Embed Size (px)
Citation preview
AndreiaBruno|CurriculumVitae
w Page1of13w
AndreiaFradinhoBruno|CurriculumVitae
Nationality|Portuguese(EUcitizen)
Address|5LomandraWalkway,BrunswickEast,Melbourne,VIC3057,Australia
Mobile|+61416750039
E-mail|[email protected]
Summary
Andreia Bruno is a Project Manager & Lecturer in the Centre for Medicine Use and Safety (CMUS), at the Faculty of Pharmacy and Pharmaceutical Sciences, Monash University, since February 2017. Previously, Dr Bruno was the Project Coordinator and Researcher in the International Pharmaceutical Federation Education (FIPEd) a post she held from January 2011 to January 2017. Her areas of responsibility in FIPEd encompassed all issues relevant to communication, coordination and management plans for projects within the domain areas of the Education Development Team [Domains: Competency development (Foundation and Advanced practice), Global workforce, Interprofessional Education, among others] and the Academic Institution Membership. Dr Bruno was the Technical Lead for Professional Development in Ordem dos Farmacêuticos (Portuguese Pharmaceutical Society | OF), from June 2014 to January 2017, her areas of responsibility encompassed the development of competency-based frameworks for the available specializations and the accreditation activities and processes for the continuous education of the Portuguese pharmacists. Currently, she provides editorial support to the Pharmacy Education Research Journal, as an Associate Editor, an online platform for publishing peer-review articles ¾ http://pharmacyeducation.fip.org/. Dr Bruno is also an Honorary Lecturer at the University of London, School of Pharmacy, where she coordinated and oversaw 3 PhD candidates, working on FIPEd projects, supporting the development of research methodologies. Her teaching is related to research methodologies on the MSc in Pharmacy Practice APP Fast-Track Programme learning sets, and provides constructive feedback to initial project presentations. Other areas encompass conducting workshops and consensus groups with students; assessing OSCEs for undergraduates and Joint Board Programme post-graduate students. From 2013 to 2016, supervised rotation students from St Louis College of Pharmacy, USA, as a Clinical Preceptor for advance pharmacy practice. Responsibilities include tutoring, structuring, planning, marking and assessing the projects and the students. The doctoral thesis is entitled ‘The Feasibility, Development and Validation of a Global Competency Framework (GbCF) for Pharmacy Education’, where the focus were competency based approaches towards professional development and pharmaceutical services. Themes such as, continuing professional development, continuing education, education and training, professional recognition and credentialing processes were also addressed. The development of the GbCF is based in current educational tools worldwide to improve practitioner development and pharmacy education and it has been adapted and is being used in several countries [Ireland, Croatia, Bosnia and Herzegovina, Monte Negro, Macedonia, Lithuania, Serbia, Philippines, Brazil, in the Pacific Island Countries and in some universities across the globe] ¾ https://www.fip.org/files/fip/PharmacyEducation/GbCF/GbCF_v1_online_A4.pdf Dr Bruno is a pharmacist by training who studied at the Egas Moniz Institute in Portugal before the doctoral programme in University College of London, School of Pharmacy; she speaks Portuguese, English and Spanish. Areas of interest include project management, workforce and practitioner development, needs-based health services development and competency based approaches. A list of the publications, key notes and invited presentations can be found from page 6 onwards.
AndreiaBruno|CurriculumVitae
w Page2of13w
CurrentEmployment
February 2017 Lecturer/Project Manager Centre for Medicine Use and Safety (CMUS), Faculty of Pharmacy
and Pharmaceutical Sciences, Monash University.
ProfessionalEngagement|International
June 2017 Expert member of the
Steering Committee
Pharmacy Technician Role Redesign Steering Committee – led by the
Society of Hospital Pharmacists of Australia, Australia | Supporting
the creation of projects focused on building capacity in the
pharmacy workforce through developing and expanding the scope of
practice of pharmacy technicians and assistants.
May 2017 Reviewer for the Newton
Prize
The Newton Prize recognises excellent research and innovation in
support of economic development and social welfare in Newton
Fund partner countries. UK | Reviewing applications for the Newton
Prize that has been developed to demonstrate how UK partnerships
with Newton countries are solving global challenges.
May 2015 Expert member of the
Steering Committee
European Association of Hospital Pharmacists (EAHP), Belgium |
Common Training Framework (legally binding framework which will
be submitted for approval to the European Commission in 2019).
October 2011 Associate Editor Pharmacy Education Journal | Reviewing manuscripts and
supporting the website and twitter account.
February 2016 to
February 2018
Expert member of the
Scientific Committee
Pilot Project for Antiretroviral therapy in Portuguese Community
Pharmacies – led by the Ministry of Health, Portugal | Development
of the design for a one-year pilot project. Identifying the key
outcomes, development of a sample and research methodologies
including surveys and data collection and analysis.
May 2015 to
March 2018
Chair of the Working
Group 1 – Competency
Mapping
European Association of Hospital Pharmacists (EAHP), Belgium |
Development of a Common Training Framework. Leading an expert
working group and analysis competency based documents across
Europe.
September 2013
to January 2017
FIP Data &
Communications Manager
FIP-RPS Global Pharmacy Workforce Observatory, United Kingdom |
Supporting the Advisory Group and the lead manager of the project,
collecting and conducting research with the data.
November 2013
to May 2016
FIP Representative
Expert
World Health Organization (WHO) Technical Working Group on
Health Workforce Education Assessment Tools, Geneva | Progress
report on health workforce education was developed to highlight
the progress on the strategies and activities of WHO and its
partners in transforming health workforce education. The progress
report was presented at the World Health Assembly in May 2016.
April 2014 to
April 2015
RPS Lead for International
Liaison
Royal Pharmaceutical Society of Great Britain (RPS), United
Kingdom | Facilitated communication and working relationship
between RPS and FIP, as well as, supporting international relations
with other partners.
AndreiaBruno|CurriculumVitae
w Page3of13w
2012/2013 Taskforce member Joint declaration on competencies for the Pan-American Conference
on Pharmacy Education, in collaboration with the PAHO and the
Pharmaceutical Forum of the Americas, Americas | Report
development, specially the analysis of the competencies (research)
and translation to English.
ProfessionalExperience
January 2016
to January
2017
Owner and CEO ab empowerment – consulting, training, events and design
company focus on healthcare, based in Lisbon, Portugal.
