTIARY

Del Bonita GravelsFlaxville FormationFoothills SeriesGoodlands MemberHand Hills FormationKishenehn FormationPaskapoo Formation

Peace Garden MemberPorcupine Hills FormationRavenscrag FormationSaddle Hills ConglomerateSaint Eugene FormationSaskatchewan GravelsSwan Hills Gravels

Sweetgrass Hills DykesSwig Current Creek BedsTurtle Mountain FormationWintering Hills GravelsWood Mountain Beds

CRETACEOUSAlberta GroupAlderson MemberAlexander SandstoneAlice Creek TongueAllison FormationAmundson MemberAquadell MemberArdkenneth MemberArdley Coal SeamAshville FormationAshville SandAssiniboine MemberAthabasca Oil SandsAtlas MemberBad Heart FormationBantry Shale MemberBarons SandBasal Colorado SandBasal QuartzBassano MemberBassano South SandstoneBattle FormationBaytree MemberBearpaw FormationBeattie Peaks FormationBeaudette GroupBeaver Mines FormationBeechy MemberBelanger MemberBelle Fourche Shale MemberBelly River FormationBenton ShaleBerland River SharesBickerdike MemberBickford FormationBig River Formation

Bighorn FormationBirch Lake MemberBlack Eagle MemberBlackleaf FormationBlackmud MemberBlackstone FormationBlairmore Group (FormationsBlood Reserve FormationBluesky FormationBoissevain FormationBonanza SandstoneBootlegger MemberBorradaile MemberBoulder Creek FormationBow Island FormationBowdoin SandstoneBoyne MemberBoyne SandBrazeau FormationBrenot FormationBroderick MemberBrosseau MemberBrown Lime SubmemberBuckinghorse FormationBuick Creek SandBullhead GroupBulwark SandstoneBulwell MemberBurnstick MemberCadomin FormationCadotte MemberCalahoo SandstoneCalcareous MemberCameron SandCantuar FormationCarbon Gas Sandstone

Cardinal MemberCardium FormationCardium Zone MemberCarlile ShaleCarrot Creek MemberCessford SandCheval BedsChinook MemberChungo MemberClaggett FormationClearwater FormationCoal SandCoalspur BedsColony SandColorado GroupCommotion FormationComrey MemberCone MemberCosmos SandCoulter MemberCrassier GroupCrooked Hole SandCrowsnest FormationCruikshank MemberCruiser FormationCrystal ClinobedCummings MemberCut Bank SandstoneDakota Formation (Group)Dalhousie ConglomerateDarling SandDeadhorse Coulee MemberDemaine MemberDetrital (Deville) BedsDeville Formation (Detrital)Dimmock Creek Member

CRETACEOUS (continued)Dina MemberDismal Rat MemberDoe Creek SandstoneDokie Ridge MemberDowling MemberDorothy BentoniteDorothy SandstoneDresser FormationDrumheller Marine TongueDunlevy FormationDunvegan FormationDynneson SandstoneEagle FormationEastend FormationEdmonton Formation (Group}Ellerslie MemberEntrance ConglomerateFalher MemberFavel FormationFerdig MemberFirst Castor SandstoneFirst White Speckled ShaleFish Scale SandstoneFlood MemberFlotten Lake SandFloweree MemberForemost FormationFort Augustus FormationFort Nelson FormationFort St. John GroupFox Hills FormationFrenchman FormationGammon Ferruginous ShaleGarbutt FormationGarden Plain TuffGates FormationGeneral Petroleum (G.P.) SandGething FormationGiroux SandGladstone FormationGlauconitic SandstoneGoodrich FormationGorman Creek FormationGrande Cache MemberGrand Rapids FormationGreenhorn LimeGrit Bed

Grizzly Bear MemberHamilton Lake SandHanson MemberHarmon MemberHasler FormationHaven MemberHell Creek FormationHighwood SandstoneHome SandHoosier ClinobedHornbeck MemberHorseshoe Canyon FormationHorsethief SandstoneHoward Creek MemberHowell Creek IntrusivesHulcross FormationInyan Kara GroupIslay MemberJoli Fou FormationJudith River FormationJumping Pound MemberKakwa MemberKarr MemberKaskapau FormationKeld MemberKevin MemberKipp SandstoneKiska MemberKneehills TuffKootenai FormationKotaneelee FormationLabiche FormationLander SandLaurier Limestone BedsLea Park FormationLepine FormationLethbridge MemberLeyland MemberLineham MemberLloydminster FormationLloydminster (Lloyd) SandLooma MemberLoon River ShaleLuscar FormationMa Butte FormationMacGowan Concretionary BedMagrath Sandstone

Malcolm Creek FormationMannville GroupManyberries MemberMarco CalcareniteMarias River ShaleMarshybank Member(Formation)Martin Sandy ZoneMatador MemberMcDougall-SegurConglomerateMcLaren MemberMcLeod MemberMcCloud MemberMcMurray FormationMedicine Hat SandstoneMedicine Lodge MemberMerrington ClinobedMillwood MemberMilk River FormationMill Creek FormationMinnes GroupMonach FormationMontana GroupMonteith FormationMoosebar FormationMoosehound MemberMorden ShaleMosby SandstoneMoulton MemberMountain Park FormationMowry Shale FormationMulga TongueMuskiki Member (Formation)Musreau MemberMyrtle Creek FormationNevis MemberNewcastle FormationNewcastle SandstoneMemberNiobrara FormationNomad MemberNosehill MemberNotikewin MemberNunki SandstoneOdanah MemberOkla Sandstone

CRETACEOUS (continued)Opabin MemberOldman FormationOstracod BedsOstrea ShaleOSullivan MemberOutlook MemberOxarart MemberPaddy MemberPaintearth MemberPakan FormationPakowki FormationPale BedsPeace River FormationPelican FormationPembina MemberPembina Mountain GroupPembina River MemberPense FormationPhillips SandstonePierre ShalePocaterra Creek MemberPouce Coupe MemberProvost MemberPuskwaskau FormationRam MemberRaven River MemberRed Speck ZoneResidual ZoneRex SandRibstone Creek MemberRicinus MemberRiding Mountain FormationRyegrass SandstoneSage Hen LimestoneSaunders GroupSawridge FormationScatter FormationScollard Formation

Second Castor SandstoneSecond White SpecksSandstoneSecond White SpeckledShaleShaftesbury FormationShandro MemberSherrard MemberSifton FormationSikanni FormationSkull Creek Shale MemberSmiley ClinobedSmoky (River) GroupSnakebite MemberSolomon SandstoneSparky SandSpikes ZoneSpinney Hill MemberSpirit River FormationSt. Edouard MemberSt. Eloi ClinobedSt. John FormationSt. Mary River FormationSt. Walburg SandstoneStockmans SandSturrock MemberSuccess FormationSully FormationSunburst Sandstone MemberSunkay MemberSunset SandstoneSwan River FormationTaber SandstoneTaft Hill MemberTelegraph Creek FormationThelma MemberThistle MemberTolman Member

Torrens MemberTovell MemberTuscoola MemberTussock MemberTwo Medicine FormationUnnamed Upper ColoradoShaleVanalta SandVanesti TongueVaughn MemberVerdigris MemberVermilion MemberVermilion River FormationVictoria MemberViking ChertViking ConglomerateViking FormationVimy MemberVirgelle MemberWabiskaw MemberWainwright SandstoneWalton Creek MemberWapella SandWapiabi FormationWapiti FormationWartenbe SandstoneWaskahigan MemberWaseca SandWestgate MemberWhitemud FormationWhitemud MemberWhite Speckled ShaleWildhorn MemberWillow Creek FormationWilrich MemberYoung Creek Member

JURASSICAdanac MemberAmaranth FormationBalmer Coal SeamBelemnite ZoneBlack Chert MemberBrown SandConrad MemberCorbula munda BedsCrow Indian Lake MemberElk FormationEllis GroupFernie Formation (Group)Firemoon MemberGravelbourg FormationGreen BedsGrey BedsGryphaea BedGypsum Spring FormationHighwood Member

Hillcrest MemberKootenay GroupLille MemberMasefield ShaleMelita FormationMist Mountain FormationMoose Mountain MemberMorrison FormationMorrissey FormationMutz MemberNikanassin FormationNordegg MemberOxytoma BedPaper ShalePassage BedsPigeon Creek MemberPine River FormationPiper FormationPoker Chip Shale

Poker FormationRed Deer MemberRed Jacket FormationReston FormationRibbon Creek MemberRibbon Sand MemberRierdon FormationRock Creek MemberRoseray FormationRush Lake ShaleSawtooth FormationShaunavon FormationSwift FormationTampico MemberVanguard Formation (Group)Waskada FormationWatrous FormationWeary Ridge Member

TRIASSICAlder MemberArtex MemberBaldonnel FormationBearberry Sand (=Bear Flat)Bear Grass (Bear Flat)MemberBlueberry MemberBocock FormationBoundary MemberBrewster Limestone MemberCecil MemberCharlie Lake FormationCoplin MemberCutbank (Braeburn, Valhalla)SandstoneDark SiItstonesDemmitt MemberDiaber (Daiber) GroupDoig FormationDucette Member

Farrell Member FlagstonesGrayling FormationGrey BedsGroundbirch MemberHalfway FormationHart Pass FormationInga MemberKobes MemberLa Glace MemberLiard FormationLlama MemberLudington FormationMacKenzie Dolomite LentilMica MemberMoberly Member/DolomiteMontney FormationMount Wright FormationNancy MemberNorth Pine MemberOlympus Sandstone Lentil

Pardonet FormationPhroso Siltstone MemberSchooler Creek GroupSeptimus MemberSiphon MemberSpearfish FormationSpray River GroupStarlight Evaporite MemberSulphur Mountain FormationTangent DolomiteToad FormationTwo Rivers SandValhalla (Cutbank) SandVega Siltstone MemberWhistler MemberWhitehorse FormationWilder MemberWinnifred MemberWorsley (Tangent) Dolomite

PERMIANBelcourt FormationBelloy FormationChowade GroupFantasque FormationHanington Formation

Ishbel GroupJohnston Canyon FormationKindle FormationMount Greene BedsMowitch Formation

Ranger Canyon FormationRoss Creek FormationSt. Martin ComplexTelford Formation

PENNSYLVANIANFording FormationFortress Mountain BedsGreenoch FormationKananaskis FormationMisty FormationNorquay Formation

Rocky Mountain Group(Formation)Spray Lakes CroupStorelk FormationStorm Creek FormationTaylor Flat Formation

Tobermory FormationTodhunter MemberTunnel Mountain Formation(Restricted)Tyrwhitt Formation

MISSISSIPPIANAlida BedsAllan Mountain FormationAuburnton-Huntoon EvaporiteBakken FormationBand FormationBanffian SeriesBanner (Silt) MemberBaril MemberBig Snowy GroupCarievale EvaporiteCarnarvon MemberCastle Reef DolomiteCharles FormationClarks MemberClausen FormationColeville MemberDando EvaporiteDebolt FormationDessa Dawn FormationDyson Creek MemberElkton MemberEtherington FormationExshaw FormationFlossie Lake MemberForget-Nottingham LimestoneFrobisher Beds

