100
WINTER ACTIVITY GUIDE 2015 Kamloops Parks, Recreation & Cultural Services AQUATICS REGISTRATION DECEMBER 9 th AT 7:30 AM GENERAL REGISTRATION DECEMBER 10 th AT 7:30 AM Canada’s Tournament Capital

City of Kamloops Winter Activity Guide

Embed Size (px)

DESCRIPTION

Published by Kamloops This week

Citation preview

Page 1: City of Kamloops Winter Activity Guide

WINTERACTIVITY GUIDE 2015

Kamloops Parks, Recreation & Cultural Services

AQUATICS REGISTRATION DECEMBER 9th AT 7:30 AM

GENERAL REGISTRATION DECEMBER 10th AT 7:30 AMCanada’s Tournament Capital

Page 2: City of Kamloops Winter Activity Guide

• Check out your local library• Cuddle up with a good book• Write a letter to a friend, grandparent, or cousin

• Play a board game with your family

• Go hiking, toboganning, or for a walk

• Play a new card game• Help make supper or bake cookies

• Make a craft, play with clay, or paint a picture

• Read a newspaper or a magazine

Family Literacy WeekJanuary 20-27, 2014

presents

Thanks to our Partners

• City of Kamloops• PacificSport• School District No. 73• Kamloops Honda

• Boys & Girls Club of Kamloops• KELLI• Make Children First• TNRD Library System

Find a h

ealth

y balan

ce... Find a healthy balance... Find a healthy balance... Find a healthy balance... Find a healthy b

alance... Find a healthy balance... Fin

d a

health

y b

ala

nce

... Fin

d a

health

y b

ala

nce

... Find a healthy balance... Find a healthy balance...

Find a healthy balance... Find a healthy balance... Find a healthy b

al

ance

...

Fin

d a

hea

lthy balance...

January 3-31Heap the Honda-Children’s Book Drive

Bring a Children’s Book to the Blazers Game-Jan 17

Wednesday, January 28Play Again Documentary at

Paramount Theatre 7pm

Tuesday, January 27Celebrate National Family Literacy Day

Drop Everything and Read D.E.A.R.

Saturday, January 317th Annual ABC Family Literacy Day

Henry Grube Education Centre 9:00am - 12:30pm

Get Unplugged TodayBuild a Snowman / Enjoy a good book / Paint a picture / Bake cookies / Write a letter

Play a board game / Go tobogganing / Read a magazine / Check out the museum

January 24-31, 2015

Find a healthy balance

Full Event Details:www.literacyinkamloops.com

Page 3: City of Kamloops Winter Activity Guide

1kamloops.ca/recreation 250.828.3500 1kamloops.ca/recreation 250.828.3500

Table of ConTenTsservices & InformationHow to Register 2Useful Contact Information 3Tournament Capital Centre 4

Community ResourcesAffordable Recreation 6Community Associations 7Community Committees 8Grants and Resources 9

ProgramsAccessible Recreation 10Aquatics 12 •SwimLessons 14 •Lifeguard&Swim

Instructor Training 17Family 20Early Years 24Children 28Youth 32Parks&TotLots 34Adult 36Schedules*Pull out section 45Adult 55+ 55PacificSport 60

There are many wonderful health benefits to being WinterActive.Spending timeoutdoors in thewinter sunand thecold&crispairis so beneficial to our body, spirit and overallwell being.Outdooractivitiesgivepeopleawonderfulsenseofconnectiontotheoutdoorenvironment.Thebenefitsofnaturallightandfreshairservetonotonly improve physical health, but also enhances our spiritual andemotionalhealth.Thereisaninnateconnectiontotheenvironmentthat begins to occur when the body is exposed to the elements Being outdoorsinthewinterissimplyinvigoratingandrevitalizing.

According toLauraineMyers, research indicateskey facts tobeingoutdoors in the winter:

Outdooractivitiesarede-stressingandcontributestoan overallhealthywellbeing.

Balances hormones and promotes weight loss

Raises metabolism to compensate for your body adjusting to temperature

Anexcellentwaytostrengthenyourheartyearround,as well as increase respiratory response

Exposuretonaturalareasincreasespositiveemotionswhile negativeemotionsdecrease-eventhosewinterblahs.

*adaptedfromTheExaminer,LauraineMyers.

Thewinteractivityguide featuresmany indoorprograms,butalsoincludesseveralideasonunpluggingandplayingoutside.Checkoutpages30-31foralistofparksandtotlotsinyourcommunity.

Get outside, be active, and be healthy!

This guide is published by

Be kind to our communityPlease recycle this guide!

WinteraCTIve

Page 4: City of Kamloops Winter Activity Guide

neW start Time

2

We heard you... Basedonyourvaluedfeedbackwemadeimprovementstoserveyoubetter:

Places to registerTournament Capital Centre910 McGill RoadMontoFri: 5:30am-10:30pmSat&Sun: 6:30am-9:00pm

Interior savings Centre300 Lorne StreetMontoFri: 8:30am-12:00pm 1:00-4:30pm

Kamloops Museum & archives207 Seymour StreetTuetoSat: 9:30am-4:30pm

Westsyde Pool & Community Centre859 Bebek RoadMon/Wed/Fri: 12:00-7:30pmTue&Thur: 3:00-7:00pm

Registration TipsA registration account is required to register for our programs New accounts should be created prior toregistrationday.Call828-3500orvisitoneofour‘PlacestoRegister’ listed to the left

A‘FamilyPIN’and‘ClientNumber’ is required to register online.Visitkamloops.ca/ezregtouse‘ForgotClientorPIN’servicepriortoregistrationday.