June 2014 to
January 2017
Technical Lead for
Professional Development
Ordem dos Farmacêuticos (OF), Portugal | Portuguese
Pharmaceutical Society, Portugal. | Areas of responsibility
encompass the development of competency-based frameworks
for the available specializations and the accreditation
activities and processes for the renewal of the practitioners
professional license and continuous education.
January 2011
to January
2017
FIPEd Project Coordinator and
Researcher
International Pharmaceutical Federation (FIP), for the FIP
Education (FIPEd), The Netherlands. | Areas of responsibility
in FIPEd encompass all issues relevant to communications and
coordination and management plans for projects within the
domain areas of the Development Team [Domains: Academic
and Institutional Capacity, Competency development
(Foundation and Advanced practice), Continuing Professional
Development/Education, e-platforms and IT-based learning,
Global workforce, Interprofessional Education, Leadership,
Pharmacy Support Workforce and Quality Assurance] and the
Academic Institution Membership.
January 2011
to March 2014
Project Coordinator FIP UNESCO-UNITWIN Global Pharmacy Education Development
Network | Supported the development of the documentation
for the development of the Centres of Excellence and of the
network itself. Organisation of the summits, held in the hosting
countries of the CoE.
April 2013 to
December 2013
Professional Frameworks Lead Royal Pharmaceutical Society, United Kingdom. | Areas of
responsibility comprised in the revision of the Advanced Level
to Consultant Framework and the General Level Framework,
the plans and delivery of the reports; also technical support
for the development of tools and resources for the RPS Faculty
(launched on June the 4th 2013).
January to
April 2013
Research Manager Royal Pharmaceutical Society, United Kingdom. |
Analysis of the results from the hospital standards pilot
study; revision of articles.
January to
December 2012
Project Manager United Kingdom Clinical Pharmacy Association (UKCPA) |
Working with the partner groups on a Credentialing Report.
AndreiaBruno|CurriculumVitae
w Page4of13w
July to
September
2007
Erasmus Programme School of Pharmacy, University of London in the Department of
Practice and Policy, United Kingdom. | Project entitled
‘Review of literature on mentorship programmes for health
researchers’.
January to
April 2007
Internship Hospital Pharmacy | Hospital Dona Estefânia, Lisboa, Portugal.
October to
December 2006
Internship Community Pharmacy | Farmácia Central, in Charneca de
Caparica, Portugal.
August 2006 Trainee Pharmacy Department of the Townville Hospital, Townsville,
Australia.
TeachingExperience
May 2015 Honorary Lecturer University College London, School of Pharmacy, United Kingdom |
Coordination and oversight of 3 PhD candidates, working on FIPEd
projects. Supporting the development of research methodologies,
mentoring and prepping for PhD viva’s. Teaching research
methodologies on the MSc in Pharmacy Practice APP Fast-Track
Programme learning sets. Providing constructive feedback to
project presentations.
2013 to 2016 Clinical Preceptor for
Advance Pharmacy
Practice
St Louis College of Pharmacy, USA | Mentored and supervised 7
rotation students for a 6 weeks period. Tutoring, structuring,
planning, marking and assessing the projects and the students
(2014 – 3; 2015 – 2; and 2016 – 2 students).
January 2014 to
December 2014
Visiting Scientist University College London, School of Pharmacy, United Kingdom |
Coordination and oversight of 3 PhD candidates, working on FIPEd
projects. Supporting the development of research methodologies
and mentoring. Teaching research methodologies on the MSc in
Pharmacy Practice APP Fast-Track Programme learning sets.
Providing constructive feedback to initial project presentations.
January 2008 to
January 2011
Associate Researcher
Pharmacy Education Taskforce, FIP Collaborating Centre, UCL
School of Pharmacy, United Kingdom | Supporting the
development of research and final reports on workforce education
and development for FIP. Conducting workshops and consensus
groups at congresses and at UCL with students. Assessing in the
OSCEs for undergraduates and Joint Board Programme post-
graduate students.
AcademicBackground
2007-2011 Doctor of Philosophy
(PhD)
UCL School of Pharmacy. Thesis entitled ‘The Feasibility,
Development and Validation of a Global Competency Framework
for Pharmacy Education’.
2001-2007 Bachelor in
Pharmaceutical
Sciences (BSc Pharm)
Instituto Superior de Ciências da Saúde Egas Moniz (ISCSEM),
Monte de Caparica, Portugal [5 years school training and the 6th
year of practice – community and hospital settings].
AndreiaBruno|CurriculumVitae
w Page5of13w
AssociativeExperience|2003to2010
2005/2006 President Núcleo de Estudantes de Ciências Farmacêuticas NECF (Local
Pharmaceutical Students’ Association) at ISCSEM.
2005/2006 Coordinator ‘Healthy Living and Diabetes’ Campaign, within the Sub-
Committee of Public Health of IPSF.
2004/2005 Vice-President Núcleo de Estudantes de Ciências Farmacêuticas NECF (Local
Pharmaceutical Students’ Association) at ISCSEM.
2004/2005 Coordinator Sub-Committee of Public Health of IPSF.
2003to2005 Contact Person Portuguese Pharmacy Students Association (APEF) in IPSF.
2003/2004 Coordinator Department of Education and Health Promotion (DEPS) of NECF at
ISCSEM.
2002to2006 Chair Organising Committee of diverse Health Campaigns at a national
and local level, such as, Healthy Living and Diabetes, Tobacco
Alert, HIV/Aids, World Health Day and Patient Council Event.
2002/2003 Member DepartmentofEducationandHealthPromotion(DEPS)ofNECFat
ISCSEM.
23rd to 26th of
August 2010
Member of the Organising
committee
16th International Social Pharmacy Workshop – “Communication
and Information in Pharmacy”, held in the Faculty of Pharmacy
University of Lisbon, Portugal.
28th and 29th of
November 2006
Member of the Organising
Committee
II Scientific Congress of the Portuguese Pharmacist Students
Association (APEF) – “Células Estaminais e Nanotecnologia - Novas
abordagens terapêuticas” [Stem Cells and Nanotechnology – New
therapeutic approaches], Portugal.
1st of July 2006 Chair of the Organising
Committee
VI Symposium of the Pharmacist Students Association (NECF) of
the ISCSEM – “Doenças Raras e Medicamentos Órfãos” [Rare
Diseases and Orphan Medicines], Monte de Caparica, Portugal.
8th of April 2005 Chair of the Organizing
Committee
V Symposium of the NECF of the ISCSEM – “Doenças Infecciosas”
[Infectious Diseases], Portugal.