Frobisher-Alida BedsFrobisher EvaporiteGainsborough EvaporiteGolata FormationHastings EvaporiteHastings-Frobisher BedsJasper Lake MemberKibbey FormationKilldeer BedsKisbey SandstoneKiskatinaw FormationLivingstone FormationLodgepole FormationLoomis MemberLower PorousMadison GroupMarston MemberMattson FormationMidale BedsMidale EvaporiteMiddle DenseMission Canyon FormationMoosehorn FormationMount Head FormationOpal MemberOungre Evaporite

Pekisko FormationPoplar BedsProphet FormationQueensdale LimeRatcliffe BedsRay MemberRoutledge Shale FaciesRundle GroupSalter MemberScallion MemberShunda FormationSouris Valley BedsStoddart GroupStrathallen BedsSun River MemberTilston BedsTurner Valley FormationUpper PorousVirden MemberWhitewater Lake MemberWileman MemberWillmar EvaporiteWillmar LimeWinlaw Evaporite

DEVONIAN

Alexandra Member (Formation)Alexo FormationAmco ShaleArcs MemberArnica FormationAshern FormationBanffian SeriesBasal Red Beds (Lotsberg)Bear Rock FormationBeaver MemberBeaverhill Lake Group(Formation)Bedson FormationBeechy HaliteBelle Plaine MemberBesa River FormationBiggar SaltBigoray MemberBig Valley FormationBirdbear FormationBistcho MemberBlack Creek MemberBlackface Mountain ShaleBlue Ridge MemberBorsato FormationBoule FormationBroadwood MemberBuffalo River MemberBull River UnitBurnais FormationBurr MemberCairn FormationCalmar FormationCalumet (Calmut) MemberCamrose MemberCardinal Lake MemberCarievale EvaporiteCedared FormationCheviot FormationChinchaga FormationChipewyan MemberCynthia MemberChristina MemberCinquefoil FormationCold Lake FormationContact Rapids Formation

Cooking Lake FormationCoronach FormationCostigan MemberCripple TongueCrossfield MemberCrowfoot FormationD1D2D3Davidson EvaporiteDavidson MemberDawson Bay FormationDawson Bay (DB1-DB6members)Delia MemberDellwood FormationDinsmore EvaporiteDixonville MemberDunedin FormationDuperow FormationDuvernay FormationEatonia EvaporiteEbbutt MemberElk Point GroupElm Point FormationElrose EvaporiteElstow MemberEntice DolomiteErnestina Lake FormationEscarpment MemberEsterhazy MemberEvie MemberFairholme GroupFiddle FormationFirebag MemberFirst Red BedsFitzgerald FormationFlat Lake EvaporiteFlume FormationFort Simpson FormationFort Vermilion FormationGhost River FormationGilwood MemberGraminia FormationGranite WashGrosmont Formation

Grotto MemberGrumbler GroupHare Indian FormationHarris MemberHarrogate FormationHatfield MemberHay Camp MemberHay River FormationHay River LimestoneHoldfast EvaporiteHollebeke FormationHondo MemberHorn River FormationHubbard EvaporiteIce River ComplexIreton FormationIsland River MemberJean Marie (Utahn) MemberJefferson Formation (Group)Kakisa FormationKeg River FormationKiln FormationKlua FormationKotcho FormationLa Loche FormationLast Lake MemberLeduc FormationLeofnard SaltLittle Buffalo FormationLivock River FormationLobstick MemberLonely Bay FormationLotsberg FormationLouise Falls MemberLyleton FormationMafeking MemberMajeau Lake MemberMaligne FormationManitoba GroupManning SandMaxim MemberMcLean River FormationMeadow Lake FormationMeekwap MemberMessines Formation

Presquile FormationQuAppelle GroupQuill Lakes Marker BedsRainbow MemberRatner MemberRedknife FormationRegway MemberRoche Miette FormationRonde MemberRosevear MemberSagemace MemberSaskatchewan GroupSaskatoon MemberSassenach FormationSecond Red Bed MemberSeward MemberSharky MemberShell Lake MemberSimla FormationSlave Point FormationSmoothstone River FormationSouris River FormationSouthesk FormationSpence River FormationSpringburn MemberStarbird FormationSteen River FormationStettler FormationStone FormationSulphur Point Formation

Swan Hills FormationTathlina FormationTelegraph MemberTerritories FormationTetcho FormationThree Forks GroupTorquay FormationTrout River FormationTurtle Mountain GroupTwin Falls FormationVirginia Hills FormationVonda MemberWabamun GroupWabasca MemberWaterways FormationWatt Mountain FormationWesterdale MemberWhite Bear Marker BedsWhitkow MemberWhitelaw MemberWinnipegosis FormationWinterburn GroupWokkpash FormationWolf Lake MemberWolverine MemberWoodbend GroupWymark MemberYahatinda FormationZ MarkerZama MemberZeta Lake Member

DEVONIAN (continued)

SILURIANFife Lake FormationFisher Branch DolomiteGuernsey FormationHanson BedsInterlake Group (Formation)Inwood FormationMoose Lake Dolomite

Nonda (Ronning) FormationRisser BedsRupert BedsSandpile GroupStrathclair FormationTaylorton MemberTegart Formation

Methy FormationMikkwa MemberMikkwa FormationMildred MemberMink MemberMinnewanka GroupMoberly MemberMorro MemberMorse River SandMount Forster FormationMount Hawk FormationMuncho-McConnell FormationMuskeg FormationMuskwa MemberNahanni FormationNeely MemberNisku FormationNormandville MemberNyarling FormationOtter Park MemberPalliser FormationPatience Lake MemberPeace Point MemberPeechee MemberPerdrix FormationPine Point Formation (Group)Pipestone FormationPoint Wilkins MemberPotlatch MemberPrairie Evaporite

Atikameg DolomiteBrandon FormationBrisco FormationCedar Lake FormationChemahawin MemberCross Lake MemberEast Arm Dolomite

ORDOVICIANBeaverfoot FormationBighorn (Tyndall) GroupBirse MemberBlack Island MemberCarman SandCat Head MemberChushina FormationCloudmaker FormationCoronach MemberDeer Island MemberDog Head MemberFort Garry MemberGlenogle FormationGunn MemberGunton Member

Hartaven MemberHecla BedsHerald FormationIce Box MemberLake Alma MemberMirage Point FormationMons FormationMount April FormationMount Wilson FormationOutram FormationOwen Creek FormationPenitentiary MemberRed River FormationRedvers UnitRoughlock Member

Sarbach FormationSelkirk MemberSinclair FormationSkoki FormationStonewall FormationStony Mountain FormationStoughton MemberSurvey Peak FormationTipperary QuartziteTyndall StoneWhiskey Trail MemberWilliams MemberWinnipeg FormationWonah QuartziteYeoman Formation

CAMBRIANAdolphus FormationAlbetella ZoneAmiskwi MemberArctomys FormationAtan GroupBarker ShaleBison Creek FormationBosche FormationBosworth FormationBurgess Shale LentilBurton FormationCanyon Creek FormationCastle Mountain GroupCathedral FormationChancellor FormationChephren MemberChetamon FormationChetang FormationCorona FormationCranbrook FormationDeadwood FormationDome Creek FormationDonald FormationEager FormationEarlie FormationEldon FormationElko Formation

Fairview FormationField MemberFinnegan FormationFlathead FormationFort Mountain FormationGog Formation (Group)Goodsir FormationGordon FormationHitka FormationHota FormationJonas Creek FormationJubilee FormationKechika GroupKinbasket LimestoneLake Louise ShaleLyell FormationLynx Formation and GroupMahto FormationMcKay GroupMcNaughton FormationMidas FormationMistaya FormationMount Selwyn FormationMount Synge FormationMount Whyte FormationMountain Creek FormationMumm Limestone

Mural FormationMurchison FormationNaiset FormationNarao MemberOgygopsis Shale LentilOttertail FormationPaget FormationPeyto FormationPika FormationPtarmigan FormationRobson LimestonesRoss Lake MemberSabine FormationSawback FormationSherbrooke FormationSnake Indian FormationSnaring FormationStephen FormationSt. Piran FormationSullivan FormationSullivan QuartziteSunwapta Peak FormationTakakkaw TongueTanglefoot UnitTangle Ridge FormationTatei FormationTershishner Member

CAMBRIAN (continued)Thompson DolomiteTitkana FormationTrinity Lakes MemberTsar Creek Formation

Wapta MemberWaputik MemberWaterfowl Formation

Weed MemberWindsor Mountain Formation

PRECAMBRIANAida FormationAldridge FormationAltyn FormationAppekunny FormationAppistoki MemberAthabasca Formation (Group)Badshot FormationBoulder Pass FormationByng FormationCarswell (Trout Lake)Format ionCarthew MemberChischa FormationCorral Creek FormationCreston FormationCrowfoot DykeCunningham FormationDouglas FormationDutch Creek FormationFair Point FormationFort Steele FormationGalton SeriesGataga FormationGateway FormationGeorge Formation

Goathaunt MemberGranite Park MemberGrinned FormationHaig Brook FormationHamill SeriesHector FormationHefty FormationHell Roaring MemberHenry Creek FormationHorsethief Creek GroupJasper Formation (Series)Kintla FormationKitchener FormationLazenby FormationLewis SeriesLocker Lake FormationMacDonald FormationManitou Falls FormationMeadow Creek FormationMiette GroupMiller Peak FormationMisinchinka GroupMount Baker UnitMount Nelson FormationMount Rowe Member

Nicol Creek FormationOld Fort Point FormationOtherside FormationPhillips FormationPurcell LavaPurcell (Belt) SupergroupRed Gap MemberRoosville FormationScenic Point MemberSheppard FormationSiyeh FormationSiyeh FormationTetsa FormationToby FormationTombstone MountainFormationTuchodi FormationTuma Lake FormationVan Creek FormationWaterton FormationWigwam FormationWindermere SupergroupWolverine Point FormationWynd Formation

Comparison of United States-Canada Nomenclature forPurcell-Belt Supergroup

United States

Belt SupergroupBonner QuartziteEmpire Formation

Garnet Range FormationGreyson FormationHelena FormationMcNamara FormationMissoula Group

Mount Shields FormationPiegan GroupRavalli GroupRed Plume QuartziteShepard FormationSnowslip FormationSpokane FormationWerner Peak Formation

Canada

Purcell SupergroupPhillips Formationlower member of Siyeh Formation

does not extend to Canadian BorderAppekunny Formationmiddle member of Siyeh FormationRoosville FormationGateway, Phillips and Roosville Formationsand Upper Member of Siyeh FormationGateway Formation (Restricted)middle member of Siyeh FormationCreston FormationPhillips FormationSheppard Formationupper member of Siyeh FormationGrinnell Formationlower member of Siyeh Formation

