15
VolumeOne.org Jan. 20, 2011 29 VOLUME ONE’S GUIDE TO SEEING YOUR NEW YEAR’S RESOLUTION THROUGH EDITORS: Kinzy Janssen & Trevor Kupfer /// WRITERS: Cheri Dostal & Kristin Frosch /// PHOTOGRAPHY: Andrea Paulseth, Leah Dunbar, Zack Gauck, & Trevor Kupfer /// DESIGN: Brian Moen Even if you haven’t announced it publicly, you know you made an informal New Year’s resolu- tion to yourself. And, odds are, it had to do with being healthier. Well if you’re like us (except for the fact that every year we tell everyone about our resolutions), after a few months, weeks, or even days you’ve already given up. Well enough is enough. This year is different because you’ve got this guide to help you see it through. We’ve done all the work you could possibly need in terms of nutritional tips, lifestyle changes, and fitness amenities. So put down the burger and roll off the couch, because there are no more excuses. Let’s do this thing! BROUGHT TO YOU IN PART BY Hahn’s Market in Eau Claire

Health & Fitness 2011 (1-20-11)

Embed Size (px)

DESCRIPTION

A Volume One guide to being heatlhy and fit!

Citation preview

VolumeOne.org Jan. 20, 2011 29

VOLUME ONE’S GUIDE TO SEEING YOUR NEW YEAR’S RESOLUTION THROUGH

EDITORS: Kinzy Janssen & Trevor Kupfer /// WRITERS: Cheri Dostal & Kristin Frosch /// PHOTOGRAPHY: Andrea Paulseth, Leah Dunbar, Zack Gauck, & Trevor Kupfer /// DESIGN: Brian Moen

Even if you haven’t announced it publicly, you know you made an informal New Year’s resolu-

tion to yourself. And, odds are, it had to do with being healthier. Well if you’re like us (except for

the fact that every year we tell everyone about our resolutions), after a few months, weeks, or even days

you’ve already given up. Well enough is enough. This year is different because you’ve got this guide to help you see it

through. We’ve done all the work you could possibly need in terms of nutritional tips, lifestyle changes, and fitness

amenities. So put down the burger and roll off the couch, because there are no more excuses. Let’s do this thing!

BROUGHT TO YOU IN PART BY

Hahn’s Marketin Eau Claire

VolumeOne.org Jan. 20, 2011 30

For The RecordIF YOU’RE LOOKING TO GO HEALTHIER, FOOD JOURNALING HOLDS YOU TO ITBY CHERI DOSTAL

I don’t believe in diets. What weeatinthecourseofadaymatters.And,besides,therootwordof“diet”isGreekfor “manner of living.” An ideal dietisn’tashort-termprogramthatwehateand can’twait to break all of its rules.Real health and fit-ness doesn’t comein quick-fix neatpackageswithhugepromises attached(sorry). Healthcomes from con-scious living, fromeatingwellandbal-anced (I conscious-ly choose to eatchocolate to bal-anceoutallgreens,eggs, and yams).Quite simply, howweeatreflectshowwelive. Research andmyownprofession-alexperienceprovethatpeoplewhopayattention towhat andhow they eat getbetter health results than those whodon’t. Food journaling is one of thesimplestways topayattention, and it’salso proven effective by research. TheNational Weight Control Registry pub-lishes researchaboutpeoplewhohavebeensuccessful losing andmaintainingtheirnewweight.Theyfoundthat,ofallparticipantsintheirstudy,98percentofthemmodifiedtheirfoodintakeand94percentincreasedphysicalactivity. How do you know what to changeinyourdietunlessyouclearlyseewhat

you’vebeenupto?Youjustmightcrackthecodeonhowyoueat,andhowtoeatwith food journaling. No more secretsand sneaky eating allowed – be hon-est and put it all on the page. If youprefer adigital app for that, checkout

online solutions fortracking your foodchoices. Everybodyisdifferent, but weareallhuman.Weall need enoughcalories but nottoo many, loadsof different nutri-ents, clean waterto drink, and anawareness of whyweeatthewaywedo. I suggest youfind a notebookyou can desig-nate as your foodjournal.Eachday,record what youeatandanapproxi-

mateamountorservingsize,aswellasthetimeofdaythatyouconsumedthosecalories.Nomatterhowyoulike toeat(see our accompanying article aboutraw, vegetarian, and vegan lifestyles)you can learn about yourself and yourbehavior patterns with a good writtenrecord. Once you’ve written in yourjournalforaweek(includingworkdaysandweekenddays),patyourselfon theback and prepare to put that informa-tion to work. Here are top suggestionsforchangingsneakypatternsthatmakeabigimpact.

No matter how you like to eat, you can learn

about yourself and your behavior

patterns with a good written

record

BROUGHT TOYOU IN PART BY

VolumeOne.org Jan. 20, 2011 31

KEEP IT POSITIVE!Ifyouhaveagreatday,giveyourselfagoldstarandcallafriend.Ifyouhaveabadday,figureoutwhyandstillcallafriendtohelpyouprob-lemsolveandplanahead.Onedaywon’tundoweeksofhardwork.Yourjournalisatooltoincreaseawarenessandholdyouaccountableforreachingyourgoals,souseitfrequentlyandwisely.

PORTIONS:Eatenough,butnotuntilyou’restuffed.Watchingportionsizesisagreatwaytoreduceoveralleatingtoahealthylevelwhileenjoyingsomeofyourfavoritessomeofthetime.Payattentiontowhetheryouactuallyfeelhungryandhowyoufeelafteryoueat.

PROTEIN:Eatingeggs,beans,rice,legumes,fish,nutsandotherproteinsourceshelpkeepyoufullandsatis-fied.Theyalsogiveyourbodytheaminoacidsandnutrientsnecessaryforbuildingmuscle,whichinturnboostsmetabolism.It’sawin-win,sodigintoproteinthroughouttheday.

PARCHED?Drinkingyourcaloriescansabotageresults.Itcouldbecocktails,dailycappuccinoswithwhip,soda,orjuice.Choosewaterorhotteamoreoftenandsaveyourselftheextracouplehundredcalories.

PLANTS:Noticethepresence(orabsence)ofplantsinyourdiet.Whenyoulookatyourfoodjournalmakeanoteofeveryplantyoueatwhetherit’ssquash,bananas,greenbeans,greenpeppers,ornavelorangesyou’renosh-ing.Plantshavenutrients,fibertokeepyoufull,andrelativelyfewcalo-ries.Themoreplantsthebetter;someprofessionalsrecommendconsuming30-60percentofyourcaloriesfromveg-etablesalone.

It’stimetogetseriousaboutalloursolidnew-yearintentions.Knowthattheroadaheadispavedwithmoreenergy,great-er health, and intelligent food choices

tofuelyourworkoutsandyourworkday.Enjoynewawarenessandwisdomfromfoodjournaling,andeatwell.