25th and 26th of
November 2004
Member of the Organising
Committee
I Scientific Congress of APEF – “Farmacogenómica – O Amanhã das
Ciências Farmacêuticas” [Pharmacogenomics – The Tomorrow of
the Pharmaceutical Sciences], Lisbon, Portugal.
14th of
November 2003
Member of the Organising
Committee
IV Symposium of the NECF of the ISCSEM – “Do Genoma Humano às
Nanotecnologias – Novas Estratégias de Intervenção Terapêutica“
[From the Human Genome to Nanotechnology – New approaches
for Therapeutic Intervention], Monte de Caparica, Portugal.
Languages
>> Portuguese as mother language;
>> Fluent in both written and spoken English;
>> Very good knowledge of Spanish;
>> Basic knowledge of French.
Skills
>> Advance knowledge in Microsoft Windows and Apple
Mac OS environments and programmes. >> Good
knowledge in Adobe Photoshop and Dreamweaver
programmes and statistical programme SPSS.
AndreiaBruno|CurriculumVitae
w Page6of13w
Publications
2018
UdohA,BrunoA,BatesI.(2018)Asurveyofpharmacists’perceptionoffoundationlevelcompetenciesinAfricancountries.HumanResourcesforHealth16:16.DOI:https://doi.org/10.1186/s12960-018-0280-1
UdohA,BrunoA,BatesI,GalbraithK.(2018)Transnationalcomparabilityofadvancedpharmacypracticedevelopmentalframeworks:acountry-levelcrossovermappingstudy.InternationalJournalofPharmacyPractice.DOI:10.1111/ijpp.12427
BatesI.,JohnC.,SeegobinP.,BrunoA.(2018)Ananalysisoftheglobalpharmacyworkforcecapacitytrendsfrom2006to2012.HumanResourcesforHealth201816:3.DOI10.1186/s12960-018-0267-y.
2017
Bader L, Bates I, Schneider P, Charman W, Bruno A (editor), Carrasqueira J. (2017) Transforming Pharmacy and Pharmaceutical Sciences Education in the Context of Workforce Development. Fédération Internationale Pharmaceutique (FIP): The Netherlands. ISBN-978-0-902936-40-9. Available at: http://www.fip.org/publications#FIP-Education
2016
Bates I, John C, Bruno A, Fu P, Aliabadi S. (2016) An analysis of the global pharmacy workforce capacity. Human Resources for Health 2016. DOI 10.1186/s12960-016-0158-z.
Mucalo I, Hadžiabdić MO, Govorčinović T, Šarić M, Bruno A, Bates I. (2016) The Development of the Croatian Competency Framework for Pharmacists. Am J Pharm Educ, 2016; 80(8): article 134.
Bruno A, Bates I. (2016) Transforming our workforce | Workforce development and education: systems, tools and navigation. Fédération Internationale Pharmaceutique (FIP): The Netherlands. ISBN-13 978-0-902936-37-9. Available at: www.fip.org/educationreports
Boeckmann G, Duong N, Bruno A, Bates I. (2016) Transforming our workforce | Workforce development and education: systems, tools and naviagation | Part 2: Introduction. Fédération Internationale Pharmaceutique (FIP): The Netherlands. ISBN-13 978-0-902936-37-9. Available at: www.fip.org/educationreports
Bruno A, Bates I. (2016) Transforming our workforce | Workforce development and education: systems, tools and navigation | Part 3: Development of FIPEd resources – 3.4 Global Competency Framework (GbCF). Fédération Internationale Pharmaceutique (FIP): The Netherlands. ISBN-13 978-0-902936-37-9. Available at: www.fip.org/educationreports
Bruno A, Baião LR, Paulino E, Costa FA, Jacinto I, Horta R, Queirós S, Rosado H. (2016) An overview of current pharmacy impact on immunisation A global report 2016 | Part 3: Case studies – 3.7 Portugal. The Hague: International Pharmaceutical Federation. ISBN 978-0-902936-38-6. Available at: www.fip.org/publications
Pálsdóttir B, Barry J, Bruno A, Barr H, Clithero A, Cobb N, Maeseneer JD, Kiguli-Malwadde E, Neusy AJ, Reeves S, Strasser R, Worley P. (2016) Training for Impact: The socio-economic impact of a fit for purpose health workforce on communities. Human Resources for Health 2016. DOI 10.1186/s12960-016-0143-6
2015
Bruno A, Galbraith K, Bates I. (2015) Advanced Practice and Specialisation in Pharmacy: Global Report. Fédération Internationale Pharmaceutique (FIP): The Netherlands. ISBN 978-0-902936-33-1. Available at: www.fip.org/educationreports
Craddock K, Twillmann S, Galbraith K, Bruno A, Bates I. (2015) Advanced Practice and Specialisation in Pharmacy: Global Report | Part 2: Introduction. Fédération Internationale Pharmaceutique (FIP): The Netherlands. ISBN 978-0-902936-33-1. Available at: www.fip.org/educationreports
Bates I, Bruno A, Galbraith K. (2015) Advanced Practice and Specialisation in Pharmacy: Global Report | Part 3: Advanced Practice and Specialisation Description. Fédération Internationale Pharmaceutique (FIP): The Netherlands. ISBN 978-0-902936-33-1. Available at: www.fip.org/educationreports
Vilaça H, Baião L, Bruno A. (2015) Advanced Practice and Specialisation in Pharmacy: Global Report | Part 4: Trends and Innovations Case Studies – Portugal: Four recognised specialities. Fédération Internationale Pharmaceutique (FIP): The Netherlands. ISBN 978-0-902936-33-1. Available at: www.fip.org/educationreports
Bruno A, John C, Bates I. (2015) Global Pharmacy Workforce Intelligence: Trends Report. Fédération Internationale Pharmaceutique (FIP): The Netherlands. ISBN 978-0-902936-34-8. Available at: www.fip.org/educationreports
AndreiaBruno|CurriculumVitae
w Page7of13w
Bruno A, Boone J, Brock T. (2015) Interprofessional Education in a Pharmacy Context: Global Report. Fédération Internationale Pharmaceutique (FIP): The Netherlands. ISBN-13 978-0-902936-35-5. Available at: www.fip.org/educationreports
Almaghaslah D, Bruno A, Bates I. An evaluation of the global pharmacy workforce highlighting pharmacy human resource challenges for countries in the Gulf Cooperation Countries (GCC). Int. J. Pharm. Prac. 2015; 23: 23-105.