Table of ContentsLexicons of Canadian StratigraphyPREFACECONTENTS OF LEXICON BY SYSTEMComparison of United States-Canada

Nomenclature for Purcell-Belt Supergroup

AAdanac Member (Mist Mountain Formation)Adolphus FormationAida FormationAikins TillAlberta GroupAlbertan FormationAlbertella Zone (Obsolete)Alder Member (Charlie Lake Formation,Alderson Member (Lea Park Formation)Aldridge Formation (Purcell Supergroup) Alexander Sandstone (Ellerslie Formation,

Mannville Group)Alexandra Member (Formation) (Twin Falls

Formation)Alexo Formation (Partly superseded)Alice Creek Tongue (Grand Rapids Formation)Alida Beds (Frobisher-Alida Beds)Allan Mountain Formation (Madison Group)Allison Formation (Obsolete)Altyn Formation (Belt-Purcell Supergroup)Amaranth FormationAmco ShaleAmiskwi Member (Stephen Formation)Amundson Member (Cardium)Appekunny Formation (Belt-Purcell Supergroup)Appistoki Member (Appekunny Formation,Aquadell Member (Bearpaw Formation)Arcs Member (Southesk Formation)Arctomys FormationArdkenneth Member (Bearpaw Formation)Ardley Coal Seam (Edmonton Formation)Arnica FormationArran FormationArtex MemberAshern Formation (Elk Point Group)Ashville Formation

Ashville Sand (Ashville Formation, ColoradoGroup)

Assiniboine Member (Favel Formation) Assiniboine Valley SedimentsAtan GroupAthabasca Formation (William River Subgroup)Athabasca Oil Sands (Athabasca Tar Sands)Athabasca TillAtikameg Dolomite (Interlake Group)Atlas Member (Cantuar Formation)Auburnton-Huntoon Evaporite (Frobisher Beds)

(Obsolete)

BBad Heart Formation (Smoky Group)Badshot FormationBakken FormationBaldonnel Formation (Schooler Creek Group)Balmer Coal Seam (Mist Mountain Formation)Balzac Till (Informal name)Banff Formation (Uppermost Devonian)Banffian Series: (Obsolete)Banffian Serifs (Obsolete)Banner (Silt) Member (Shunda Formation)Bantry Shale Member (Lower Mannville

Formation)Baril Member (Mount Head Formation)Barker Shale (Obsolete)Barons Sand (Colorado Group)Basal Colorado Sand (Colorado Group)Basal Quartz (Mannville Group)Basal Red Beds (Lotsberg Formation, Informal

name) Baseline TillBassano Member (Bearpaw Formation)Bassano South Sandstone (Bearpaw

Formation)Battle FormationBattleford FormationBaytree Member (Cardium Formation Smoky

Group)Bearberry SandBear Grass (Bear Flat) Member

Bear Rock FormationBearpaw Formation, Montana GroupBeattie Peaks Formation (Minnes Group)Beaudette Group (Abandoned)Beaver MemberBeaverfoot FormationBeaverhill Lake Group (Formation)Beaver Mines Formation (Blairmore Group)Bedford Formation (Informal name)Bedson Formation (Obsolete)Beechy Halite (Hatfield Member,Beechy Member (Bearpaw Formation)Belair Drift (Informal)Belanger Member (Bearpaw Formation)Belcourt Formation (Ishbel Group)Belemnite Zone (Fernie Formation,

Superseded)Belle Fourche Shale Member (Ashville

Formation)Belle Plaine Member (Prairie Formation, Elk

Point Group)Belloy Formation (Ishbel Group)Belly River Formation (Group)Benton Shale (Colorado Group) (Abandoned in

Canada)Berland River Shales (Obsolete)Besa River FormationBickerdike Member (Cardium Formation)Bickford Formation (Minnes Group)Biggar Salt (Disused)Bighill Creek FormationBighorn Formation (Obsolete)Bighorn (Tyndall) GroupBigoray Member (Nisku Formation)Big River Formation (Colorado Group,

Cretaceous)Big Snowy GroupBig Valley FormationBirch Lake Member (Judith River Formation)Birdbear Formation (Saskatchewan Group)Birse Member (Stony Mountain Formation,

Disused)Bison Creek FormationBistcho MemberBlack Chert Member (Fernie Formation,

Superseded)Black Creek MemberBlack Eagle Member (Bearpaw Formation)Blackface Mountain Shale (Obsolete)

Black Island Member (Winnipeg Formation)Blackleaf Formation (Colorado Group)Blackmud Member (Edmonton Group, Disused)Blackstone Formation (Alberta Group)Blairmore Group (Formation)Blood Reserve FormationBlueberry Member (Charlie Lake Formation,

Schooler Creek Group)Blue Ridge MemberBluesky FormationBabcock Formation (Schooler Creek Group)Boissevain FormationBonanza Sandstone (Peace River Formation,

Obsolete)Bonnyville Formation (Informal)Bootlegger Member (Blackleaf Formation)Borradaile Member (Mannville Formation,

Disused)Borsato Formation (Fairholme Group)Bosche Formation (Abandoned)Bosworth Formation (Obsolete)Boulder Creek Formation (Fort St. John Group)Boulder Pass Formation (Purcell-Belt

Supergroup, Abandoned)Boule Formation (Obsolete)Boundary Member (Charlie Lake Formation)Bow Island Formation (Colorado Group)Bow Valley TillBowdoin SandstoneBoyne MemberBoyne SandBrandon Formation (Interlake Group)Brazeau FormationBrenot FormationBrewster Limestone Member (Whitehorse

Formation)Bridge River TephraBrisco Formation (Abandoned)Broadwood Member (Alexo Formation)Brocket TillBroderick Member (Bearpaw Formation)Bronson Lake Formation (Informal)Brosseau Member (Judith River Formation,

Abandoned)Brown Lime SubmemberBrown Sand (Fernie Formation, superseded)Buckinghorse Formation (Fort St. John Group)Buffalo Lake TillBuffalo River Member

Buick Creek Sand (Gething Formation)Bullhead GroupBull River Unit (Invalid)Bulwark Sandstone (Bearpaw Formation)Bulwell MemberBurgess Shale Lentil (Stephen Formation)Burnais FormationBurnstick Member (Cardium Formation)Burr Member (Dawson Bay Formation,

Manitoba Group)Burton Formation (Abandoned)Byng Formation (Miette Group)

CCadomin Formation (Blairmore and Bullhead

Groups)Cadotte Member (Peace River Formation)Cairn Formation (Fairholme Group)Calahoo Sandstone (Ellerslie Member)Calcareous Member (Blairmore and Mannville

Formation, Group)Calgary Silt (Informal name)Calmar Formation (Winterburn Group)Calumet (Calmut) MemberCameron SandCamrose Member (Ireton Formation, Woodbend

Group)Canmore TillCantuar FormationCanyon Creek FormationCarbon Gas Sandstone (Upper Mannville)Cardinal Member (Cardium Formation, Alberta

Group)Cardinal Lake Member (Wabamun Formation)Cardium Formation (Alberta Group)Cardium Zone Member (Cardium Formation)Carievale Evaporite (Frobisher Beds) (Obsolete)Carlile Shale (Colorado Group)Carman Sand (Member or Lentil, Winnipeg

Formation)Carnarvon Member (Mount Head Formation)Carrot Creek Member (Cardium Formation)Carswell (Trout Lake) FormationCarthew MemberCartwright Till (Informal name)Castle Reef Dolomite (Madison Group)Castle Mountain Group (Obsolete)

Cat Head Member (Red River Formation)Cathedral FormationCecil Member (Charlie Lake Formation,

Schooler Creek Group)Cedared FormationCedar Lake Formation (Interlake Group)Cessford Sand (Colorado Group)Chain Lakes Clays and SiltsChancellor FormationCharles Formation (Madison Group)Charlie Lake Formation (Schooler Creek Group)Chemahawin Member (Cedar Lake Formation)Chephren Member (Mount Whyte Formation)Chetamon Formation (Abandoned)Chetang FormationCheval Beds (Abandoned)Cheviot Formation (Obsolete)Chinchaga FormationChinook Member (Wapiabi Formation)

(Obsolete)Chipewyan Member (Muskeg Formation)Chischa FormationChowade Croup (Redundant)Christina Member (Beaverhill Lake (Waterways)

Formation)Chungo Member (Wapiabi Formation, Alberta

Group)Chushina Fermation (Abandoned)Cinquefoil Formation (Obsolete)Claggett Formation (Montana Group)Clarks MemberClausen FonnationClearwater Formation (Mannville Group)Cloudmaker FormationCoal Sand (Blairmore Group)Coalspur Beds (Saunders Group)Coldharbor FormationColeville Member (Bakken Formation) Colony Sand (Joli Fou Formation) (Colorado

Group)Colorado GroupCommotion FormationComrey Member (Oldman Formation)Condie TillCone Member (Marias River Shale)Conrad Member (Sawtooth Formation, Ellis

Group)Contact Rapids FormationCooking Lake Formation (Woodbend Group)

Coplin Member (Charlie Lake Formation)Corbula Munda Beds (Fernie Formation)Corona Formation (Abandoned)Coronach Formation (Obsolete)Coronach Member (Herald Formation)Corral Creek Formation (Miette Group)Cosmos Sand (Disused)Costigan Member (Palliser Formation)Coulter Member (Pierre Shale)Cranbrook FormationCrassier Group (Abandoned)Creston Formation (Purcell Supergroup)Cripple Tongue (Mount Hawk Formation)Crooked Hole Sand (Blairmore Group)Crossfield Till (Informal)Crossfield Member (Stettler Formation/

Wabamun Group)Cross Lake MemberCrowfoot DykeCrowfoot Formation (Winterburn Group)Crow Indian Lake Member (Disused)Crowsnest FormationCrukShank Member, Bearpaw FormationCruiser FormationCrystal Clinobed (Viking Formation, Colorado

Group)Cummings Member (Clearwater Formation,

Mannville Group)Cunningham Formation (Cariboo Group)Cutbank (Braebum, Valhalla) Sandstone Cut Bank SandstoneCynthia Member (Nisku Formation)Cypress Hills FormationCypress Hills Loess (Informal narne)

DD-1 (Redundant; superseded by Wabamun

Group)D-2 (Nisku Formation)D-3 (Leduc Formation)Dakota Formation and GroupDalhousie Conglomerate (Blairmore Group)Dando Evaporite (Mission Canyon Formation,

Madison Group)Dark Siltstones (Obsolete)Darling Sand (Kootenai Formation, Disused)Davidson Evaporite

Davidson Member (Souris River Formation,Manitoba Group)