BROUGHT TOYOU IN PART BY

VolumeOne.org Jan. 20, 2011 32

TOTAL VEGETARIANS:Thedietconsistsentirelyoffoodfromplantsources.

LACTO-VEGETARIANS:Whilethisdietisstillbasedintheconsumptionofplantproducts,dairyproductsarealsoallowed.

LACTO-OVO VEGETARIANS:Thistypeofvegetariandietallowsbothdairyandeggproductsinadditiontotheprimaryplantfood.

POLLO-VEGETARIANS:Withthistypeofdiet,poultryproductsareallowed.Onlybeefproductsareeliminated.

PESCO-VEGETARIANS:Theonlytypeofmeatallowedhereisseafood.

SEMI-VEGETARIAN/FLEXITARIAN:Whilethisdietconsistsofmostlyplantsources,meat,eggs,anddairyproductsareallowedonoccasion.

Whileyoumaythinkavegetariandietisself-explanatory,therearemanyvarietiestochoosefrom,eachwiththeirownsetofrules.

VEGETARIANISM

VEGANISM

RAW FOODS

The raw foods diet is becomingincreasinglymore common among life-style diets. All meals consist of safe,uncooked food such as fruits, vegeta-bles,nuts,andgrains.Thediet itself isfairly self-explanatory and has manyhealthbenefits. “In short, the idea behind veganrawfoodsisthefoodisnotheatedabove

105degrees, leaving theenzymesalive,which results in your body being abletoabsorballthenutrients,”saidAshleyScoreofRawDeal,arawfoodsrestau-rant in Menomonie. “The more veganraw foods in your diet, the better, butyou certainly do not have to be exclu-sively raw to benefit your health andenergy.Afterall,youarewhatyoueat!”

Veganism is by far the strictest ofthe lifestyle diets. A vegan diet con-sistsentirelyoffoodfromplantsources.Animal products, including those fromdairy,eggs,orhoneyarenotallowed. Vegetarian and Vegan diets haveproventoprovidemanypositivehealthbenefitssuchasdecreasedriskofheartdisease,obesity,anddiabetes.However,vegetariansandvegansneedtofollowastrict dietary code to ensure adequatenutrition. Neglecting to obtain certainnutrientsfromplantsourcescanleadtolong-termhealthproblems.Thebenefitscanfaroutweighthecostsif,ofcourse,youtakethedietseriously. AnEauClairenativeandvegetarian,who wishes to remain anonymous, hasexperienced positive health outcomes

fromthedietaryshift,asadiabetic. “SinceIdecidedtoquiteatingmeatandadoptaplant-baseddiet,Ihavehadnoticeablybettercontrolovermyblood-sugarlevels.SwitchingtovegetarianismisprobablythebestthingI’veeverdone.”Eau Clairian Susan Feather also seesvegetarianisminapositivelight. “With all the health benefits,switchingtoavegetariandietjustmadesense,” said Feather. “I’m very happywithmydecision.” Vegetarian and vegan diets arebecoming increasingly more prevalent.Morerestaurantsarebeginningtooffervegetarian friendly dishes, and morepeoplearebeginningtoacceptthedeci-siontoswitch.

“Lifestyle” DietsWHAT SOME PEOPLE DO TO CHANGE THEIR RELATIONSHIP WITH FOODBY KRISTIN FROSCH

BROUGHT TOYOU IN PART BY

Whetheryouarethinkingofchangingyourdietforhealthorethicalreasons,oryousimplywanttotrysomethingnewfor2011,alifestylechangeisafullcommitment.Doyourresearchfirst!

Ifyouhaveeverbeenonadiet,youknowthattheeffectssimplydon’tlastonceyouresumeyournormaleatinghabits. Inorder toreceive lastingbenefits,youreallyneedtochangeyourentirelifestyleandrelationshipwithfood.So,tohelpyouout,wehavecompiledalistofthesedifferent“lifestylediets”tohelpyouthinkaboutthekindsofextremessomepeopletake.

RAW DEAL

In addition to serving up 35 flavors ofsmoothies, Eau Claire Fusion really getsinvested in your personal health goals. Atwhatotherrestaurant–orsmoothiebar, forthatmatter–canyougetafreebodyscan,orearnmoney froma pot as a result of shed-dingpounds? Co-ownerNicoleNemecexplains the basic three-part system that shehas personally ben-efited from: she lost80 pounds afterfollowing theprogram, and hasmaintainedforhernew shape for morethanayear.First,youtakeashotofmango-flavored aloe, servedinacutewhitemini-mug. It looks likewater, but it’s justa tad thicker, andgoesdowncoolandsmooth.Asadiges-tiveagent, itprepsyour stomach forthemeal that willfollow. Aloe hasalso been hailedasanalleviantforheartburn, acidreflux, irritablebowel syndrome,and even Crohn’sdisease. Then yousip flavorful greentea (I had peach),which purportedlyboosts metabo-lism and generatesenergy. Your mealitself comes in theform of a thicksmoothie.IhadtheOatmeal Cookie,which has ground-upraisinsinit,butthereareflavorsasvaried as TropicalFruit Splash andReese’s PeanutButter. Packed with 24 grams of pro-tein, each smoothie has been certifiedasamealreplacementbytheFDA,andtheyhaveallthevitaminsandmineralsourbodiesneedinoneday,accordingtoNemec.Shestressestheimportanceofproteinintakeinmusclebuilding–andnot just forbodybuilders.Anyonewhoworks out needs to get enoughproteinin order to replace unwanted fat withleanmuscle. “Werecommendashakeforbreak-fast,aproteinsnack,ashakeforlunch,aproteinsnack,andasensibledinner.Andmenmighthaveanothersnackafterthat, since they needmore protein. So

you’reeatingfivetimesaday,”shesaid. Many of Nemec’scustomers wander infrom their downtowndesk jobs, looking foran energy boost. “They

go back to work andtheir co-workersare like, ‘Howdotheyhavesomuchenergy?Where didyou justeat?’ ” saidNemec.O t h e rsmoothie

proponentsaremaking thempart of theirdaily diet, andattending nutri-tion club meetingsto ensure account-ability. The meet-ingsspannineweeks,are held right atFusion, and cost $35,which gets collectedinto a pot. At weeklyweigh-ins (Mondays orWednesdays), you must

pay $1 per poundyou gain.Youareallowed to missone meeting, butmust fork over $5per meeting youmiss after that.The pot, whichwill have grownsince the firstmeeting,willthenbe split betweentwo winners: theperson who losesthe highest per-centage of bodyweight, and theperson who losesthemostinches.