2014
Bruno A, Rouse M, Tofade T, Bates I. (2014) Continuing Professional Development/Continuing Education in Pharmacy: Global Report. Fédération Internationale Pharmaceutique (FIP): The Netherlands. Available at: www.fip.org/educationreports
Bates I, Bruno A. (2014) Continuing Professional Development/Continuing Education in Pharmacy: Global Report | Part 3: A Global Description of Continuing Professional Development/Continuing Education in Pharmacy. Fédération Internationale Pharmaceutique (FIP): The Netherlands. Available at: www.fip.org/educationreports
Altiere R, Anderson C, Bates I, Boone J, Brock T, Bruno A, Carrasqueira J, Galbraith K, Hindmarsh W, James S, Marriott J, Rennie T, Rouse MJ, Tofade T. (2014) Continuing Professional Development/Continuing Education in Pharmacy: Global Report | Part 5: CPD/CE Link with other FIP Education Initiative Activities. Fédération Internationale Pharmaceutique (FIP): The Netherlands. Available at: www.fip.org/educationreports
Bruno A, Rouse M, Meštrović A. (2014) Quality Assurance of Pharmacy Education: the FIP Global Framework. Fédération Internationale Pharmaceutique (FIP): The Netherlands. Available at: www.fip.org/educationreports
Anderson C, Marriott J, Carrasqueira J, Brock T, Rennie T, Bruno A, Bates I. (2014) Turning the World of Pharmacy Education into a Global Community Through Sharing. Am J Pharm Educ, 2014; 78(7): article 130.
Udoh A, Bruno A, Bates I. (2014) Developing the Global Pharmacy Workforce: An Opportunity for Stakeholders' Engagement in Africa. The African Pharmacist 2: 41-42.
Bruno A, Galbraith K, McKinnon R. (2014) Global Supply of Health Professionals. N Engl J Med, 370; 23, June 5. DOI: 10.1056/NEJMc1404326
Anderson C, Bates I, Brock T, Brock T, Brown A, Bruno A, Gal D, Galbraith K, Marriott J, Rennie T, J Rouse M, Toyin T. (2014) Highlights from FIPEd Global Education Report. Am J Pharm Educ, 2014; 78(1): article 4.
2013
Bruno A, Bates I, Gal D. (2013) FIPEd Global Education Report 2013. Fédération Internationale Pharmaceutique (FIP): The Netherlands. Available at: www.fip.org/educationreports
Bates I, Bruno A, Arakawa N. (2013) FIPEd Global Education Report 2013 | Part 3: Global Education Description. Fédération Internationale Pharmaceutique (FIP): The Netherlands. Available at: www.fip.org/educationreports
Anderson C, Bates I, Brock T, Brown A, Bruno A, Futter B, Gal D, Rennie T, J Rouse M. (2013) FIPEd Global Education Report 2013 | Part 5: Using FIP Education Initiative Resources and Networks to Implement Education Change. Fédération Internationale Pharmaceutique (FIP): The Netherlands. Available at: www.fip.org/educationreports
Wehrli A, Bruno A, Gal D, Marriott J, van der Spek O. (2013) FIP's contributions to the sharing of expertise and resources in the pharmacy profession. Shifa Clin Pharm Quarterly News Letter, Apr-Jun 2013: Vol 3, Issue 2.
2012
Brown AN, Gilbert B, Bruno AF (2012) Development of an Essential Medicine Supply Competency Framework for Primary Healthcare Personnel: Participatory Action Research. International Journal of Nursing, 2012: I (2), 13-24.
Brown A, J Gilbert B, F Bruno A, M Cooper G. (2012) Validated Competency Framework for Delivery of Pharmacy Services within Pacific-Island Countries. J Pharm Pract Res 2012; 42: 268-272.
Bruno A. (2012) UKCPA joins partnership to move forward with credentialing agenda. In Practice October 2012; Volume 44 Issue 2.
Bruno A, Bates I. (2012) Global Competency Framework version 1 (GbCF). Fédération Internationale Pharmaceutique (FIP): The Netherlands. Available at: https://www.fip.org/files/fip/PharmacyEducation/GbCF/GbCF_v1_online_A4.pdf
Gal D, Bates I, Bruno A, Whitmarsh S. (2012) FIP Global Pharmacy Workforce Report 2012. Fédération Internationale Pharmaceutique (FIP): The Netherlands. Available at: www.fip.org/educationreports
Bates I, Bruno A. (2012) FIP Global Pharmacy Workforce Report 2012 | Part 3 Global Pharmacy Workforce Description. Fédération Internationale Pharmaceutique (FIP): The Netherlands. Available at: www.fip.org/educationreports
AndreiaBruno|CurriculumVitae
w Page8of13w
Anderson C, Bates I, Brock T, Brown A, Bruno A, Futter B, Gal D, Rennie T, J Rouse M. (2012) FIP Global Pharmacy Workforce Report 2012 | Part 4 Pharmacy Education. Fédération Internationale Pharmaceutique (FIP): The Netherlands. Available at: www.fip.org/educationreports
Anderson C, Bates I, Brock T, Brown A, Bruno A, Futter B, Rennie T, J Rouse M. (2012) Needs-Based Education in the Context of Globalization. Am J Pharm Educ, 2012; 76(4): article 56.
Mestrovic A, Stanicic Z, Hadziabdic M, Mucalo I, Bates I, Duggan C, Carter S, Bruno A, Kosicek M. (2012) Individualized Education and Competency Development of Croatian Community Pharmacists Using the General Level Framework. Am J Pharm Educ, 2012; 76(2): article 23.
2011
Wehrli A, Bruno A, Gal D, Marriott J, van der Spek O. (2011) FIP's contributions to the sharing of expertise and resources in the pharmacy profession. Institute of Pharmaceutical Education and Research (RIPER) PDIC Bulletin, December 2011; 2 (17). www.riperjournals.org
Mestrovic A, Stanicic Z, Hadziabdic M, Mucalo I, Bates I, Duggan C, Carter S, Bruno, A. (2011) Evaluation of Croatian Community Pharmacists' Patient Care Competencies Using the General Level Framework. Am J Pham Educ. Vol 75(2): 36.
Modi, D, Bruno A. (2011) Moving On: Improving Pharmacy Education Globally. EPSA NewsLetter. Vol 18 (3): 30.