Dawson Bay Formation (Manitoba Group)Dawson Bay Formation (Manitoba Group)Deadhorse Coulee MemberDeadwood FormationDebolt FormationDeer Island Member (Winnipeg Formation)Del Bonita GravelsDelia Member (Abandoned)Dellwood Formation (Disused)Demaine Member (Bearpaw Formation)Demmit Member (Charlie Lake Formation)Deserters Canyon Till (Informal name)Dessa Dawn Formation (Obsolete)Detrital (Deville) Beds (Mannville Group)Deville Formation (Detrial)Diaber (Daiber) GroupDimmock Creek Member (Cantuar Formation)Dina Member (McMurray Formation, Mannville

Group)Dinsmore Evaporite (Wymark Member,Dismal Rat MemberDixonville Member (Wabamun Formation)Doe Creek MemberDog Head Member (Red River Formation)Doig FormationDokie Ridge MemberDome Creek Formation (Cariboo Group)Donald FormationDouglas FormationDowling Merrier (Wapiabi Formation, Alberta

Group)Dorothy Bentonite (Bearpaw Formation)Dorothy Sandstone (Bearpaw Formation)Dresser Formation (Abandoned)Drumheller Marine TongueDrystone Creek TillDrywood SoilDucette Member (Baldonnel Formation)Dunedin FormationDunlevy Formation (Bullhead Group) ObsoleteDunvegan FormationDuperow FormationDutch Creek Formation (Purcell Supergroup)Duvenay FormationDynneson SandstoneDyson Creek Member (Rundle Fomation)

(Obsolete)

EEager FormationEagle Formation (Montana Group)Earlie FormationEast Arm Dolomite (Interlake Group)Eastend FormationEatonia Evaporite (Wymark Member,Ebbutt Member (Willow Lake Formation)Echo Lake GravelEdmonton Formation (Group)Edson TillEisenhower Junction TillEldon Formation (Eldon Dolomite)Elk Formation (Kootenay Group)Elko FormationElk Point GroupElkton Member (Turner Valley Formation)Elkwater DriftEllerslie Member (Mannville Group)Ellis GroupElm Point Formation (Elk Point Group)Elrose Evaporite (Wymark Member, DuperowElstow Member (Duperow Formation,

Saskatchewan Group)Empress Group (Formation)Entice Dolomite (Waterways Formation,Entrance Conglomerate (Coalspur Beck)Ernestina Lake FormationErnst TillErratics Train TillEscarpment Member (Hay River Formation)Esterhazy Member (Prairie Evaporite, Elk Point

Group)Ethel Lake Formation (Informal)Etherington Formation (Rundle Group)Etzikom DriftEvie Member (Horn River Foundation)Expanse Formation (Informal name)Exshaw Formation

FFairholme GroupFair Point FormationFairview Formation (Obsolete)Falher Member (Spirit River Formation)Fantasque Formation

Farrell Member (Charlie Lake Formation,Schooler Creek Group)

Favel FormationFerdig Member (Marias River Shale)Fernie Formation (Group)Fiddle Formation (Obsolete)Field Member (Eldon Formation)Fife Lake Formation (Interlake Group)Finnegan FormationFirebag Member (Beaverhill Lake (Waterways)

Formation)Firemoon Member (Piper Formation)First Castor Sandstone (Bearpaw Formation)First Red Beds (Souris River Formation)First White Speckled ShaleFisher Branch Dolomite (Interlake Group)Fish Scale SandstoneFitzgerald FormationFlagstones (Obsolete)Flat Lake EvaporiteFlathead FormationFlaxville FormationFlood Member (Blackleaf Formation) Floral FormationFlossie Lake MemberFlotten Lake Sand (Colorado Group)Floweree Member (Marias River Shale)Flume Formation (Fairholme Group)Foothills Series (Obsolete)Foraging Formation (Obsolete)Foremost FormationForget-Nottingham LimestoneFort Augustus Formation (Mannville Group,

disused)Fort Garry Member (Red River Formation)Fort Mountain FormationFort Nelson Formation (Abandoned)Fort Simpson FormationFort Steele Formation (Purcell Supergroup)Fort St. John GroupFort Vermilion Formation (Member)Fortress Mountain Beds (Kananaskis

Formation)Fox Hills Formation (Abandoned in Canada)Frenchman FormationFrobisher Beds (Frobisher-Alida Beds)Frobisher-Alida BedsFrobisher Evaporite (Midale Beds)Furman Till (Informal name)

GGainsborough Evaporite (Alida Beds)Galton Series (Abandoned)Gammon Ferruginous Shale (Pierre Shale)Garbutt Formation (Fort St. John Group)Garden Plain TuffGataga FormationGates FormationGateway Formation (Purcell Supergroup)General Petroleum (G.P.) SandGeorge FormationGething Formation (Bullhead Group)Ghost River Formation (Abandoned)Gilwood Member (Watt Mountain Formation)Glacier Peak TephraGladstone Formation (Blairmore Group)Glauconitic Sandstone (Mannville Group)Glenogle FormationGlenwoodville Drift (Informal name)Goathaunt Member (Obsolete; Siyeh Formation)Gog Formation (Group)Golata FormationGoodlands Member (Turtle Mountain

Formation)Goodrich Formation (Fort St. John Group)Goodsir Formation (Abandoned)Gordon FormationGorman Creek Formation (Minnes Group)Graminia Formation (Winterburn Group)Grande Cache Member (Malcolm Creek

Formation)Grand Centre Formation (Informal)Grand Rapids Formation (Mannville Group)Granite Park Member (Siyeh Formation,

Obsolete)Granite WashGravelbourg FormationGrayling Formation (Obsolete)Green Beds (Fernie Formation)Greenhorn LimeGreenoch Formation (Redundant)Grey Beds (Fernie Formation)Grey Beds (Obsolete)Grinnell Formation (Purcell Belt Supergroup)Grit Bed (Blackstone Formation)Grizzly Bear Member (Lea Park Formation)Grosmont Formation (Woodbend Group)

Grotto Member (Southesk Formation)Groundbirch Member (Charlie Lake Formation,

Schooler Creek Group)Grumbler Group (Formation)Grunthal Formation (Informal name)Gryphaea Bed (Fernie Formation)Guernsey Formation (Interlake Group)Gunn MemberGunton Member (Stony Mountain Formation)Gypsum Spring Formation

HHaig Brook Formation (Purcell Supergroup)Halfway FormationHamill SeriesHamilton Lake SandHand Hills FormationHanington Formation (Obsolete)Hanson Beds (Interlake Group)Hanson Member (Wapiabi Formation, Alberta

Group)Hare Indian FormationHarmon MemberHarris Member (Souris River Formation,

Manitoba Group)Harrogate FormationHartaven Member (Stony Mountain Formation)Hart Pass Formation (Obsolete)Hasler FormationHastings Evaporite (Frobisher-Alida Beds)Hastings-Frobisher Beds (Obsolete)Hatfield Member (Souris River Formation,

Manitoba Group)Haven Member (Blackstone Formation)Hay Camp MemberHay River FormationHay River Limestone (Obsolete)Hazel Formation (Informal name)Hecla BedsHector Formation (Miette Group)Hefty Formation (Galton Series) (Abandoned)Hell Creek Formation (Montana Group)Hell Roaring MemberHenry Creek FormationHerald Formation (Bighorn Group)Hidden Creek HillHighwood Member (Fernie Formation)

Highwood Sandstone (Chungo Member)Hillcrest Member (Mist Mountain Formation)Hitka Formation (Abandoned)Holdfast (Flat Lake) EvaporateHollebeke Formation (Fairholme Group)Home Sand (Blairmore Group)Hondo Member (Grosmont Formation)Hoosier ClinobedHornbeck Member (Cardium Formation)Horn River FormationHorseshoe Canyon Formation (Edmonton

Group)Horsethief SandstoneHorsethief Creek Group (Windermere

Supergroup)Hota FormationHoward Creek MemberHowell Creek IntrusivesHubbard EvaporiteHulcross Formation (Fort St. John Group)Hummingbird Till

IIce Box Member (Winnipeg Formation)Ice River ComplexInga Member (Charlie Lake Formation)Interlake Group (Formation)Inwood Formation (Interlake Group)Inyan Kara GroupIreton Formation (Woodbend Group)Irvine Bed (Glacier Peak Tephra)Ishbel GroupIsland River Member (Invalid)Islay Member (Mannville Formation) (Disused)

JJackfish Creek TillJasper Formation (Series)Jasper Lake Member (Shunda Formation)

(Obsolete)Jean Marie (Utahn) MemberJefferson Formation (Obsolete)Johnston Canyon FormationJoli Fou Formation (Colorado Group)Jonas Creek Formation (Obsolete)

Jubilee FormationJudith River FormationJumping Pound Member (Jumping Pound,

Jungle Ridge)

KKakisa FormationKakwa Member (Cardium Formation)Kananaskis Formation (Spray Lakes Group) Karr Member (Cardium Formation)Kaskapau Formation (Smoky Group)Kechika GroupKeg River Formation (Upper Elk Point Group)Keld Member (Favel Formation)Kennedy DriftKevin Member (Marias River Shale)Kibbey Formation (Big Snowy Group)Killdeer Beds (Madison Formation)Kiln Formation (Obsolete)Kimball Drift (Informal name)Kinbasket LimestoneKindle FormationKintla Formation (Lewis Series, abandoned)Kipp Sandstone (Bearpaw Formation)Kisbey SandstoneKishenehn FormationKiska Member (Cardium Formation, Alberta

Group)Kishtinaw FormationKitchener Formation (Purcell Supergroup)Klua FormationKneehills Tuft (Edmonton Formation)Kobes Member (Charlie Lake Formation,

Schooner, Creek Group)Kootenai FormationKootenay GroupKotaneelee FormationKotcho Formation

LLabiche FormationLabuma TillLax du Bonnet Formation (Informal)La Glace Member (Charlie Lake Formation,

Schooler Creek Group)

Lake Agassiz ClaysLake Alma Member (Herald Formation)La Loche FormationLake Louise ShaleLamoral TillLander Sand (Kootenai Formation)Largs FormationLast Lake Member (Wabamun Formation)Laurier Limestone Beds (Keld Member)Lazenby FormationLea Park FormationLeduc Formation (Woodbend Group)Leinan TillLennard FormationLenzie SiltLeofnard Salt (Elk Point Group) (Disused)Lepine Formation (Fort St. John Group)Lethbridge DriftLethbridge Member (Oldman Formation)Lewis Series (Abandoned)Leyland Member (Cardium Formation, Alberta

Group)Liard Formation (Schooler Creek Group)Libau Drift (Informal)Lille Member (Fernie Formation)Lineham Member (Obsolete)Little Buffalo FormationLivingstone Formation (Rundle Group)Livock River FormationLama Member (Sulphur Mountain Formation)Lloydminster Formation (Superseded)Lloydminster (Lloyd) SandLobstick Member (Nisku Formation)Lochend Till (Informal)Locker Lake FormationLodgepole Formation (Madison Group)Lonely Bay FormationLooma Member (Grand Rapids Formation)

(Obsolete)Loomis MemberLoon River Shale (Fort St. John Group)