Shape scans are also available atFusion.Nemechas amachineon loanfromUCLAthatmeasuresalltheimpor-tant aspects of your shape, includingthe percentage of your body fat, totalpoundsofbodyfat,andleanbodymass.UnlikeaBMIscale,it’snotjustanequa-tion. And the printout tells you howmuchproteinyouneedaday,andwhatyourcaloricintakeshouldbeformain-tenanceorweightloss. So whether you’re looking tolose weight, gain energy, or just tastesome of these eclectic flavors, you’llfind Fusion’s place in the Eau Clairesmoothiesceneisanpowerfulone.

VolumeOne.org Jan. 20, 2011 33

BROUGHT TOYOU IN PART BY

Drink and ShrinkTHE INTERESTING MEAL SYSTEM OF EAU CLAIRE FUSION BY KINZY JANSSEN

“(Customers) go back to work and their co-

workers are like, ‘How do they have so much

energy? Where did you just eat?’ ”

–Eau Claire Fusion co-owner Nicole Nemec

VolumeOne.org Jan. 20, 2011 34

Raiseyourhand if youdrinksoda.OK,putyourhandsdownandconsideranalternative–analternativethatmayinspire you to raise your pinky in finefashion–andthatcangiveyouthecaf-feineyoumaydesirealongwithloadsofotherhealthbenefits.Thinktea. It’s thenewyear, andmostpeoplehavestartedthinkingabouttheirhealth(and hopefully haven’t stopped quiteyet). One of the most drastic changesyou canmake for you health is to stopdrinkingpop.Eachcanof soda (classicCoke, as an example here) can haveabout39gramsofsugarormore.Drinktwocansperdaysixdaysperweekandthat’senoughsugarcaloriestomakeyougain27.6poundsoverthecourseof theyear.Whoa.Stop thepopandswitch totea.Here’swhy–inmorescientificandspecificterms. Matéteamaybeawell-keptsecretaroundtheMidwest,butitspopularityisgrowing. This sustainable, shade-grownherb from theAmazon is known for itsstimulating, energizing benefits. Withmore caffeine than coffee, some mightsuspectitwouldhavethemdancingajighalf-nakedaroundtheofficeinnotime.Although we can’t promise you won’tdoalittleditty, this teausuallydoesn’tincitethesamejittersandcrashesasso-ciated with caffeine (and certainly notthe same rock bottom feeling from 40grams of sugar). Maté tea contains 11polyphenols (powerful antioxidants) inamounts nine times greater than greentea,anddoublewhat theacai fruit canclaim.Maté teaalsogivesyouvitaminsA, C, E, B1, B2, Niacin (B3), B5, andmineralslikecalcium,manganese,iron,selenium, potassium, magnesium, andphosphorous. During cold and flu sea-son,begladthatthisgrassyteaalsohassaponines which help stimulate yourimmune system – all without the sup-pressingsymptomsofasugarhigh. Sothenexttimeyouthinkofgrab-

bingalimegreen,corn-syrupybeverage,reachforthisnaturalenergizingbever-age.Itmaynotbemagic,butitmayjusthelpyouimproveyourhealth.

Healthy To a TeaTHE BENEFITS OF DIFFERENT TEA FAMILIES

BLACK TEA:(100%oxidation/60-90mgcaffeinepercup)Thisclassicteaaccountsforthemajorityofwesternteasales,andincludescommonblendslikeEnglishBreakfast,EarlGrey,andMasalaChai.

OOLONG:(20-70%oxidation/50-75mgcaffeine)Oolongteaflavorsrangewidelyduetothehorticultureandproductionoftea.Theyarepopularinblends,inparticulartheinfamousDarkChocolatePeppermintOolongoveratInfinitea.It’slikesippingathinmintcookie!

GREEN TEA:(0%oxidation/35-70mgcaffeine)Twomajorkindsofgreentea,JapaneseandChinese,containpower-fulantioxidantsandpolyphenols,espe-ciallyEGCG.EGCGhasbeenshowntofightandevenkillcancercells;itmayalsohelplowerLDLcholesterol.

WHITE TEA:(0%oxidation/30-55mgcaffeine)Usingveryyoungtealeavesmeanslessprocessingandmorehealthbenefitsretained.Whiteteahasalight,mildflavor,andmixeswellwithfruits.

ROOIBOS:(Nocaffeine)ThisSouthAfricanteaisnowavailableinmanycountries,sometimesknownasredbushtea.Ithassimilarhealthbenefitswithmanyantioxidantsandhasanaturallysweetandsometimesnuttyflavor.

Pinkies UpTHE HEALTH BENEFITS OF DRINKING MATÉ TEA, AS OPPOSED TO SODABY CHERI DOSTAL

BROUGHT TOYOU IN PART BY

VolumeOne.org Jan. 20, 2011 35

THE BIGBEAUTIFULGYM GRID

Free weights

Machines

Personal training

Classes Strength& endurance Bodysculpting Cardio Pilates Yoga Nia Circuit Spinning Dance Specialty

Sports Basketball Volleyball Racquetball Tennis Pool Track

Massage

Nutritional counseling

Beverage bar

Tanning

Kids’ services

Pro shop

Spa / Sauna

Open 24 hours

Anyt

ime

Fitn

ess

Bodywork

s

Ath

leti

c Clu

bChip

pewa

Valle

y

Fam

ily

YMCA

Curves

Eau C

lair

e YM

CA

FitE

LITE

Gold

’s G

ymH

ighla

nd Fi

tnes

s Cen

ters

New

Imag

e PA

CE

UW

-Sto

ut Sport

&

Fitn

ess

Cente

rU

WEC

Rec

reat

ion &

Sport F

acil

itie

sSnap

Fit

ness

24-7

Wis

sota

Fit

ness

Tannin

g &

Mas

sage

findcontactinfointhelistingsonthepreviouspages

BROUGHT TOYOU IN PART BY

=ChippewaFallslocationonly

=Menomonielocationonly

=exceptMenomonielocation

=exceptHastingsWaylocation =ChippewaFallslocationonly

VolumeOne.org Jan. 20, 2011 36

ACUPUNCTUREAcupuncture For Wellness 616 S. Farwell Street, Eau Claire • 379-6429 • www.ac4wellness.com Casey Cas-tona offers a unique brand of healing through acupunc-ture by bringing together Chinese and Western Medi-cine. Specializing in Pain Management. Nutritional and herbal formula counseling.Elements for Healthcare 431 E Clairemont Ave, Suite 2A, Eau Claire • 832-2005 • www.elementsforhealth-care.com Offers services such as TCM acupuncture, therapeutic massage, and strategies to reduce stress.Root and Branch Acupuncture 1227 Menomonie St., Eau Claire • 836-9696 • A retired nurse practitioner of-fers both needle and non-needle acupuncture, and mi-crocurrent and meridian therapy.Tao Arts 2103 Broadway Street South, Menomonie • 231-3060 • Sensei Leland is known for his alternative and traditional Chinese approaches to medicine, includ-ing acupuncture, use of herbs, and tuina massage.