2010
Bruno A, Bates I, Brock T, Anderson C. (2010) Towards a Global Competency Framework. Am J Pharm Educ. 74(3): p. 56
Bruno A, Bates I. (2010) Moving On II Project – International Trends in Pharmacy Education. IPSF News bulletin. Vol 60.
Bruno A, Bates I. (2010) A Look Into the Future – Where is Pharmacy Education Heading Globally. Phuture IPSF Education Supplement. Vol 16: 13.
2009
Anderson C, Bates I, Bruno A, Futter B, Rouse M, Whitmarsh S. (2009) Part 4: Pharmacy Education of the 2009 FIP Global Pharmacy Workforce Report (Edited by Wuliji, T.).
Bruno A, Jones S, Jubraj B. (2009) Continuing Professional Development (CPD) in Pharmacy Practice: Is it really about learning to learn or legislating learning? Int Pharm J. Vol 25: 20-25.
2008
Bates I, Bruno A. (2008) Competence in the Global Pharmacy Workforce. A discussion paper. Int Pharm J. Vol 23: 30-33.
AndreiaBruno|CurriculumVitae
w Page9of13w
KeyNote,PostersandInvitedPresentations
2018
Conference abstract accepted - Bruno A, Hussainy S, Abeyaratne C, Warden R, Cogley V, Wood S. Global pharmacist: using the world cafe method to enhance learning about professional organisations. International Pharmaceutical Federation (FIP) World Congress of Pharmacy and Pharmaceutical Sciences. Glasgow, UK (September 2018).
Conference abstract accepted - Bruno A, Brock T, Galbraith K, Kirkpatrick C, Larson I. How to you PWDG? International
Pharmaceutical Federation (FIP) World Congress of Pharmacy and Pharmaceutical Sciences. Glasgow, UK (September 2018). Simple reflection and feedback models: experiences of first year students and their academic coaches. Bruno A, Chohan A,
Galbraith K, Brock TP, Short J. Speaker at the 12th International Conference, Life Long Learning in Pharmacy, Brisbane, Australia 6th to 9th of July 2018.
Skills coaching program – how to do it? Bruno A, Galbraith K, Brock TP. Workshop presenter and facilitator at the 12th International Conference, Life Long Learning in Pharmacy, Brisbane, Australia 6th to 9th of July 2018.
Vertical Integrated Master’s | A new approach to pharmacy education. Bruno A. Invited speaker at the Third Croatian Pharmacy and Medical Biochemistry Students’ Association’s Virtual PharmCon, Croatia, 12th of April 2018.
Pharmacy program in Monash University | VIM. Bruno A. Invited speaker at International Conference on “Practical training and pharmacist practice in Vietnam - present and future, Hanoi, Vietnam, 13th of April 2018.
Pharmacy education via competencies: conception and practice (Educação Farmacêutica por competências: concepção e prática). Bruno A. Invited speaker at the Webinar of SIG of Pharmaceutical Care - in portuguese - Brazil, 13th of April 2018.
Pharmacist capacity (globally and) in Australia. Bruno A. Invited speaker at International Conference on “Practical training and pharmacist practice in Vietnam - present and future, Hanoi, Vietnam, 14th of April 2018.
Workforce Development Goals: Aligning innovations to support sustainable development era. Bruno A. Keynote invited speaker at the 44th SHCP International Research Conference, Cebu, Philippines, 9th of February 2018.
2017
SHPA doing more: technician role redesign. Bruno A. Invited speaker at the 43rd SHPA National Conference, Medicines Management, Sydney, Australia, 16th to 19th of September 2017.
Go glocal: Implementing the global FIP PWDGs locally. Bruno A. Invited speaker for the International Pharmaceutical Students’ Federation webinar, 4th of December 2017.
The FIP Competency Framework. Bruno, A. Invited speaker at the 77th World Congress of Pharmacy and Pharmaceutical Sciences, FIP, Seoul, Republic of Korea, 10th to 14th of September 2017.
Call for action - Global conference on pharmacy and pharmaceutical sciences education outcomes. Bruno A, Bates I, Brock T, James S, Larson I, Boone J, Galbraith K, Rouse M, Tofade T, Anderson C, Carrasqueira J, Bader L. Speaker at the 77th World Congress of Pharmacy and Pharmaceutical Sciences, FIP, Seoul, Republic of Korea, 10th to 14th of September 2017.
Vertical integrated master’s - A new approach to pharmacy education. Bruno A, Mak V, Brock T, Kirkpatric C, Larson I, Galbraith K. Speaker at the 77th World Congress of Pharmacy and Pharmaceutical Sciences, FIP, Seoul, Republic of Korea, 10th to 14th of September 2017.
Using the WHO 7-Star Pharmacist Model to encourage first year students to embrace being a pharmacist in training. Mak V, Bell SJ, Bruno A, Abeyaratne C, Bosch D, Jokanovic N, Lalic S, Kirkpatrick C. Poster presentation at the 77th World Congress of Pharmacy and Pharmaceutical Sciences, FIP, Seoul, Republic of Korea, 10th to 14th of September 2017.
The science behind a competent professional juggler. Bruno A. Invited speaker for the EuRo Pharmacy Science Week, International day of Women and Girls in Science, IPSF Webinar, 21st of February 2017.
2016
The EAHP statements and the CTF: How to get the needed competencies. Bruno, A. Invitedspeakeratthe37thSIFONationalCongress,Milan,Italy,1stto4thofDecember,2016.
Education and development tools: A user guide | 2016 technical report launch “Transforming our workforce”. Bruno, A. Invited speaker at the 76th World Congress of Pharmacy and Pharmaceutical Sciences, FIP, Buenos Aires, Argentina, 28th of August to 1st of September 2016.
AndreiaBruno|CurriculumVitae
w Page10of13w
Enseñanza de la carrera de farmacia orientada a las nuevas necesidades regionales y locales. Bruno, A. Invited speaker at the XXII Congreso Farmacéutico Argentino, Buenos Aires, Argentina, 29th of August 2016.
AIM: Dean’s Forum | 2016 technical report pre-launch “Transforming our workforce”. Bruno, A. Invited speaker at the 76th World Congress of Pharmacy and Pharmaceutical Sciences, FIP, Buenos Aires, Argentina, 28th of August to 1st of September 2016.
Practice-driven restructuring of the pharmacy curricula: fcus on advanced services. Alves da Costa F, Cotrim H, Faria F, Bruno A, Gomes P. Poster presentation at the 2016 Pharmaceutical Care Network Europe, 19-20 February 2016, Hillerod, Denmanrk. In J Clin Pharm. DOI 10.1007/s11096-016-0283-8.