(Obsolete)Lotsberg Formation (Elk Point Group)Louise Falls Member (Hay River Formation)Lower PorousLowland GravelLudington Formation (Schooler Creek Group)Luscar Formation (Obsolete)Lyell Formation

Lyleton Formation [QuAppelle, (Three Forks)Group]

Lynx Formation and Group (Revised)

MMa Butte Formation (Blairmore Group)MacDonald Formation (Galton Series)

(Abandoned)MacGowan Concretionary BedMackenzie Dolomite Lentil (Vega Siltstone

Member)Madison GroupMafeking Member (Damson Bay Formation)Magrath Sandstone (Bearpaw Formation)Mahto Formation (Gog Group)Majeau Lake Member (Cooking Lake

Formation, Woodbend Group)Malcolm Creek FormationMaligne Formation (Fairholme Group)Manitoba GroupManitou Falls FormationManning Sand (Watt Mountain Formation)

(Obsolete)Mannville GroupManyberries Member (Bearpaw Formation)Manyberries Volcanic AshMarchand FormationMarco Calcarenite (Assiniboine Member)Marguerite Till (Informal)Marias River Shale (Colorado Group)Marie Creek Formation (Informal)Marlboro TillMarsh Creek TillMarshybank Member (Wapiabi Formation,

Alberta Group)Marston Member (Mount Head Formation)Martin Sandy ZoneMarysville SandsMasefield Shale (Formation)Matador Member (Bearpaw Formation)Mattson FormationMaunsell TillMaxim MemberMayberne TillMaycroft TillMazama Tephra (Galata Ash, Bighill Spring

Ash)

McDougall-Segur ConglomerateMcKay GroupMcLaren Member (Mannville Group)McLean River Formation (Elk Point Group)

(Superseded)McLeod Member (Kootenay Formation)

(Obsolete)McCloud Member (Cantuar Formation)McMurray Formation (Mannville Group)McNaughton Formation (Gog Group)Meadow Creek Formation (Miette Group)Meadow Lake Formation (Elk Point Group)Medicine Hat SandstoneMedicine Lodge Member (Bearpaw Formation)Meekwap Member (Nisku Formation,

Winterburn Group)Melita FormationMerrington ClinobedMessines Formation (Obsolete)Methy Formation (Upper Elk Point Subgroup)Mica MemberMidale BedsMidale Evaporite (Ratcliffe Beds)Midas Formation (Cariboo Group)Middle DenseMidnapore SiltsMiette (Formation) GroupMikkwa Member (Muskeg Formation)Mikkwa FormationMildred Member [Beaverhill Lake (Waterways)

Formation]Milk River FormationMill Creek Formation (Obsolete)Miller Peak FormationMillwood Member (Pierre Shale)Mink Member (Muskeg Formation)Minnedosa FormationMinnes GroupMinnewanka Group (Obsolete)Mirage Point FormationMisinchinka GroupMission Canyon Formation (Madison Group)Mistaya FormationMist Mountain Formation (Kootenay Group)Misty FormationMisty Till (Informal)Mitchell Bluff FormationMoberly Member (Beaverhill Lake Waterways)

Formations

Moberly Member/DolomiteMonach Formation (Minnes Group)Mons Formation (Obsolete)Montana GroupMonteith Formation (Minnes Group)Montney FormationMoosebar Formation (Fort St. John Group)Moosehorn Formation (Obsolete)Moosehound Member (Cardium Formation,

Alberta Group)Moose Lake Dolomite (Interlake Group)Moose Mountain Member (Morrissey

Formation)Morden ShaleMorley Till (Informal)Morrison FormationMorrissey Formation (Kootenay Group)Morro Member (Palliser Formation)Morse River Sand (Superseded)Mosby Sandstone (Greenhorn Formation,

Colorado Group)Moulton MemberMount April FormationMount Baker Unit (Purcell Supergroup)

(abandoned)Mount Forster FormationMount Greene Beds (Ishbel Group)Mount Hawk Formation (Fairholme Group)Mount Head formationMount Nelson Formation (Purcell Supergroup)Mount Rowe Member,Mount Selwyn FormationMount St. Helens Set Y TephraMount Synge Formation (Abandoned)Mount Whyte FormationMount Wilson FormationMountain Creek FormationMount Wright Formation (Schooner Creek

Group)Mountain Park FormationMowitch FormationMowry Shale Formation (Colorado Group)Mulga Tongue (Lea Park Formation)Mumm Limestone (Abandoned)Muncho-McConnell FormationMural Formation (Gog Group, Cariboo Group)Murchison Formation (Abandoned)Muriel Lake Formation (Informal)Muskeg Formation

Muskiki Member (Wapiabi Formation, AlbertaGroup, and

Muskwa FormationMusreau Member (Cardium Formation)Mutz Member (Mist Mountain Formation)Myrtle Creek Formation (Abandoned)

NNahanni FormationNaiset FormationNancy Member (Charlie Lake Formation,

Schooler Creek Group)Narao Member (Stephen Formation)Neely Member (Dawson Bay Formation,

Manitoba Group)Nevis Member (Edmonton Group) (Disused)Newcastle Formation (Colorado Group)Newcastle Sandstone Member (Ashville

Formation)Nicol Creek Formation (Purcell Supergroup)Nikanassin FormationNiobrara FormationNisku Formation (Winterburn Group)Nomad Member (Wapiabi Formation, Alberta

Group)Nonda (Ronning) FormationNordegg Member (Fernie Formation)Normandville Member (Wabamun Formation)Norquay Formation (Obsolete); North Pine Member (Charlie Lake Formation,

Schooler Creek Group)Nosehill Member (Cardium Formation)Notikewin Member (Spirit River Formation)Nunki Sandstone (Kaskapau Formation)Nyarling Formation

OObed TillOdanah Member (Pierre Shale)Ogygopsis Shale Lentil (Stephen Formation)Okla Sandstone (Big River Formation, Colorado

Group)Old Fort Point Formation (Middle Miette Group)Quaternary (Classical Wisconsin)Oldman Formation

Olympus Sandstone Lentil (Starlight EvaporiteMember)

Opabin Member (Blackstone Formation andKaskapau Formation)

Opal Member (Mount Head Formation)Ostracod Beds (Mannville Group)Ostrea Shale (Obsolete)OSullivan Member (Mannville Formation)

(Disused)Otherside FormationOtter Park Member (Horn River Formation)Ottertail FormationOungre Evaporite (Ratcliffe beds)Outlook Member, Bearpaw FormationOutram FormationOwen Creek FormationOxarart Member (Bearpaw Formation)Oxytoma Bed (Nordegg Member, Fernie

Formation)

PPaddy Member (Peace River Formation)Paget Formation (Obsolete)Paintearth Member (Bearpaw Formation)Pakan Formation (Abandoned)Pakowki DriftPakowki FormationPale Beds (Variegated and Pale Beds)

(Obsolete)Palliser FormationPaper Shale (Fernie Formation) (Superseded)Pardonet Formation (Schooler Creek Group)Paskapoo Formation (Saunders Group in

Foothills)Passage Beds (Fernie Formation)Patience Lake Member (Prairie Evaporite, Elk

Point Group)Peace Garden Member (Turtle Mountain

Formation)Peace Point Member (Waterways Formation)Peace River Formation (Fort St. John Group)Peechee Member (Southesk Formation)Pekisko Formation (Rundle Group)Pekisko Till (Informal)Pelican Formation (Colorado Group)Pembina Member (Pierre Shale)Pembina Mountain Group (Obsolete)

Pembina River Member (Cardium Formation)Penitentiary Member (Stony Mountain

Formation)Pense FormationPerdrix Formation (Fairholme Group)Peyto Formation (Member)Phillips Formation (Purcell Supergroup}Phillips SandstonePhroso Siltstone MemberPierre ShalePigeon Creek Member (Fernie Formation)Pika FormationPine Point Formation (Group)Pine River Formation (Abandoned)Piper FormationPipestone Formation (Obsolete)Pocaterra Creek Member (Blairmore Group)Point Wilkins MemberPoker Chip Shale (Fernie Formation)Poker Formation (Fernie Group)Poplar BedsPorcupine Hills FormationPorcupine Till (Informal)Portage Mountain Till (Informal)Potlatch Member (Three Forks Formation)Pouce Coupe MemberPrairie Evaporite (Prairie Formation, Elk Point

Group)Prelate Ferry PaleosolPresquile FormationProphet FormationProvost MemberPtarmigan Formation (Ptarmigan Limestone)

(Abandoned)Purcell Lava (Purcell Supergroup)Purcell (Belt) SupergroupPuskwaskau Formation (Smoky Group)

QQuAppelle AlluviumQuAppelle Group (Disused)Queensdale Lime (Frobisher-Alida Beds,

Informal)Quill Lakes Marker Beds (Prairie Evaporite, Elk

Point Group)

RRainbow Member (Keg River Formation)Ram Member (Cardium Formation, Alberta

Group)Ranger Canyon FormationRatcliffe BedsRatner Member (Winnipegosis Formation, Elk

Point Group)Raven Creek TillRaven River Member (Cardium Formation)Ratner Member (Winnipegosis Formation, Elk

Point Group)Raven Creek TillRaven River Member (Cardium Formation)Ravenscrag FormationUpper Ravenscrag (Ravenscrag Formation)Lower Ravenscrag (Frenchman Formation)Ray Member (Kibbey Formation)Red Gap Member (Grinnell Formation,

Obsolete)Red Deer Member (Fernie Formation}Red Jacket FormationRedknife Formation (Grumbler Group)Red River Formation (Bighorn Group)Red Speck Zone (Vaughn Member, Blackleaf

Formation)Redvers Unit (Herald Formation)Regina ClayRegway Member (Winnipegosis Formation, Elk

Point Group)Residual ZoneReston FormationRex Sand (Lower Grand Rapids Formation,

Mannville Group)Ribbon Creek Member (Fernie Formation)Ribbon Sand Member (Swift Formation, Ellis

Group)Ribstone Creek Member (Judith River

Formation)Ricinus Member (Cardium Formation)Riddell Member (Floral Formation)Riding Mountain FormationRierdon Formation (Ellis Group) Risser Beds (Interlake Group)Roaring River ClayRobson Limestones (Obsolete)Roche Miette Formation (Obsolete)

Rock Creek Member (Fernie Formation)Rocky Mountain Group/Formation (Redundant)Ronde Member (Southesk Formation)Roosville Formation (Purcell Supergroup)Rosa Formation (Informal)Roseau FormationRoseray FormationRosevear MemberRoss Creek Formation (Ishbel Group)Ross Lake Member (Ross Lake Shale,

Cathedral Formation)Roughlock Member (Winnipeg Formation)Rouleau ClayRoutledge Shale Facies (Lodgepole Formation)Rundle GroupRupert Beds (Interlake Group)Rush Lake Shale (Formation) (Vanguard Group)Ryegrass Sandstone (Bearpaw Formation)