BELLY DANCINGBelly Dancing with Laura Gaber Dancers Studio Ban-bury Place, 800 Wisconsin St., Eau Claire • 926-4233 • Laura teaches six-week classes in beginning and inter-mediate belly dancing. Pilates, Yoga, and Beyond 4913 River Glen Court, Eau Claire • 832-7335 • www.baemmert.com Private sessions and group classes in Pilates, yoga, Thai yoga bodywork, belly dancing and more.Sahaja Dance / Jen Bush and Rebecca Whitman , • 688-9556 • www.sahajadance.com Belly dance classes in a friendly, energetic atmosphere with a focus on body isolations, basic dance steps and combinations, and the use of finger cymbals. Benefits may include weight loss and increased range of motion. Anticipate a supportive and fun community of dancers to uplift your spirit. No experience is necessary to start.

DANCE STUDIOSA-Step Zumba 2504 S Hastings Way, Eau Claire • 579-2623 • Angela Engstrom teaches zumba, a mixture of international dances set to international music and modi-fied for an exercise class.Arthur Murray 401 1/2 S Barstow St., Eau Claire • 834-6166 • www.arthurmurray.com

Dancing Mountain / Jen Bush , • 688-9556 • Dancing Mountain aims to guide people in joyful movement and to imbue our daily lives with a sense of wonder, explora-tion, and ease.Danz Kraze Building 4/6, Suite 205, 800 Wisconsin St., Eau Claire • 832-DANZ • Youth dance teams use Eau Claire’s largest studio space and are modeled after High School dance teams, offering poms, hip hop/funk, kick, and jazz. Short sessions available for those who are in-decisive.Diamond School of Dance 123 S Graham Ave., Eau Claire • 577-1285 • www.diamondschoolofdance.com Offers ballet, tap, jazz, lyrical, pointe, hip-hop, and com-

petitive performance.Eau Claire School of Dance 306 Main St., Eau Claire • 312 Bridge St., Chippewa Falls (above Anytime Fitness) • 832-9900 • Offering classes in ballet, lyrical, tap, hip hop, pointe, and technique.En Avant School of Dance 3330 North Town Hall Rd., Eau Claire • 874-5575 • www.enavantdance.com Pre-ballet, ballet, tap, jazz, modern, and hip-hop.Goggin Ballroom Dancing 316 Eau Claire St, Eau Claire • 833-1879 • www.dancingoggin.homestead.com They teach ballroom, Latin, and swing dancing.Jean Marie’s School of Dance 31 W Spring St., Chip-pewa Falls • 723-8635 • www.jeanmariedance.com Specializing in children’s classes, Jean Marie offers tap, ballet, jazz, and basic acrobatics. Classes for adults also available.Jewelry Box Dancer 110 Main Street West, Menomonie • 563-3534 • This studio teaches children ages 4 through eighth grade in tap, jazz, ballet, and hip hop.Two to Tango McPhee Dance Studio, UWEC campus • www.uwec.edu Two to Tango provides Eau Claire stu-dents, staff, and the general community instruction and practice opportunities for various social dances such as Swing, Cha Cha, Waltz, Viennese Waltz, Tango, and Foxtrot.

GYMS & HEALTH CLUBSAnytime Fitness 329 Water St., Suite E, Eau Claire • 831-6400 /// 401 Pinnacle Way, Suite 116, Eau Claire • 831-6200 /// 1700 Stout St., Menomonie • 309-4441 /// 312 Bridge St., Chippewa Falls • 723-3800 • www.anytimefitness.com • See The Big Beautiful Gym Grid earlier in the section.Bodyworks Athletic Club, LLC 2407 Stout Road, Menomonie • 235-6106 • See The Big Beautiful Gym Grid earlier in the section.Chippewa Valley Family YMCA 611 Jefferson Ave., Chippewa Falls • 723-2201 • www.chippewaymca.com • See The Big Beautiful Gym Grid earlier in the section.Curves 3029 N. Hastings Way, Eau Claire • 834-9507 /// 335 E. Prairie View Road, Chippewa Falls • 720-0304 /// 2010 Stout Road, Menomonie • 235-6600 • www.curves.com • See The Big Beautiful Gym Grid earlier in the section.Eau Claire Gymnastics Center 800 Wisconsin St. Build-ing 4-6, Ste. 209, Eau Claire • Gymnastics programs for ages 2 to 18 years.Eau Claire YMCA 700 Graham Ave., Eau Claire • 836-8460 • www.eauclaireymca.org • See The Big Beautiful Gym Grid earlier in the section.FitELITE 2839 Mall Dr., Ste. 3A, Eau Claire • 514-1264 • www.fiteliteonline.com • See The Big Beautiful Gym Grid earlier in the section.Gold’s Gym 3225 Lorch Ave., Eau Claire • 552-4570 • www.goldsgym-ec.com • See The Big Beautiful Gym Grid earlier in the section.Highland Fitness Center 2221 Eastridge Center, Eau Claire /// 2403 Folsom Street, Suite A, Eau Claire /// 3022 Commercial Blvd., Chippewa Falls • 833-2100 •

The Fit ListTHE CHIPPEWA VALLEY’S MANYRESOURCES FOR A HEALTHY LIFESTYLE

BROUGHT TOYOU IN PART BY

Crest Wellness Center, UWEC

VolumeOne.org Jan. 20, 2011 37

VolumeOne.org Jan. 20, 2011 38

www.highlandfitness.com • See The Big Beautiful Gym Grid earlier in the section.New Image PACE Fitness 1942 Hallie Road, Lake Hallie • 552-7223 • www.newimagepacefitness.com • See The Big Beautiful Gym Grid earlier in the section.Snap Fitness 3445 E Hamilton Ave., Eau Claire • 830-9999 /// 1320 Broadway St. N, Menomonie • 232-9999 /// 475 Chippewa Mall Dr., # 305, Chippewa Falls • 723-0602 • www.snapfitness.com • See The Big Beauti-ful Gym Grid earlier in the section.UW-Stout Health & Fitness Center / North Point 712 Broadway St, Menomonie • 232-1392 • urec.uwstout.edu • See The Big Beautiful Gym Grid earlier in the section.UWEC Recreation & Sport Facilities McPhee Educa-tion Building, UWEC upper campus, Eau Claire • 836-3377 • www.uwec.edu • See The Big Beautiful Gym Grid earlier in the section.Wissota Fitness Tanning & Massage 16850 Cty. Hwy. X, Chippewa Falls • 723-7006 • www.wissotafitness.com • See The Big Beautiful Gym Grid earlier in the section.

HYPNOSISHypnosis Center of Eau Claire 306 S. Barstow St., Suite 209, Eau Claire • 552-5355 • www.hypnosiscenterec.com Certified and experienced hypnotherapist Richard Marano, B.S., C.H. will “allow your subconscious mind to replace bad habits with new and healthier ones.” Rid yourself of anything from insomnia and smoking to anxiety and weight problems.Heaven Sent Healing 3548 Cypress St., Eau Claire • 833-1096 • www.heavensenthealing.us Julie works as a Spiritual Teacher, empowering people to live more mindfully. She specializes in healing relationships: with others, with self, with spirit.