2015
Los Proyectos Globales de Educacio ́n Farmace ́utica. Bruno A. Invited speaker at III Reunio ́n - La Triple He ́lice en Farmacia, Mexico City, Mexico, 12th of November 2015.
Modelo de Competências Farmacêuticas da Ordem dos Farmacêuticos. Bruno A. Invited speaker at Congresso Nacional de Farmácia | CNF’15, Lisbon, Portugal, 31st of October 2015.
Modelos de Competências em Farmácia Hospitalar na Europa e no Mundo. Bruno A. Invited speaker at Congresso Nacional de Farmácia | CNF’15, Lisbon, Portugal, 30st of October 2015.
The global competency framework, the Basel Statements and a need to develop advanced competencies – is a global framework achievable? Bruno, A. Invited speaker at the 75th World Congress of Pharmacy and Pharmaceutical Sciences, FIP, Dusseldorf, Germany, 29th of September to 3rd of October 2015.
Global context for discussion of Interprofessional education: WHO Transformative Education Movement. Bruno, A. Invited speaker at the 75th World Congress of Pharmacy and Pharmaceutical Sciences, FIP, Dusseldorf, Germany, 29th of September to 3rd of October 2015.
The FIP Education Initiative: Get involved | Competency (foundation level). Bruno, A. Invited speaker at the 75th World Congress of Pharmacy and Pharmaceutical Sciences, FIP, Dusseldorf, Germany, 29th of September to 3rd of October 2015.
The FIP Education Initiative: Get involved | Pharmacy Education Journal. Bruno, A. Invited speaker at the 75th World Congress of Pharmacy and Pharmaceutical Sciences, FIP, Dusseldorf, Germany, 29th of September to 3rd of October 2015.
The FIP Education Initiative: Get involved | Refreshing the Education vision, with WHO – Transformative Education. Bruno, A. Invited speaker at the 75th World Congress of Pharmacy and Pharmaceutical Sciences, FIP, Dusseldorf, Germany, 29th of September to 3rd of October 2015.
International Pharmaceutical Federation Education Initiative (FIPEd). Bruno A. Invited speaker at the AACP webinar, USA, 20th of August 2015.
O Farmacêutico no Mundo - Estender Fronteiras, Expandir Horizontes - Vou… e agora? Bruno A. Invited speaker at the XIX Seminário AEFFUL, Lisbon, Portugal, 11th of May 2015.
Carreiras Internacionais – Experiências. Bruno A. Invited speaker at the XXI Jornadas de Ciências Farmacêuticas, ISCSEM, Costa de Caparica, Portugal, 6th of May 2015.
O Farmacêutico no Mundo – da educação à profissão. Bruno A. Invited speaker at the XVI Jornadas de Ciências Farmacêuticas CESPU-ISCSN, Porto, Portugal, 24th of April 2015.
Udoh A, Bruno A, Bates I. (2015). Evaluating Advanced Pharmacy Practice Competencies in a Global Context. Abstract and PhD day presentation, 24th April 2015, UCL school of Pharmacy.
Ser cidadão europeu: estudantes, farmacêutico e utente. Bruno A. Invited speaker at the XIV Forum Educacional APEF, Lisbon, Portugal, 28th of February 2015.
Competências do Farmacêutico na actualidade. Bruno A. Invited speaker at the Forum Educativo 100 Anos Depois Pensamos o Futuro AEFFUL, Lisbon, Portugal, 15th November 2015.
2014
Estruturação do Currículo Farmacêutico com base nas competências; Atividades Clínicas do Farmacêutico: Experiências de Portugal. Bruno A. Invited speaker at the 1º Congresso Brasileiro de Assitências Farmacêutica e Farmácia Clínica, Fortaleza, Brazil, 13th to 15th of October 2014.
Tofade T, Rouse M, Bruno A. (2014). Poster presentation: Quality Assurance of Pharmacy Education: the FIP Global Framework Version 2. 74th International Pharmaceutical Federation (FIP) World Congress, August 31 to September 4, Bangkok, Thailand.
AndreiaBruno|CurriculumVitae
w Page11of13w
Arit U, Bruno A, Galbraith K, Bates I. (2014). Poster presentation: Developing and Evaluating Advanced Pharmacy Practice Competencies in a Global Context. 74th International Pharmaceutical Federation (FIP) World Congress, Bangkok, Thailand, Aug 31 to September 4.
Arakawa N, Bruno A, Bates I. (2014). Poster presentation: A Global Comparison of Initial Pharmacy Education Curricula. 74th International Pharmaceutical Federation (FIP) World Congress; 2014 Aug 31 to September 4; Bangkok, Thailand.
Arakawa N, Bruno A, Bates I. (2014). Poster presentation: Students’ Approaches to Learning in Pharmacy: A Global Survey. 74th International Pharmaceutical Federation (FIP) World Congress; 2014 August 31 to September 4; Bangkok, Thailand.
Almaghaslah D, Bruno A, Bates, I. (2014). Poster presentation: A qualitative Comparative Study of Service Development in Two Gulf States. 74th International Pharmaceutical Federation (FIP) World Congress, Bangkok, Thailand, Aug 31 to Sep 4, 2014.
Tofade T, Rouse M, Bruno AF, Bates I. (2014) Poster presentation: What FIPEd is Doing Regarding CPD/CE Initiatives Globally. 74th International Pharmaceutical Federation (FIP) World Congress, Bangkok, Thailand, August 31 to September 4, 2014.
John C, Bruno A, Bates I. (2014) Poster presentation: Global Pharmacy Workforce Observatory. 74th International Pharmaceutical Federation (FIP) World Congress, Bangkok, Thailand, August 31 to September 4, 2014.
The FIP Education Initiative: Progress and Challenges | Competency (foundation level). Bruno, A. Invited speaker at the 74th World Congress of Pharmacy and Pharmaceutical Sciences, FIP, Bangkok, Thailand, 31st of August to 4th of September 2014.
Transforming the health care workforce: WHO, GHWA and FIP. Bruno, A. Invited speaker at the 74th World Congress of Pharmacy and Pharmaceutical Sciences, FIP, Bangkok, Thailand, 31st of August to 4th of September 2014.
Core Competency Framework for Pharmacists. Bruno, A. Invited speaker at the 60th International Pharmaceutical Students’ Federation World Congress, Oporto, Portugal, 31th of July to 9th of August 2014.