SSabine FormationSaddle Hills ConglomerateSage Hen LimestoneSagemace MemberSalter Member (Mount Head Formation)Sandpile GroupSand River Formation (Informal)Sarbach Formation (Obsolete)Saskatchewan GravelsSaskatchewan GroupSaskatoon GroupSaskatoon MemberSassenach FormationSaunders GroupSawback Formation (Obsolete)Sawridge Formation (Obsolete)Sawtooth Formation (Ellis Group)Scallion Member (Lodgepole Formation)Scatter Formation (Fort St. John Group)Scenic Point MemberSchooler Creek GroupScollard FormationSecond Castor Sandstone (Bearpaw

Formation)Second Red Bed MemberSecond White Specks SandstoneSecond White Speckled Shale (Colorado

Group)

Selkirk Member (Red River Formation)Senkiw FormationSeptimus Member (Charlie Lake Formation,

Schooler Creek Group)Seward MemberShaftesbury Formation (Fort St. John Group)Shandro Member (Lea Park Formation)

(Abandoned)Sharky Member (Muskeg Formation)Shaunavon FormationSheep River Silts and ClaysShell FormationShell Lake Member (Prairie Evaporite, Elk Point

Group)Sheppard Formation (Purcell Supergroup)Sherbrooke Formation (Obsolete)Sherrard Member, Bearpaw FormationShunda Formation (Rundle Group)Sifton FormationSikanni Formation (Fort St. John Group)Simla FormationSinclair Formation (Obsolete)Siphon Member (Charlie Lake Formation,

Schooler Creek Group)Siyeh Formation (Purcell Supergroup)Siyeh Formation (Map Unit 5, Leech, 1960)Skoki FormationSkull Creek Shale Member (Ashville Formation)Slave Point FormationSmiley Clinobed (Viking Formation, Colorado

Group)Smoky (River) GroupSmoothstone River Formation (Elk Point Group,

Disused)Snakebite Member (Bearpaw Formation)Snake Indian FormationSnaring FormationSolomon Sandstone (Obsolete)Souris River Formation (Manitoba Group)Souris Sand and Gravel (Informal)Souris Valley Beds (Madison Group)Southesk Formation (Fairholme Group)Sparky Sand (Lower Grand Rapids Formation,

Mannville Group)Spearfish FormationSpence River FormationSpikes Zone (Big River Formation, Colorado

Group)Spinney Hill Member

Spirit River Formation (Fort St. John Group)Sprague Formation (Informal)Spray Lakes GroupSpray River GroupSpringburn Member (Beaverhill Lake Formation

and Group)Spy Hill Till (Informal)Starbird FormationStarlight Evaporite Member (Whitehorse

Formation)Steen River Formation (Obsolete}Stephen Formation (Stephen Shale)Stettler FormationSt. Edouard Member (Joli Fou Formation,

Colorado Group)St. Eloi Clinobed (Viking Formation, Colorado

Group)St. Eugene FormationSt. John Formation (Disused)St. Malo Formation (Informal)St. Martin Complex (Series)St. Mary River FormationSt. Piran FormationSt. Walburg SandstoneStimson Creek Till (Informal)Stockmans Sand (Blairmore Group)Stoddart GroupStone FormationStonewall FormationStony Mountain Formation (Bighorn Group)Storelk Formation (Spray Lakes Group)Storm Creek FormationStoughton Member (Stony Mountain Formation)Strathallen Beds (Madison Formation)Strathclair Formation (Interlake Group)Strathcona Sand and SiltStuartburn Formation (Informal)Sturrock Member (Cardium Formation, Alberta

Group)Success FormationSullivan FormationSullivan Quartzite (Invalid)Sully Formation (Fort St. John Group)Sulphur Mountain Formation (Spray River

Group)Sulphur Point FormationSunburst Sandstone Member Sunkay MemberSun River Member (Castle Reef Dolomite)

Sunset SandstoneSunwapta Peak FormationSurvey Peak FormationSutherland GroupSwan Hills Formation (Beaverhill Lake Group)Swan Hills GravelsSwan River FormationSweetgrass Hills DykesSwift Current Creek BedsSwift Formation (Ellis Group)Sylvan Lake Till

TTaber SandstoneTableland GravelTaft Hill Member (Blackleaf Formation)Takakkaw Tongue (Cathedral Formation)Tampico Member (Piper Formation)Tangent Dolomite (Superseded)Tanglefoot UnitTangle Ridge Formation (Abandoned)Tatei FormationTathlina Formation (Grumbler Group)Taylor Flat FormationTaylorton Member (Interlake Group)Tee Lakes FormationTegart FormationTelegraph Member (Muskeg Formation)Telegraph Creek Formation (Montana Group)

(Informal)Telford Formation (Ishbel Group)Territories FormationTershishner Member (Pika Formation)Tetcho FormationTetsa FormationThelma Member (Bearpaw Formation)Thistle Member (Wapiabi Formation, Alberta

Group)Thompson Dolomite (Obsolete)Three Forks GroupTilston BedsTimber Creek Till (Informal)Tipperary QuartziteTitkana FormationToad Formation (Obsolete)Tobermory FormationToby Formation (Winderemere Supergroup)

Todhunter Member (Etherington Formation)Tofield SandTolman Member (Edmonton Group) (Disused)Tolstoi Formation (Informal)Tombstone Mountain Formation (Purcell

Supergroup)Torquay Formation (Three Forks Group)Torrens MemberTovell Member (Mannville Formation) (Disused)Trinity Lakes Member (Cathedral Formation)Trout River FormationTsar Creek FormationTuchodi FormationTuma Lake FormationTunnel Mountain FormationTurner Valley Formation (Rundle Group)Turtle Mountain FormationTurtle Mountain Group (Obsolete)Tuskoola Sandstone (Kaskapau Formation,

Smoky Group)Tussock MemberTwin Cliffs FormationTwin Falls FormationTwo Medicine Formation (Montana Group)Two Rivers SandTyndall StoneTyrwhitt Formation (Spray Lakes Group)

UUnnamed Upper Colorado Shale (Colorado

Group)Upper Porous

VValhalla (Cutbank) SandVanalta Sand (Disused)Van Creek Formation (Purcell Supergroup)Vanesti Tongue (Lea Park Formation)Vanguard Formation (Group)Vaughn Member (Blackleaf Formation)Vega Siltstone MemberVerdigris Member (Foremost Formation)Vermillion Member (Bearpaw Formation)

(Invalid)Vermilion River FormationVictoria Member

Viking Chert (Viking Formation, ColoradoGroup)

Viking ConglomerateViking Formation (Colorado Group)Vimy MemberVirden Member (Lodgepole Formation)Virgelle Member (Eagle Formation, Montana

Group)Virginia Hills Formation (Informal)Vista Formation (Informal)Vonda Member (Prairie Evaporate, Elk Point

Group)

WWabamun Group (Formation)Wabasca Member (Muskeg Formation)Wabiskaw Member (Clearwater Formation)Wainwright Sandstone (Sparky FormationWalsh DriftWalton Creek MemberWapella Sand (Informal)Wapiabi Formation (Alberta Group)Wapiti FormationWapta Member (Stephen Formation)Waputik Member (Stephen Formation)Wartenbe Sandstone (Kaskapau Formation,

Smoky Group)Wascana Creek Ash (Pearlette Tephra)Waseca Sand (Grand Rapids Formation,

Mannville Group) (Informal)Wasada FormationWaskahigan Member (Cardium Formation)Waterfowl FormationWaterton Formation (Purcell Supergroup)Waterways FormationWatrous FormationWatt Mountain FormationWeary Ridge Member (Morrissey Formation)Weed Member (Mount Whyte Formation)Wellsch Valley TephraWesterdale Member (Ireton Formation,

Woodbend Group)Westgate Member (Ashville Formation)Whiskey Trail Member (Beaverfoot Formation)Whistler Member (Sulphur Mountain Formation)White Bear Marker Beds/MemberWhitehorse Formation (Spray River Group)

Whitelaw Member (Wabamun Formation)Whitemouth Lake FormationWhitemud FormationWhitemud Member (Edmonton Group)

(Disused)Whiteshell FormationWhite Speckled ShaleWhitewater Lake MemberWhitkow Member (Prairie Evaporite, Elk Point

Group)Whoop up Formation (Informal) Wigwam Formation (Galton Series)

(Abandoned)Wilder Member (Charlie Lake Formation,

Schooler Creek Group)Wildhorn MemberWildhorse DriftWileman Member (Mount Head Formation)Williams Member (Stony Mountain Formation)Willmar Evaporite (Frobisher-Alida Beds)

(Informal)Willmar Lime (Frobisher-Alida Beds) (Informal)Willow Creek FormationWilrich Member (Spirit River Formation)Windermere SupergroupWindsor Mountain FormationWinlaw Evaporite (Frobisher-Alida Beds)Winnifred Member (Whitehorse Formation)Winnipeg FormationWinnipegosis Formation (Elk Point Group)Winterburn GroupWintering Hills Gravels (Informal)Wokkpash FormationWolf Island SedimentsWolf Lake Member (Nisku Formation)Wolverine Member (Muskeg Formation)Wolverine Point FormationWonah Quartzite (Obsolete)Woodbend GroupWoodmore Formation (Informal)Wood Mountain BedsWorsley (Tangent) Dolomite (Charlie Lake

Formation)Wymark MemberWymark TillWynd Formation (Miette Group)

YYahatinda FormationYeoman Formation (Bighorn Group)Young Creek Member (Bearpaw Formation)

ZZ Marker (Woodbend Group)Zama MemberZelena FormationZeta Lake Member (Nisku Formation)

REFERENCES

Adanac Member (Mist Mountain Formation)Upper Jurassic

Author: Norris, D.K., 1959.

Type Locality: South face of Grassy Mountain, 8 km (5 mi) north of Blairmore, Alberta, along mainhaulage road between Grassy No. 2 and Grassy No. 4 coal pits (Norris, 1959; Hughes, 1978). NTSMap 82G/9 Blairmore.

History: Unit recognized and named by Norris 11959) as a member of the Kootenay Formation; nowincluded within the lower Mist Mountain Formation (Gibson 1979, 1985).

Lithology: Medium dark grey to black carbonaceous shale, medium grey, fine grained sandstone andcoal. At Grassy Mountain top of the member is characterized by No. 4 Grassy Mountain coal seam.

Thickness and Distribution: The Adanac is a locally recognized member of the Mist MountainFormation in the Crowsnest Pass area of the southwestern Alberta Foothills east of the Lewis Thrust,and in the area adjacent to and south of Blairmore and Coleman as far as the Adanac Strip Mine(Gibson 1977, 1985). The member ranges in measured thickness from a minimum of 20 m (66 ft) atGrassy Mountain to 31 m (102 ft) on York Creek south of Coleman.

Relationship to Other Units: The unit is conformably overlain by fine to medium grained sandstonewith interbeds of black silty mudstone and siltstone of the Hillcrest Member. At Grassy Mountain theupper contact is placed at top of No. 4 seam. The Adanac is conformably underlain by carbonaceous,micaceous, medium grey, fine grained quartz and chert sandstone of the Moose Mountain Member ofthe Morrissey Formation.