MARTIAL ARTS / BOXINGHealing Choices Massage & Tai Chi 2711 Pleasant St., Eau Claire • 852-0303 • www.healingchoicesec.com

Classes offered in Tai Chi and AMMA massage, four days a week. Also offers hot stone massage and AMMA Therapy, and has a complete line of nutritional supple-ments available.AKF Martial Arts Academy of Eau Claire 1606 S Hast-ings Way, Suite B, Eau Claire • 613-8282 • www.kyuki-do.com Kyuki-Do is focused on helping you and your families achieve goals through martial art techniques, practical self defense, and traditional principles. Offers classes for ages 4 and up, and done in a group setting. Can also accommodate private lessons.American Tae Kwon Do & Fitness 800 Wisconsin St., Eau Claire • 552-2777 • www.atf.nu Taekwondo classes in both private and group settings offering fast, hard-hit-ting cardio workouts. Also offers a fitness membership where members can independently use the facility and equipment during non-class hours.Clear Water Martial Arts 10 West Spring St., Chippewa Falls • 723-3321 • Offering private and group Karate, Judo, Jujitsu, and Tai Chi instruction to all ages. Karate American is there two days a week.Elite Karate 410 Bay St., Chippewa Falls • www.eli-

tekaratestudios.com Karate instruction in both private and group settings focusing on the three core values of honor, discipline, and respect.Ju’s Taekwondo Karate Academy 415 S. Farwell St., Eau Claire • 834-5766 • www.justaekwondo.com Taekwondo classes in both private and group settings. Classes target self-defense, weight control, physical and mental fitness, improved coordination and agility.Karate American 2228 N. Hillcrest Pkwy., Altoona • 832-6488 • www.karate-american.com Karate instruc-tion for all ages in both private and group settings. Les-sons in Karate, Taekwondo, Judo, and Aikido are avail-able. Menomonie Goju-Ryu Karate 1807 Wilson St. # A, Menomonie • 233-9927 • www.menomoniegoju.com Okinawan style Karate instruction in both private and group settings.One Tree Martial Arts 2015 Fairfax St., Eau Claire • 514-0656 • www.onetreemartialarts.com Martial arts instruction for all ages (group of private settings) in Tae-kwondo, Hapkido, Jiu-Jitsu, and several other arts. Also offering women’s self-defense and kickboxing classes,

tai chi, and a high energy children’s program. 24-hour fitness room with certified fitness trainer on site.Red Dragon Academy 438 Main St. E, Menomonie • 235-1122 • www.reddragonacademy.com Karate in-struction for all ages in both private and group settings.

MASSAGEAdvanced Massage Therapies 829 W Clairemont Ave., Eau Claire • 833-3505 • Offers deep tissue, Swedish, hot stone, cupping, sports, pregnancy, medical therapy, and Ashiatsu massage.Body Focus 705 S. Barstow St., Eau Claire • 835-8898 • www.bodyfocusonline.com Offers shiasu, pregnancy, Thai, couples, deep tissue, bamboo, reflexology, cup-ping, raindrop, Reiki, personal injury, and workman’s comp massages.Chippewa Valley Physical Therapy 116 N Bridge St., Chippewa Falls • 726-1010 • Offering massage and bodywork, therapeutic massage, Swedish massage, deep tissue massage, and physical therapy targeting headaches, neck, back and shoulder pain.Clemona Massage and Day Spa 815 E Main St., Menomonie • (920) 853-6668 • www.clemona.com Wedding Bell Bliss services relax, calm and center you during one of the busiest planning moments of your life. Individual bridal services, group wedding party spa services, and mobile on-site services available. Office located in Menomonie, but mobile throughout many areas of Wisconsin and Minnesota. Contact us for more information or for your free consultation! Eau Claire Massage 316 N Barstow St. Suite G, Eau Claire • 225-8018 • www.EauClaireMassage.com Of-fers deep tissue, relaxation, trigger point therapy, chair, hot stone, couples, and on-site massages. Relief for headache, neck and shoulder pain, low back pain, sci-atica, and overall stress.Elements for Healthcare 431 E Clairemont Ave, Suite 2A, Eau Claire • 832-2005 • www.elementsforhealth-care.com Offers services such as TCM acupuncture, therapeutic massage, and strategies to reduce stress.Essential Massage Therapy Center 4330 Golf Terrace, Suite 209, Eau Claire • 888-213-0820 • www.essential-massagetherapy.com Offers Swedish, deep tissue, hot stone, chair, prenatal, couples, sports, Fourhand, neuro-

BROUGHT TOYOU IN PART BY

The Fit List CONT’D Hypnosis Center of Eau Claire

VolumeOne.org Jan. 20, 2011 39

VolumeOne.org Jan. 20, 2011 40

muscular, and Thai yoga massages.Harmony Healing Center 2130 Brackett Ave. Suite B, Eau Claire • 831-8030 • www.harmonyhealingcenter.net Offers Swedish, deep tissue, hot stone, trigger point, chair, prenatal, sports, and AMMA massage; as well as reflexology and neuromuscular therapy.Healing Arts Center 710 4th St. E, Menomonie • 235-7711 • www.bubishi.com A school for massage therapy and Asian bodywork therapy. Specializing in AMMA Therapy, which is concerned with the balance and movement of life energy in the human body.Healing Choices Massage & Tai Chi 2711 Pleasant St., Eau Claire • 852-0303 • www.healingchoicesec.com Classes offered in Tai Chi and AMMA massage, four days a week. Also offers hot stone massage and AMMA Therapy, and has a complete line of nutritional supple-ments available.The Lotus Spa , • 835-1100 • www.lotusspaeauclaire.com Relaxation, sport, or deep tissue massages avail-able. Also offering aromatherapy scalp massages, ma-ternity massage, and hot stone treatments. Relaxation facials, pedicures, and hydrotherapy tubs.Optimum Therapies, LLC 517 E. Clairemont Ave., Eau Claire • 855-0408 /// 1309 Stout Rd., Menomonie • 233-6320 • www.optimumtherapies.com Offering deep tissue, trigger point release, myofascial release, neuro-muscular, sports, Swedish, and hot stone massage and physical therapy.Path to Health Massage Therapy and Wellness 316 N. Barstow St. Suite G, Eau Claire • 225-0461 • www.path-tohealthmassage.com Offering Swedish, aromatherapy, hot stone, reflexology, prenatal, sports, deep tissue, Reiki, and AMMA massage.Poppy Moelter, Massage Therapist 820 Chauncey St., Eau Claire • 834-8867 • Offers therapeutic massage, for neuromuscular therapy and myofascial release, as well as integrative movement (inner-guided dance).Sans Souci Massage 927 Loring St., Suite 4, Altoona • 830-9890 • www.sanssoucimassage.com Offering thera-peutic massage and bodywork.