Deeper Insights of the Competency Framework for Pharmacists. Bruno, A. Invited workshop presenter and moderator at the 60th International Pharmaceutical Students’ Federation World Congress, Oporto, Portugal, 31th of July to 9th of August 2014.
Projects between FIPEd and IPSF: How to engage? Bruno, A. Invited workshop presenter and moderator at the 60th International Pharmaceutical Students’ Federation World Congress, Oporto, Portugal, 31th of July to 9th of August 2014.
Research Methodology for the Future Pharmacists. Bruno, A. Invited workshop presenter and moderator at the 60th International Pharmaceutical Students’ Federation World Congress, Oporto, Portugal, 31th of July to 9th of August 2014.
Tofade T, Rouse M, Bates I, Bruno A.F, and FIPEd Members. (2014). Poster presentation: Developing a global strategy for professional education: Evidence First? 10th BiAnnual Lifelong Learning Conference in Pharmacy June 2014. Orlando, Florida.
Pharmaceutical Services, Rational Use of Medicines, and Regulatory Curriculum: Challenges and Opportunities for the Pharmacy Curricula. Bruno, A. Invited speaker at the IX Pan American Conference on Pharmaceutical Education, Baltimore, Maryland, USA, 2nd to 4th of June 2014.
FIP UNESCO-UNITWIN Country Case Studies Summit | Development of the Centre of Excellence for Africa. Organiser and presenter. Lusaka, Zambia, 10th and 11th of May 2014.
Fostering the relationships between the FIPEd and Japanese organisation; FIPEd works - Competency-based education and training; Addressing current global themes in pharmacy practice: an FIP workshop. Bates I, Bruno, A. Several presentations and workshops as invited speaker, workshop presenter and moderator during a visit to Japan organised by the Japanese Pharmaceutical Organisation, Josai University, Kanagawa Pharmaceutical Association and Ueda Pharmaceutical Association, Japan, 24th to 27th of June 2014.
PSWC Educational Day. Bates I, Bruno, A. Invited workshop organiser, presenter and moderator at the 5th Pharmaceutical Sciences World Congress, Melbourne, Australia, 12th of April 2014.
Almaghaslah D, Bruno A, Bates, I. (2014). Poster presentation: Pharmacy Workforce in the Gulf Countries.4th Pharmaceutical Care Conference, Oman, 22nd to 24th of February 2014.
Anderson C, Bates I, Besançon L, Brock T, Brown A.N, Bruno A.F, Gal D, Galbraith K, Marriott J, Rouse M, andFIPEd Members. Poster presentation: Capability, capacity and scope - Developing and applying the tools needed for transformative education, optimising access to and use of essential medicines worldwide. Prince Mahidol Award Conference 2014 – Transformative Learning for Health Equity, 27-32 Januray 2014, Pattaya, Thailand.
2013
AndreiaBruno|CurriculumVitae
w Page12of13w
Universal health coverage – improving access and outcomes through responsible medicines use | Access to a pharmacist: Ensuring competency of the pharmacy workforce. Bruno, A. Invited speaker at one of the side events of the Third Global Forum on Human Resources for Health, Recife, Brazil, 9th to 13th of November 2013.
Pharmacy education in FIP: The journey so far… | Competency (foundation level). Bruno, A. Invited speaker at the 73rd World Congress of Pharmacy and Pharmaceutical Sciences, FIP, Dublin, Ireland, 31st of August to 5th of September 2013.
Pharmacy Workforce in the Gulf Countries. Almahaslah, D., Bates, I. and Bruno, A. Poster presentation at the 73rd World Congress of Pharmacy and Pharmaceutical Sciences, FIP, Dublin, Ireland, 31st of August to 5th of September 2013.
Developing Foundation Level Pharmacy Practice Competencies in an African Context. Udoh, A., Bates, I. and Bruno, A. Poster presentation at the 73rd World Congress of Pharmacy and Pharmaceutical Sciences, FIP, Dublin, Ireland, 31st of August to 5th of September 2013.
Students Learning Experience Questionnaire. Arakawa, N., Bates, I. and Bruno, A. Poster presentation at the 73rd World Congress of Pharmacy and Pharmaceutical Sciences, FIP, Dublin, Ireland, 31st of August to 5th of September 2013.
Educación Farmacéutica: Competencias Para el Desarollo Profesional y la Provisión de Servicios Farmacéuticos. Bruno A. Invited plenary presenter (via webinar) at the Seminario “Desafíos de la formación de profesionales Farmacéuticos en un Mundo Globalizado”, Faculta de Farmacia, Playa Ancha, Valparaíso, Chile, 22nd August 2013.
Research Methodology for the Future Pharmacists. Bruno, A. and Arakawa, N. Invited workshop presenter and moderator at the 59th International Pharmaceutical Students’ Federation World Congress, Utrecht, The Netherlands, 30th of July to 10th of August 2013.
Competency Frameworks. Bruno A. Invited plenary presenter at the 36th European Pharmaceutical Student’s Association (EPSA) Annual Congress, Catania, Italy, 23rd of April 2013.
Deeper insights into competency frameworks. Bruno A. Invited workshop presenter and moderator at the 36th European Pharmaceutical Student’s Association (EPSA) Annual Congress, Catania, Italy, 23rd of April 2013.
FIP Country Case Studies Summit. Organiser and presenter. Accra, Ghana, 2nd and 3rd of March 2013.
2012
Are you fit for the practice ahead? Bruno A. Invited workshop presenter and moderator at 5th Annual National Congress of Pharmacy Students Association of Serbia (NAPSer), Zlabitor, Serbia, 5th December 2012.
Competency-based education: The academic argument. Bates I, Bruno, A, J Rouse M. Invited speaker at the 72nd World Congress of Pharmacy and Pharmaceutical Sciences, FIP, Amsterdam, The Netherlands, 4th to 8th of October 2012.
A global framework for a competent workforce: Evidence from FIPEd. Brown A, Bruno, A. Invited speaker at the 72nd World Congress of Pharmacy and Pharmaceutical Sciences, FIP, Amsterdam, The Netherlands, 4th to 8th of October 2012.
IPSF Learning Experience Database. Bruno A. Invited speaker at the 72nd World Congress of Pharmacy and Pharmaceutical Sciences, FIP, Amsterdam, The Netherlands, 4th to 8th of October 2012.