References: Gibson, 1977, 1979, 1985; Hughes, 1978; Norris, 1959.

DWG

Adolphus Formation Lower Upper Cambrian

Author: Burling, L.D., 1923, p. 741-743.

Type Locality: Mumm Peak (southeast spur), on Alberta-British Columbia boundary north of RobsonPass and 9 km 5.6 mi) due north of Mount Robson.

History: Burling replaced the Hota Formation of Walcott (1918) with the Adolphus because he thoughthat Walcott had mis-correlated the Hota of the type section with the Mural. Mountjoy (1962) and othersused the term Hota-Adolphus for Hota on the basis of historical priority.

Thickness and Distribution: 122 m (400 h) of limestone cliffs in Mumm Peak; thought by Burling to beMiddle Cambrian.

Relationship to Other Units: Conformably overlies the Mahto Formation and is overlain by the ChetangFormation along a distinct, sharp contact.

Paleontology: Scattered Lower Cambrian trilobites belonging to the upper part of the Bonnia-OlenellusZone; (although originally considered to be Middle Cambrian by Burling, 1923).

References: Burping, 1923, 1955; Mountjoy, 1962, 1980; Mountjoy and Fritz, 1975; Walcott, 1913,1928.

EWM

Aida Formation?Helikian

Author: Bell, R.T., first use 1966, first published 1968.

Type Locality: on the southeast flanks of Mount Aida, in the Tuchodi Lakes (94K) map area,northeastern British Columbia. Geographic co-ordinates of the type section:

base of section: 581130N, 1243815Wtop of section: 581130N, 1243945W

The type section is incomplete because of sub-Cambrian erosion; reference sections designated forthe poorly exposed base have the geographic co-ordinates 580745N, 1243230W, and for thecomplete top of the sequence 580445N, 1244245W.

Lithology: A thick succession of very light brown and light grey weathering, slaty-cleaved, calcareousand dolomitic mudstones with minor siltstones and fine grained, graded sandstones. Two hundredmetres (656 ft) above the base of the formation a green chamositic mudstone unit 60 m (197 ft) thickoverlain by 65 m (213 ft) of black, carbonaceous mudstone constitute a persistent marker unit. Much ofthe upper two thirds of the Aida is a sequence of well developed rhythmites with partial Boumasequences.

Thickness and Distribution: The formation is exposed in a belt from the confluence of the Toad andWest Toad Rivers in the Tuchodi Lakes (94K) map-area to Muskwa River in northern Ware (94F) map-area. Near the type section on Mount Aida the formation is 1000 m (3280 ft) thick; near Mount Churchillit is slightly more than 2000 m (6560 ft) thick

Relationship to Other Units: Conformably overlies the Tuchodi Formation and is conformably overlainby the Gataga Formation. Over much of its exposure area the formation has been partially truncated bysub-Cambrian erosion.

References: Aitken, 1975; Bell, 1966,1968; Taylor and Stott, 1973.

GCT

Aikins TillQuaternary

Author: Christiansen, E.A., 1959, p. 33.

Type Locality: North bluff of Swift Current Creek near Aikins, Saskatchewan, in Lsd. 1 of Sec. 24, Twp.15, Rge. 14W3M.

Lithology: A clay-loam till that is calcareous, montmorillonitic, plastic, and mostly unoxidized; palebrown where oxidized, otherwise light greyish brown; properties of the Aikins Till resemble those ofthe Wymark and Leinan Tills.

Thickness and Distribution: In the Swift Current area, where it is present north of the Wymark Till it is 4to 12 m (13 to 39 ft) thick (Christiansen, 1959). Found also in the Kindersley area (Christiansen, 1965).

Relationship to Other Units: Lies between the middle and lower stratified-drifts; north of theClearwater Lake Moraine it is covered by the Leinan Till; south of that moraine it is exposed or elsecovered by middle stratified drift; this is the till that directly overlies the Prelate Ferry Paleosol(Christiansen, 1965, p. 23) and so would appear to correlate with the Battleford Formation and theCondie Till. The unit is the second youngest till in the Swift Current area, and appears to be ofWisconsin age. The name has not been much used in recent years, but if this unit can be traced to theBattleford Formation and Condie Till, as appears probable, the name Aikins Till would appear to havepriority over both.

References: Christiansen, 1959, 1965; Greer and Christiansen, 1963.

AMacSS

Alberta GroupLower to Upper Cretaceous (Albian to Campanian)

Author: Hume, G.S., 1930, p. 6B.

Type Locality: The name was originally applied in the Highwood River area, and a composite sectioncan be viewed along the Highwood River (Twp. 15, Rge. 3W5M) (Stott, 1963).

History: Hume introduced the term Alberta shales for strata previously referred to as Benton. Webb andHertlein (1934) raised it to group status. Clow and Crockford (1951) used the term Alberta Formationin southeastern Alberta. The term Alberta Group is equivalent in part to the Colorado Group and to thelower Montana Group.

Lithology: Predominantly dark grey, silty mudstone. A prominent sandstone sequence (CardiumFormation) in the middle of the group lies between two thick shale successions, the underlyingBlackstone Formation and overlying Wapiabi Formation. Individual members of the shale formationsare characterized by silty mudstone with sideritic concretions or calcareous shales with thin beds ofargillaceous limestone.

Thickness and Distribution: The group is present along the southern and central foothills and adjacentplains from the International Boundary in the south to the Athabasca River in the north, whereequivalent beds are included in the Smoky Group. At the Highwood River the group is about 609.6 m(2000 ft) thick. In the Bighorn Basin, north of the North Saskatchewan River the thickness is in theorder of 1219.2 m (4000 ft).

Relationship to Other Units: The group lies with marked disconformity, and with some evidence oferosional unconformity on the Lower Cretaceous Blairmore and Luscar Groups throughout most of thefoothills, and on the volcanic Crowsnest Formation in southwestern Alberta. Stratigraphic equivalentsare the Colorado Group and Lea Park Formation in southern Alberta and the Smoky Group in northernAlberta and British Columbia.

Paleontology: Characterized by ammonites and pelecypods, ranging from at least the CenomanianDunveganoceras Zone to probably younger than the Santonian Desmoscaphites Zone (Stott, 1963). Asequence of eleven generalized microfaunal zones were recognized (Wall and Germundson, 1963).

References: Clow and Crockford, 1951; Hume, 1930; Stott, 1963; Wall and Germundson, 1963; Webband Hertlein, 1934.

DFS

Albertan FormationQuaternary (Pleistocene)

Authors: Dawson, G.M. and McConnell, R.G., 1895, p. 66.

Type Locality: Bow Valley near Calgary, Alberta (Dawson and McConnell, 1895, p. 59); not furtherspecified.

Lectostratotype Locality: Here designated as the Brocket Section on the left (northwest) bank ofOldman River about 7 km (4.4 mi) northeast of Brocket, Alberta, in S/2 of Sec. 34, Twp. 7, Rge. 28W4M(493610N, 1134230W), where it forms the deposits lying directly above bedrock (Stalker, 1963, p.30).

Lithology: Till, gravel and sand. The formation consists of 2 members, as suggested by Dawson (1895,p. 510): The Albertan Formation to comprise both the western boulder-clay and the derivedSaskatchewan gravels. A third, higher member may be present elsewhere, as at the Kipp Section(Stalker, 1972, p. 70-72). At the lectostratotype site the bottom member consists mainly of outwashsand and coarse, commonly angular or sub-round till gravel. It is overlain with gradational contact by amember consisting of indurated silty and sandy, very stony till that forms a steep cliff face with atendency towards columnar structure. The till coarsens eastward, where it shows more water working.At Brocket the till is light brown or buff, south of the Oldman Valley commonly pink or purplish. Thepossible upper member at Kipp consists of coarse, poorly sorted gravel overlying the till of the middlemember with gradational contact. The formation consists of material derived locally or from the RockyMountains and is characterized by a lack of stones from the Canadian Shield.

Thickness and Distribution: At the lectostratotype section the bottom member is 2 m (7 ft) thick, the tillmember 4.5 m (15 ft); at Kipp the till member is 2 m (7 ft), the overlying gravel 3 m (10 ft) or more thick.Much greater thicknesses undoubtedly occur in some of the prairie preglacial valleys. Widelydistributed in south and central Alberta, particularly near the mountain front, and into westernSaskatchewan, but in many places destroyed by subsequent glaciation and river action. The tillmember disappears east of Kipp.

Relationship to Other Units: Overlies bedrock or, with gradational contact earlier river gravels that aredifficult to separate from it (see Saskatchewan Gravels). Overlain eastward with sharp contact by theLabuma Till or the Twin Cliffs Formation, from which it is readily distinguished by its lack of Shieldstones and light color. In the western foothills and mountains overlain by younger tills, valley train andalluvium. The unit is the earliest glacial deposit recognized in southwestern Alberta, but probablyrepresents the same glaciation that later laid down the Labuma Till and Twin Cliffs Formation. Dawson(1895, p. 510) suggested that: The western boulder-clay must represent an epoch of glaciationantecedent to the Kansan., but it is now generally assigned to the Illinoian age (Stalker and Harrison,1977, p. 885). It may represent a glaciation between and separate from the Kansan and Illinoianglaciations as generally recognized. Probably contemporaneous with part of the SaskatchewanGravels, and eastward apparently grades into these. May include the Kennedy Drift and Baseline Till,if so the name Albertan Formation has priority. This formation apparently represents the largestQuaternary Cordilleran glaciation in the Rocky Mountains and Foothills, and it should correspond tothe Great Cordilleran (Waterton 1) Advance of Stalker and Harrison (1977). It undoubtedly laid downthe highest Cordilleran drift found in the Foothills, and also that extending farthest east onto the Plains.

References: Dawson, 1895; Dawson and McConnell, 1895; Horberg, 1952, 1954; Stalker, 1963, 1972;Stalker and Harrison, 1977.

AMacSS

Albertella Zone (Obsolete)Middle Cambrian

Author: van Hees, H., 1959.

Type Locality: Unspecified, but by implication the California Standard Parkland 4-12-15-27W4M well,in southern Alberta.

History: The Albertella Zone was recognized only by van Hees (1959, 1964), who viewed it as adivision of the Cathedral Formation (in more recent work, it would be part or all of the Mount WhyteFormation). In three successive publications on the Cambrian of Alberta Pugh (1971, 1973, 1975)made no mention of it.

Lithology: Fine grained marine siliciclastics, characterized by high radioactivity.

Thickness and Distribution: Thickness about 30 m (98 ft). From the westernmost wells in theundeformed basin, extending eastward and passing into basal Cambrian sandstone west of theAlberta-Saskatchewan boundary; and northward, passing into sandstone by about Twp. 38.