NUTRITIONJust Six , • www.JustSix.com A nutritional service pro-vided by a licensed dietitian that involves creating nutri-tious meal and snack plans, and tracking your habits and relationships with food.Optima Health & Vitality Center 3321 Golf Road, Eau Claire • 832-1953 • www.optimahvc.com A chiropractic practice that also offers nutritional counseling.

PERSONAL TRAININGEvolve Wellness, LLC 412 1/2 Water St., Eau Claire • 864-7000 • www.livewellevolve.com Cheri Dostal, NASM certified personal trainer, offers personal training services as well as customized group workshops. Com-plimentary consultation available upon request.Momentum SportFitness, LLC 2615 London Road, Eau Claire • 955-4319 • www.momentumsport.com New, larger facilities. Personal and group training for sports conditioning, rehabilitation, and general strength and fitness for both kids and adults. Clinics available for coaches. Baseball academy includes two rentable bat-ting cages, batting lessons, and a baseball camp. En-dorsed by the Eau Claire County SWAT Team.

PHYSICAL THERAPYB Natural 2421 E. Clairemont Ave., Eau Claire • Dr. Amy Emch practices immuno-therapy and offers servic-es such as health & nutrition consultations, reflexology, chi machine therapy, and infra red therapy.Capture Life, LLC , • 829-2761 • www.capturelifewell-ness.com Capture Life offers individual and small group fitness training, workshops, and yoga classes. Chippewa Valley Physical Therapy 116 N Bridge St., Chippewa Falls • 726-1010 • Offering massage and bodywork, therapeutic massage, Swedish massage, deep tissue massage, and physical therapy targeting headaches, neck, back and shoulder pain.Creative Fitness , • 379-0304 • creativefitnessec.com Offers classes, life coaching, and personal training (everything from fitness and nutrition to stress manage-ment, meditation, and holistic practices).Hayden Integration 815 Main St. E, Menomonie • 608-630-0664 • haydenintegration.com Chris Hayden is a certified Rolfer, a method of structural integration that involves balancing a person’s tissue structure to release constrictions (from injuries, overuse, posture, etc.) and bring relief to your body.McMahon Chiropractic and Physical Therapy 3004 Golf Rd # 100, Eau Claire • 834-4516 • www.mcmahon-chiroandpt.com Specializing in chiropractic and physi-

The Fit List CONT’D

VolumeOne.org Jan. 20, 2011 41

cal therapy work.Optimum Therapies, LLC 517 E. Clairemont Ave., Eau Claire • 855-0408 /// 1309 Stout Rd., Menomonie • 233-6320 • www.optimumtherapies.com Offering deep tissue, trigger point release, myofascial release, neuro-muscular, sports, Swedish, and hot stone massage and physical therapy.Quantum Health & Wellness 817 Chauncey St., Eau Claire • 456-6734 • www.DrLynnThompson.com Dr. Lynn Thompson specializes in stress reduction, pain management, and weight loss.

SPIRITUAL WELLNESSA-Ok Stress-Release MDs Prefer , • 379-4901 • Of-fering transcendental meditation (or TM) stress-release, meditation techniques. The certified instructor will come to you, or invite you to his home, in an individual or group setting for a four-day class.Colors of Joy Healing Arts Center 405 S. Farwell St., #2-A, Eau Claire • (805) 909-9674 • www.journeyofthe-heartandsoul.com Offers transformational soul therapy, angel therapy, reiki, mediumship readings, animal com-munication, cranio-sacral therapy, and light activation therapy.Heaven Sent Healing 3548 Cypress St., Eau Claire • 833-1096 • www.heavensenthealing.us Julie works as a Spiritual Teacher, empowering people to live more mindfully. She specializes in healing relationships: with others, with self, with spirit.

SPORTS & REC EQUIPMENTAnybody’s Bikeshop 411 Water St., Eau Claire • 833-7100 • www.anybodysbikeshop.com Bikes, accessories, and bicycling apparel.Dunham’s Sporting Goods 1501 Broadway St. N., Menomonie • 235-0750 • A range of gear and equip-ment from fitness to hunting and fishing.Eau Claire Bike & Sport 403 Water St., Eau Claire • 832-6149 • www.bikeandsport.com Bikes, skateboards, inline skates, snowboards, fitness equipment, ac-cessories, and disc golf.Mi Zi Zak Kayaks 29588 State Road 40, New Auburn • 967-2301 • www.mizizakkayak.com A range of kayaks and kayaking accesso-ries. Open by appointment only mid-October through April.Play It Again Sports 3561 Gateway Dr., Eau Claire • 834-0602 • www.playitagainsports.com New and used

roller blades and equipment for fitness, hockey, golf, baseball, and soccer.Scheels All Sports 4710 Golf Road, Eau Claire • 833-1886 • A wide range of sporting goods and fitness gear from shoes to home gyms. Simple Sports 326 Main St. E., Menomonie • 233-3493 • Sales and service on bikes (new and used), hockey equip-ment, skateboards, snowboards, and disc golf supplies.Spring Street Sports 12 W. Spring St., Chippewa Falls • 723-6616 • www.springstreetsports.com A huge se-lection of bikes and bike accessories, as well as snow sports equipment.

WELLNESS CENTERSAngel Care Healing Touch 2130 Bartlett Ave. Ste. B, Eau Claire • 832-7250 • Judy Meinen is a healing touch practitioner, reiki master, certified angel therapy practi-tioner, and certified hypnotherapist. Provides energetic biofeedback and presentations, workshops, and reiki classes.ReJuv Wellness , • 563-2370 • www.rejuvwellness.blogspot.com Offers fitness events (boot camps), semi-nars, nutritional counseling, and classes. Locations vary.Tao Arts 2103 Broadway Street South, Menomonie • 231-3060 • Sensei Leland is known for his alternative and traditional Chinese approaches to medicine, includ-ing acupuncture, use of herbs, and tuina massage.

YOGA, PILATES & MORECapture Life, LLC , • 829-2761 • www.capturelifewell-ness.com Capture Life offers individual and small group fitness training, workshops, and yoga classes. Evolve Wellness, LLC 412 1/2 Water St., Eau Claire • 864-7000 • www.livewellevolve.com Cheri Dostal, NASM certified personal trainer, offers personal train-ing services as well as customized group workshops. Complimentary consultation available upon request.

Pilates, Yoga, and Beyond 4913 River Glen Court, Eau Claire • 832-7335 • www.

baemmert.com Private sessions and group classes in Pilates, yoga, Thai

yoga bodywork, belly dancing and more.Pilates by Penny 6108 Aspen Ridge Dr., Eau Claire • 296-0836 • Penny Crochiere is an STOTT and Mas-ter Certified Pilates Teacher who

has been teaching for 13 years. She runs a fully-equipped studio out of her

home, offering private, semi-private, and small group classes.