Global Students’ Learning Experience. Bruno A, Arawaka N, Bates I. Poster presentation at the 72nd World Congress of Pharmacy and Pharmaceutical Sciences, FIP, Amsterdam, The Netherlands, 4th to 8th of October 2012.
Motivations & Reasons for Studying Pharmacy: FIPEd PET-IPSF Student Learning Experience Questionnaire. Arakawa N, Bruno A. Invited workshop presenter and moderator at the 58th International Pharmaceutical Students’ Federation World Congress, Hurghada, Egypt, 1st to 10th of August 2012.
Advances in Pharmaceutical Sciences and Practice towards a Better Future. Bruno A. Invited plenary presenter at the 58th International Pharmaceutical Students’ Federation World Congress, Hurghada, Egypt, 1st to 10th of August 2012.
Global Education Initiatives. Bruno A, Rouse M. Invited speaker at the VIII Pan-American Conference on Pharmacy Education, Habana, Cuba, 8th to 10th of July 2012.
Student Learning Experience – Comparison between Europe and Other Regions. Bruno A, Modi D, Pereira F, Beltagy M, Lesko Myriah, Bates I. Poster presentation at the 18th EAFP Annual Conference, Utrecht, The Netherlands 24th to 26th of May 2012.
1st FIP Webinar on the Draft Global Competency Framework. Bates, I., Bruno, A. 27th of March 2012.
Reflectir fora do rectângulo - Competências e Perspectivas. Bruno, A. Invited as a key speaker at Ciclo de Conferências de 2012, Seccão Regional de Coimbra Ordem dos Farmacêuticos, Coimbra, Portugal, 5th of March 2012.
Bruno, A. Invited speaker at Melbourne, Brisbane, Canberra, Australia, 14th to 28th of February 2012.
AndreiaBruno|CurriculumVitae
w Page13of13w
Especialidades Baseadas em Competências. Bruno, A. Invited panellist and presenter at Conselho Nacional Farmacêutico, Lisbon, Portugal, 4th of February 2012.
2011
Patient Care Competencies – how to make a self-assessment? Meštrović, A., Bruno, A. Invited workshop presenter and moderator at the 40th Annual European Symposium - European Society of Clinical Pharmacy (ESCP), Dublin, Ireland, 18th to 21st of October 2011.
Validating Global Competencies for Pharmacy Education. Bruno, A., Bates, I., Brock, T. Poster presentation at the 71st World Congress of Pharmacy and Pharmaceutical Sciences, FIP, Hyderabad, India, 4th to 8th of September 2011.
Assessing the status of pharmacy education globally: what information should be regularly collected and analysed at the global level? Gal, D., Chan, X., Bailey, R., Anderson, C., Bruno, A., Brock, T., Rouse, M. Poster presentation at the 71st World Congress of Pharmacy and Pharmaceutical Sciences, FIP, Hyderabad, India, 4th to 8th of September 2011.
Developing Consensus on Foundation Level Competencies in a Global Competency Framework. Bruno, A., Bates, I., Brock, T., Brown, A. Oral presentation at the Lifelong Learning in Pharmacy, Rotorua, New Zealand, 29th of June to 2nd of July 2011 (Andrew Brown presented on my behalf).
Validação de Competências Globais para Farmácia Comunitária e Hospitalar. Bruno, A., Bates, I., Brock, T. Poster presentation at IV Congresso Ibero-Americano de Ciências Farmacêuticas, Lisbon, Portugal, 21st to 23rd of June 2011.
2010
A Global Survey of Pharmacy Workforce Competency Frameworks. Bruno, A., Bates, I., Brock, T. Poster presentation at the 70th World Congress of Pharmacy and Pharmaceutical Sciences, FIP, Lisbon, Portugal, 28th August to 2nd of September 2010.
Synthesising Practitioner Competencies in a Global Context. Bruno, A., Bates, I., Brock, T. Invited speaker at the 70th World Congress of Pharmacy and Pharmaceutical Sciences, FIP, Lisbon, Portugal, 28th August to 2nd of September 2010.
Developing a Global Competency Framework. Bruno, A., Bates, I., Brock, T. Invited speaker at the 70th World Congress of Pharmacy and Pharmaceutical Sciences, FIP, Lisbon, Portugal, 28th August to 2nd of September 2010.
Continuing Professional Development - what are ‘we’ doing for revalidation? Jones, S., Bruno, A., Jubraj, B., Bates, I. Workshop presenter and moderator at the 16th International Social Pharmacy Workshop, Lisbon Portugal, 23rd to 26th of August 2010.
Leadership in practice: Working in a team - Understanding ourselves and others. Bates, I., Bruno, A., Duggan, C., Knez, L. Workshop presenter and moderator at the 56th International Pharmaceutical Students’ Federation World Congress, Ljubljana, Slovenia, 2nd to 12th of August 2010.
2009
Towards a Global Pharmacy Competency Framework. Bruno, A., Bates, I., Brock, T. Poster presentation when the HRH Princess Anne visited The School of Pharmacy, University of London, 14th of May 2009.
2008
Competency - Culture Workshop Preliminary Report. Bruno, A., Bates, I., Brock, T. Invited speaker at the 68th World Congress of Pharmacy and Pharmaceutical Sciences, FIP, Basel, Switzerland, 29th of August to 4th of September 2008.
FIP Pharmacy Education Consultation Report on the Competency Domain. Bruno, A., Bates, I., Brock, T. Invited speaker at the 68th World Congress of Pharmacy and Pharmaceutical Sciences, FIP, Basel, Switzerland, 29th of August to 4th of September 2008.
Moving On II - International demographic trends in pharmacy education. Bates, I., Bruno, A. Invited workshop moderator at the 54th International Pharmaceutical Students’ Federation World Congress, Cluj-Napoca, Romania, 1st to 11th of August 2008.
Key Competences of Pharmacy Students. Laaksonen, R., Stupariu, I., Bruno, A. Invited workshop facilitator at the 54th International Pharmaceutical Students’ Federation World Congress, Cluj-Napoca, Romania,1st to 11th of August 2008.
Competency - towards a culturally inert understanding. Bruno, A., Anderson, C., Stupariu, I., Bates, I., Brock, T. Workshop presenter and moderator at the 15th International Social Pharmacy Workshop, Queenstown, New Zealand, 8th to 11th of July 2008.
Professionalism or Professional Development. Bruno, A., Bates, I., Invited workshop presenter and moderator at the 54th International Pharmaceutical Students’ Federation World Congress, Cluj-Napoca, Romania, 1st to 11th of August 2008.