Relationship to Other Units: van Hees (1959, 1964) apparently viewed the Albertella zone as afaunizone, but extended it by Ra-log correlation from the fossiliferous interval of the Parkland well. Onthe data of van Hees and later workers however, the unit appears instead to be a diachronous,unusually radioactive muddy facies separating nearshore sandstones from offshore limestones of theCathedral Formation. The term has not been used in formal publication since 1964.

Paleontology: The unit yielded the Middle Cambrian trilobite Albertella sp. at the Parkland 4-12 well,but is probably younger than that, though still Middle Cambrian eastward and northward.

References: Pugh, 1971, 1973, 1975; van Hees, 1959, 1964.

JDA

Alder Member (Charlie Lake Formation,Upper Triassic

Schooler Creek Group) (Superseded)Author: Torrie, J.E., 1973, p. 170.

Reference Section: Pacific Fort St. John 2-18-84-19W6M, in northeastern British Columbia, between1344.5 and 1346 m (4411 and 4416 ft): grey anhydrite equivalent (Siphon Member).

History: This name has been used in the Currant, Crush and Bulrush areas of British Columbia for theSiphon Member of the Charlie Lake Formation (Hess, 1968). Union Oil used Alder for the CecilMember of the Charlie Lake Formation.

Lithology: Sandstone.

Thickness: 1 to 2 m (3 to 7 ft) thick.

References: Hess, 1968; Torrie, 1973.

JWR, KAM

Alderson Member (Lea Park Formation)Upper Cretaceous (Campanian)

Authors: Meijer Drees, N.C. and Myhr, D.W., 1981; p. 42-74.

Type Locality: Meijer Drees and Myhr (1981) stated that the type section lies between 253.5 and 338.3m (832 and 1110 ft) in the ARCO Alderson 10-4-15-10W4M well in southeastern Alberta.

Lithology: The member consists of grey to dark grey bioturbated, silty, montmorillonitic shale withlaminated lenses and interbeds of very fine grained, silty sandstone. Scattered greyish greenbentonitic shale beds, chert pebble beds and beds containing siderite nodules are present. The sandcontent increases from the base upward.

Thickness and Distribution: The thickness of the Alderson Member in southeastern Alberta is fairlyconstant, ranging from 85 to 91 m (279 to 299 ft). The member thins northward to about 70 m (230 ft) atTwp. 50. The southwestern limit of the member is defined by the appearance of the Virgelle Member(Meijer Drees and Myhr 1981) of the Milk River Sandstone. The northeastern limit of the AldersonMember is defined by the last occurrence of the thin pebble bed at the top which grades basinward(northeast) into a laminated shale facies.

Relationship to Other Units: The top of the member is conformable, being marked by a chert pebblebed, however there is no significant change in mechanical log character between the overlying upperLea Park and the Alderson. The basal contact is Conformable and transitional on mechanical logs, butlithologically can be picked by the appearance of the first or upper White Speckled Shale. To thesouthwest the Alderson is equivalent to the Deadhorse Coulee, Virgelle and Telegraph Creekmembers of the Milk River Formation. In Montana this succession equates to the upper, middle andVirgelle members of the Eagle Formation as well as the Telegraph Creek Formation. In central andsouthern Saskatchewan the Alderson is equated with the lower portion of the Lea Park, and inManitoba with the Pembina Member of the Pierre Shale (formerly Vermillion River Formation). In thecentral Alberta Foothills the Chungo and Hanson Members of the Wapiabi are of equivalent age.

References: Meijer Drees and Myhr, 1981.

RLM

Aldridge Formation (Purcell Supergroup)Middle Proterozoic

Author: Schofield, S.J., 1914a, p. 221.

Type Locality: Near Kingsgate, southeastern British Columbia.

History: Daly (1912) assigned strata near Kingsgate to his Kitchener Formation, which he defined asoverlying his Creston Formation, but Schofield (1912) showed that they were older not younger thanthe Creston Formation and proposed that they be called the Aldridge Formation (Schofield, 1914a, p.221).

Lithology: The Aldridge consists of rusty weathering, grew fine grained quartzite and argillaceousquartzite, grey siltite and dark grey argillite are the dominant and characteristic rock types. In thePurcell Mountains the lower part consists of rusty weathering, laminated, thinly bedded, light colored,very fine grained quartzite, argillaceous quartzite and siltite, with minor black argillite partings. Cross-bedding is common, and scour and fill structures occur but are rare (Reesor, 1958). These grade intothe middle part, which is a sequence characterized by light weathering, thin to thick bedded, lightcolored, fine grained quartzite and argillaceous quartzite interbedded with laminated, rustyweathering, grey siltite and black argillite. Intraformational debris-flow conglomerates and large scaleconvolutions of bedding occur locally. Quartzite beds commonly grade to dark grey siltite in the top fewcentimetres and many have flute or load casts at their base. Ripple-drift cross lamination occurslocally. These quartzites are interpreted to be turbidite deposits (Bishop et al., 1970, Edmunds, 1973).In the Hughes Range north of Fort Steele the middle part of the Aldridge Formation consists oflaminated and cross laminated siltite; laminated dark grey argillite, and minor quartzite (Hoy 1978); butin the Lizard Range very rusty weathering, laminated siltite, massive siltite and rare quartzite(McMechan, 1979) occur beneath the light weathering quartzite unit. In all of these areas the upperpart of the formation consists of rusty weathering, laminated siltite and dark argillite. Mud-cracked,interlaminated dolomite and green siltite occur near the top of the formation in the Lizard Range.Hornblende metagabbro sills and dykes are abundant in the lower parts of the formation.

Thickness and Distribution: Extends from north of Kimberley, British Columbia to south of Missoula,Montana. Because the base of the formation is only exposed very locally the thickness is generallyunknown. In Canada the known thickness ranges from 2100 m (6890 ft) for the entire formation in theHughes Range, to 4000 to 5000 m (13120 to 16400 ft) with the base not exposed in the PurcellMountains. The Aldridge Formation is the host for the Sullivan stratiform Ag-Pb-Zn deposit atKimberley.

Relationship to Other Units: The Aldridge conformably overlies the Fort Steele Formation in theHughes Range, but elsewhere the base is not exposed. It is conformably overlain by the CroutonFormation or the Ravalli Group (in the United States). The Prichard Formation is its United Statesequivalent. The Aldridge Formation has been correlated with the Altyn and Waterton Formations of theClark Range (Price, 1964).

References: Bishop et al., 1970; Daly, 1905, 1912; Edmunds, 1973; Huebschman, 1973; Hoy, 1978,Leech, 1958; McMechan, 1978, 1979; Price, 1964a; Reesor, 1958, 1973; Rice, 1937, 1941; Schofield,1912, 1914a, 1914b, 1915.

RAP

Alexander Sandstone (Ellerslie Formation, Mannville Group)Lower Cretaceous (Albian)

Author: First used by wellsite geologists for a sand at the top of the Ellerslie Member in the immediatearea of Alexander Indian Reserve No. 134. It was later described by Jackson and Bourns (1968).

Type Locality: Mid-Western Calahoo 6-1-55-27W4M, in Alberta, between 1155.5 and 1158.5 m (3790and 3800 ft).

Lithology: Mainly fine to medium grained quark sandstone, containing numerous fossil fragments, afew coal inclusions, with fair to good porosity.

Thickness and Distribution: Restricted to the immediate Alexander Indian Reserve No. 134 areacentred in Twp. 56, Rge. 27W4M. The thickness varies from zero to 8.5 m (28 ft).

Relationship to Other Units: The Alexander Sandstone is a sandstone unit occurring within theuppermost Ellerslie Formation and the lower part of the Ostracode Zone. It is overlain by Ostracodeshale. It is separated from the underlying Calahoo Sandstone, another sandstone unit within theEllerslie Formation, by a 2 m (7 ft) thick shale unit.

References: Jackson and Bourns, 1968.

GEB; KEJ

Alexandra Member (Formation) (Twin Falls Formation)Upper Devonian (Frasnian)

Author: Crickmay, C. H., 1953.

Type Locality: Alexandra Falls, on the Hay River, District of Mackenzie, at 6030N, 11616W. Thebase of the member is 2 m (7 ft) above the base of the falls.

History: First used without definition by Crickmay (1952); re-defined by Crickmay (1957). Statusrevised to Alexandra Member by Belyea and McLaren (1962), who excluded the upper 11 m (36 ft) ofCrickmays definition from the member.

Lithology: Principally limestone, with minor interbeds of shale, sandstone and siltstone. Biostromal.

Thickness and Distribution: The Alexandra Member is 30.8 m (101 ft) thick at the type section and 21.3m (70 ft) at Briggs Tathlina Lake No. 3 borehole (604929.49N, 1173909.56W). It is present in theHay River-Tathlina Lake area.

Relationship to Other Units: The Alexandra Member is the lowest member of the Twin Falls Formationand conformably overlies the Hay River Formations. It is overlain by an unnamed upper member of theTwin Falls Formation. On Hay River it corresponds approximately to map unit 17 (Douglas, 1959) andto Douglass map units 17 and 18 and the upper part of 15 on Kakisa River. West of Tathlina Lake itgrades into the Fort Simpson Formation.

References: Belyea and McLaren, 1962; Crickmay, 1952, 1953, 1957; Douglas, 1959.

LVH; PAM

Alexo Formation (Partly superseded)Late Devonian (Famennian)

Authors: deWit, R. and McLaren, D.J., 1950.

Type Locality: North Saskatchewan River Gap, north side, where the river cuts through the BrazeauRange. Located 15 km (9 mi) southeast of Nordegg, Alberta. Lat. 5226N, Long. 11554W.

History: The formation, named after the village of Alexo, Alberta was erected by deWit and McLaren(1950) to include all the silty carbonate beds between the top of the Southesk and Mount HawkFormations and the base of the Palliser Formation. A minor thickness revision was made by McLaren(1955), who also divided the formation informally into upper and lower members. Furtherpaleontologic (McLaren, 1959) and stratigraphic studies in the Jasper region led McLaren andMountjoy (1962) to revise the formation nomenclature for that area. They designated the lower Alexoas the Ronde Member of the Southesk Formation and the upper Alexo as the Sassenach Formation.The term Alexo Formation is therefore no longer applied in the mountains north of the type section, butis used to the south where the stratigraphy of this interval has not been fully elucidated and is possiblydue for revision.

Lithology: The Alexo Formation is informally divided into two members (McLaren 1955). The lowermember consists of interbedded dolomite and silty and argillaceous dolomites, grading up throughlaminated siltstones and silty dolomites to thick bedded, vuggy grey dolomite. The basal part of thismember weathers thin bedded and somewhat recessive. The upper member is composed oflaminated, thin to medium bedded grey and green-grey argillaceous siltstones and silty dolomites.Small penecontemporaneous slump structures are often present in this interval.

Thickness and Distribution: The Alexo Formation is essentially a basinal unit which onlaps and thinlycovers the Fairholme Group carbonate buildups in the Rocky Mountains. It is fully developed only farfrom such buildups, where it may reach thicknesses of 100 m (328 ft), i.e. south of the Nort