BROUGHT TOYOU IN PART BY

For even more resources and articles, visit VolumeOne.org/Health

VolumeOne.org Jan. 20, 2011 42

rumba, cha-cha, swing and more. Open to all inter-ested dancers. Dressy attire please. Sponsored by Chippewa Valley Dance Club.

YOGABeginner’s Yoga Series Every Thursday until Jan. 27, 5:30-7pm • Yoga Center of Eau Claire, 412 1/2 Water St. • $40 • 14+ • 830-0321 • This is an op-portunity for beginners to be introduced to the basic principles and poses of yoga in a systematic way. You will learn about grounding, extension, how to mobi-lize the core muscles, how to work with the breath in poses, benefits of yoga, how the poses are related, and much more. After taking this class you will be equipped to join any of our multi-level yoga classes.Heart Yoga Feb. 6, 8am • Yoga Center of Eau Claire, 412 1/2 Water St. • $20 per class, $50 for series • 830-0321 • www.infinitejoy.com Unite your body and spirit and find love and energy in your life through the practice of yoga.

ZUMBAZumba Fitness Class Every Monday until Dec. 31, 6-7pm; Every Saturday until Dec. 31, 8:30-9:30am; Every Thursday, 6-7pm; Every Wednesday, 6-7pm; Second Monday, 7-8pm • Christ Church Cathedral, 510 S. Farwell St., Eau Claire • $5/class, $40/10 class punch card • [email protected] • 835-6550 • Zumba with instructor Jean Dreger and Emma Lutz-ke. Includes Samba, Tango, Flamenco, Bellydance, Merengue, Hip Hop, Cumbia, Salsa, Reggaeton and more. FREE beginner class second Mondays at 7pm.A-Step Zumba Every Monday, Wednesday, Thursday 6-7pm Saturday 9-10am • The Design Center, 2504 S. Hastings Way • First class FREE • 579-2623 (An-gie), 829-8365 (Steph) • FREE beginner class Feb. 22, 6-7pm.Brazilian Zumba Every Tuesday 8-9pm Thursday 8:15-9:15pm • 123 Graham Ave., Eau Claire • $6 for one class, $50 for a 10-class punch card • 514-8155 • Experience authentic latin zumba flavor by Brazil-ian level two zumba instructor Sanny Jones. Classes include 10 minute floor workouts and the Thursday class features kickboxing mixed in with yoga. No registration necessary.Strong Bones Yoga Every Monday until Feb. 14, 7:15-8:45pm • Yoga Center of Eau Claire, 412 1/2 Water St. • $60 • 14+ • 830-0321 • Learn a series of poses shown to build bone mass. Variations will be offered for each pose to make it suitable for your cur-rent state of bone health. Leave the series with a way to protect or rehabilitate your bones, lower anxiety, increased poise, balance and confidence, and normal-ized blood pressure.

CLASSES2011 New Year’s Resolution Solution Every Tues-day, Thursday until Mar. 31, 6:30am • Unity Christ Center, 1808 Folsom St • $10 per class, $20 for one month; discounts available • 379-3004 • By Deborah Lilly of Creative Fitness. Medical questionnaire and

waiver available. Each class includes centered breath-ing and guided meditation. See contact info for spe-cific featured workouts each day.Blueprints I: Making Your Body Your Home Every Thursday until Jan. 27, 10:30am-noon • Yoga Center of Eau Claire, 412 1/2 Water St. • $40.00 • 14 to ? • 830-0321 • Blueprints will establish a sound founda-tion for new practitioners, and help experienced prac-titioners move deeper into their practice with purpose and rich understanding of the human body. We define health as a lack of illness, rather than working with desire toward our true imprint of health and vitality.Join the Revolution: Women’s Boot Camp Every Day, Monday, Tuesday, Thursday until May. 31, 4:29-5:29pm • Landmark, 4140 126th St. • [email protected] • women 18+ • 563-2370 • www.Rejuvwell-ness.blogspot.com Forget The “Resolution.” Join the Revolution. We are more than just a boot camp; we are place where you can escape, relieve stress, make friends and be yourself. Our passion is to provide an atmosphere that is positive, non-judgmental, encour-aging, and empowering to women. No start/end dates; camps run continuously. Register in advance.Health 101 Every Tuesday, Wednesday, Thursday, 6-6:30pm • Erickson Chiropractic Clinic, 2722 Lon-don Road, Eau Claire • FREE • 514-2701 • www.ericksonchiropracticec.com Dr. Austin Erickson, DC offers a class on the basics of healthy living. Topics will include Sleep, Diet, Excercise, Staying Hydrated and the role of attitude in health.Health Break Jan. 20, 7pm • Borders, 4030 Com-monwealth Ave • FREE • 838-5805 • No registration is necessary.TRX Suspension Training with Benji Williford Ev-ery Monday, 7:15-8:15pm; Every Wednesday, 7:15-8:15pm; Every Thursday, 7:15-8:15pm; Every Friday until Aug. 23, 5:15-6:15pm; Every Monday, 6:15pm; Every Monday, 6:15pm • Radiant Health Chiroprac-tic, 534 Water St., Eau Claire • $15 • 379-4249 • www.BenjiWilliford.com TRX Suspension Training gives athletes, military personnel and fitness pros around the world a complete total-body training tool and the cutting-edge training programs they need to take their performance to the next level.TRX Suspension Training with Benji Williford Every Monday, Friday 8:30am Monday 9:30am Wednesday 8:50am Wednesday 6pm Wednesday 7:15pm Friday 4:45pm Friday 5:45pm • Angelus Quick Fitness, 126 Graham St. • $15 • 379-4249 • www.BenjiWilliford.com TRX Suspension Training gives athletes, military personnel and fitness pros around the world a com-plete total-body training tool and the cutting-edge training programs they need to take their performance to the next level.Triathlon Seminar Jan. 22, 10am • Red Cedar Medi-cal Center, 2321 Stout Road • FREE • 231-2453 • www.badcatbicycles.com Guest speakers: Lindsey Bradley Trek (women’s representative), Mark Mas-tilar (5 time ironman finisher), Christopher Schrantz (M.S. P.T.). Topics: Injury prevention, nutrition/hydra-tion, training/preparation and race day.Introduction to Cross-Country Skiing Jan. 23, 1-3pm • Wise Nature Center, Beaver Creek Reserve, S1 Cty Rd. K, Fall Creek • $9, $6 friends • 877-2212 • Have

EVENTSWinter After Hours - Eau Claire’s Weekly Snow-Based Social Thursdays in January and February, 6-8pm • Boyd Park, 1202 Fairway Street • FREE • 552-0457 • VolumeOne.org A ton of cool winter action for adults and kids alike in Eau Claire’s fes-tively-lit Boyd Park. Enjoy ice skating, snowshoeing (skates/shoes available for rent), snow sculptures, winter kubb (that awesome Nordic lawn game, win-ter style), a giant fire pit, hot drinks, music and lots of fun. Take winter back, and enjoy it after hours.Silvermine International Ski Jumping Competition Friday Jan. 21, 5pm; Saturday Jan. 22, 11am • Silver Mine Ski Jump, 2900 Silvermine Dr. • $6/advance, $10/gate, FREE/12 & under • www.ec-skiclub.com Enjoy two days of of spectacular ski jumping compe-tition. Also enjoy bonfires, a beer tent, Flying Eagles concessions, $1 snowmobile rides and the Hall of Fame dance at America’s Best Value Inn Saturday at 8pm.Chippewa Valley Powder Keg Snowshoe Race 10:30am-2pm • Eau Claire County Expo Center, 5530 Fairview Drive • $25 adults, $5 kids under 12, (in advance: $20 adults) • 839-3755 • www.chippe-waoffroad.org The Chippewa Valley Powder Keg, presented by CORBA, will include a 5-mile snow-shoe race, a 2-mile snowshoe run/stroll and a fun ¼-mile romp for kids and local mascots. Snowshoers of all ages and experience levels are welcome.18th Annual Chippewa Falls Lions Club Ice Fishing Contest & Raffle 11am-3pm • Glen Loch (bordering

Irvine Park and Ojibwa Golf Course) • 829-5807 • Fish prizes for 1st, 2nd and 3rd places for perch, bluegill, crappie and northern. Only fish caught on Glen Loch between the starting and ending horn are eligible for prizes. Complimentary hole drilling, con-cessions in the tent. Prizes awarded at 3pm as well as the raffle drawings for cash prizes.

DANCEBelly Dance Classes: American Tribal Style Every Tuesday, 6-7:15pm; Every Thursday, 6-7:15pm; Ev-ery Saturday, 10:30-11:45am • Sofia Spirit Studio, 2131 Fenwick Ave. • $12, $10 students, $15 drop-in rate • 379-6304 • www.sofiatribal.com Belly Dance is a dance by women for women’s purposes. Join the certified insructors of Sofia Tribal for a new 6-week level 1 session of American Tribal Style Bellydance. This dance style is for women of all ages, body shapes and sizes. Come join the exciting sisterhood of dance.Eau Claire International Folk Dancers Every Fri-day, 7:30-9:30pm • Eau Claire YMCA Fitness and Training Center, 216 Emery St., Eau Claire • $1/night • A weekly recreational international dance group where you dance the dances of many lands. Come and join us whenver you like. No partners necessary. Wear comfortable clothes and soft-soled, non-marking clean shoes. First Fridays of the month are specialized for beginners.Belly Dance Classes Jan. 26, 5-6pm • Sofia Spirit Studio, 2131 Fenwick Ave. • $40 • [email protected] • 970-471-5882 • Learn middle eastern dance in a fun and feminine environment. Egyptian cabaret, turkish and folk styles of belly dance. For women of all ages and sizes; no dance experience necessary. Six Wednesdays beginning Jan. 26, 5-6pm.Ballroom, Swing and Latin Dance - Larry Busch Band Jan. 29, 7:30-11pm • St. Marys Community Center, 1812 Lynn Ave, Altoona • $15 • 833-1879 • www.dance.spinstep.com Saturday, Jan 29 enjoy an evening of dancing to a variety of music by the Larry Busch Band, which will include the waltz, foxtrot,

BROUGHT TOYOU IN PART BY

The Fit List RECREATION EVENTS

VolumeOne.org Jan. 20, 2011 43

you ever wanted to try cross-country skiing but were not sure where to begin? Come to Beaver Creek to learn the basics. After a brief classroom time inside we’ll head to an open field in front of the Observatory to try it out first hand. If you’ve never tried to cross-country skiing before and would like to give it a try, this class is for you. There will be fun and adventure for the whole family and maybe a cup of hot chocolate too. Cross-country ski rental fee is included. Register in advance.Learn To Skate Every Sunday until Feb. 20, 4:30-5:15pm • Hobbs Ice Arena, 915 Menomonie Street, Eau Claire • 831-9734 • www.ecfigureskate.org Learn to Skate with the Eau Claire Figure Skating Club. Students of all ages can learn to skate using the US Figure Skating Club’s basic skills program and snow plow same program. Skaters of all ages welcome to participate. Winter session runs Sundays, January 2nd through February 20th, 2011. Watch for upcoming in-formation on our ice show: Ice, Camera, Actions. Pilates Every Tuesday until Feb. 15, 1:30-2:30pm •

L.E. Phillips Senior Center, 1616 Bellinger St. • $60, $40 members • 839-4909 • Pilates has a strong focus on the abdominal muscles to ensure that the spine is properly supported. Pilates increases our awareness of all muscle groups, relieving the strain on those that are often overused. Participants will be using mats on the floor for this class and is limited to 15.Core Strengthening Class Every Tuesday, 5:30-7pm • McMahon Chiropractic and Physical Therapy, 3004 Golf Rd. Suite 100, Eau Claire • $5 • 834-4516 • www.mcmahonchiroandpt.com Strengthen your core in a fun and interactive group setting. Hosted by Dr. Bryan Henslin, D.C., M.S. use pilates, yoga postures and stability ball exercises to improve your core balance, strength and flexibility. This class is appropriate for beginners and the experienced. Bring a stability ball and yoga mat (also available for purchase). Call to reserve a spot.Health 101 Every Tuesday, Wednesday, Thursday, 6-6:30pm • Erickson Chiropractic Clinic, 2722 Lon-don Road, Eau Claire • FREE • 514-2701 • www.

ericksonchiropracticec.com Dr. Austin Erickson, DC offers a class on the basics of healthy living. Topics will include Sleep, Diet, Excercise, Staying Hydrated and the role of attitude in health.Introduction to Snowshoeing Feb. 5, 9:30-11:30am-Check with venue for hours • Wise Nature Center, Beaver Creek Reserve, S1 Cty Rd. K, Fall Creek • $9, $6 friends • 877-2212 • Learn about the snowshoe’s history, the different styles of snowshoes, and how and where to use them. After a brief classroom time inside we’ll take to the trails for a snowshoe hike. Make a new adventure for the entire family! The snowshoe rental fee is included in the program cost. Register by Feb. 2.Healing Oils in the Bible Feb. 6, 1-3:31pm • Unity Christ Center, 1808 Folsom St. • 836-0010 • Learn hidden health secrets; smell a bit of the Garden of Eden; discover God’s forgotten gifts with facilitator NIK` Meiers, Wellness & Lifestyle Consultant since 1967.

BROUGHT TOYOU IN PART BY