Keepusup-to-datewithyourcurrent contact information so wecanadviseyouofimportantprogram changes or updates

Refund/Withdrawal Policy•A$10administrationfeewillbechargedforallprogramwithdrawals,excluding memberships Check each programforspecificrefundpolicies.

•Onceaprogrambegins,apro-ratedrefund minus the administration fee will be applied

Cancellations•Programsmaybecanceledifnotenoughpeopleareregistered,sopleaseregisterearlytoavoiddisappointment!

•Mostprogramsareplannedtorunregardlessoftheweather;however,occasionallywemayhavetocancela program due to poor weather If yourprogramiscanceled,youareissued a refund

aquatics Registration beginsDeCeMbeR 9, 2014

at 7:30 am

General Registration beginsDeCeMbeR 10, 2014

at 7:30 am

HoW To ReGIsTeR...

3 Ways To ReGIsTeR

by PhoneCall our Customer Relations

Representativesat250-828-3500

In PersonVisit any of the

locationslistedabove.

onlineVisit our ezReg website at

kamloops.ca/ezreg

services & information

*7:30 start time applies to registrations made online, by phone and in person at TCC.

NEW7:30amregistrationstarttime Upgraded registration computer system Enhanced online registration (EZ Reg) Additional TeleReg support on registration day

Page 5: City of Kamloops Winter Activity Guide

3kamloops.ca/recreation 250.828.3500

Program RegistrationOnline kamloops.ca/ezregTelephone 250 828 3500

administrationFacility Bookings 250 828 3600General Inquiry 250 828 3400Adopt-a-Road 250 828 3400

aquaticsOnline kamloops.ca/swimEmail swim@kamloops caCanada Games Aquatic Centre 250 828 3655 Fax: 250 828 3643WestsydePool&CommunityCentre 250 828 3616

Interior savings Centre & arenasOnline kamloops.ca/arenasEmail skate@kamloops caArena Bookings 250 828 3335Blazer’sBoxOffice 250 828 3339Ticketmaster(ConcertSales) 1 855 985 5000

Kamloops Museum & archivesOnline kamloops.ca/museumEmail museum@kamloops caPhone 250 828 3576

PacificSport Interior BCOnline pacificsportinteriorbc.comEmail [email protected] 250 828 3344OperationRedNose 250 320 0650

ParksOnline kamloops.ca/parksEmail parks@kamloops caPhone 250 828 3551

Recreation, fitness, arts & Cultural ProgramsOnline kamloops.ca/recreationEmail recreation@kamloops ca [email protected] [email protected] 250 828 3655

Tournament Capital CentreEmail tcc@kamloops caOnline tournamentcapital comPhone 250 828 3655KamloopsClassicsSwimming 250 828 3660Kamloops Gymnastics &TrampolineCentre 250 374 6424SageSportInstitute 250 314 5000TCCSwim&FitnessShop 250 372 5305TRU Athletics 250 828 5009

Follow us on Facebook for up to date eventandfacilityinformation.facebook.com/cityofkamloopsfacebook.com/kamloopsaquaticsfacebook.com/tournamentcapital

UsefUl ConTaCT InfoRMaTIon

services & information

Page 6: City of Kamloops Winter Activity Guide

4

HoURs of oPeRaTIon MonDay - fRIDay saTURDay - sUnDayTCC(wellnessCentre&IndoorTrack)* 5:30am-11:00pm 6:30am-9:30pm

Canada Games Pool 6:00am-11:00pm 7:30am-9:00pm

ToURnaMenT CaPITal CenTRe

Day Passes PUnCH CaRDs(Valid for 2 years from date of purchase MonTHly MeMbeRs

Pool&IndoorTrack Full Access*1 Pool&Indoor

Track (14 admissions)Full Access *1

(10 Admissions) indoor Track Full Access*1

Children(4-13)*2 $3 75 $7 $43 $67

18 50(All Ages)

$34Youth(14-18) $5 25 $9 $62 $85 $45Adult(19-59) $7 $11 $84 $104 $55Senior(60+) $5 25 $9 $62 $85 $45

Family*3 $3 75 each N/A $43 $250 N/A $110

Adult(19-59) Senior(60+) Youth(14-18) Child(4-13) FamilyAdvancedPayment $552 $480 $480 $348 $1,080MonthlyPayment*6 $46 $40 $40 $29 $90

annual full access - Regular Membership *5 (Witha12-monthcommitment)

annual full access - Corporate Membership *5

(Witha12-monthcommitment)

annual full access - build your own family Membership *5

(Witha12-monthcommitment)

*1Fullaccesspassincludeswellnesscentre(gym),indoortrack,andCanadaGamesPoolaccess*2 Children 3 years of age and under are free*3Familyisamaximumoftwoadultsandallchildren18yearsofageandunderwhoarerelatedbybirth,legalstatus,ormarriage.Alegally

dependent person with a disability will qualify regardless of age *5Fullaccessmembership:Somerestrictionswillapply.Pleaseaskatfrontcounterformoredetails.*6$40administrationfreewillapplytostartmonthlypaymentplanonnewmembershipsonly,feedoesnotapplytoconsecutiverenewals.Patronshavetheoptionofmakingoneadvancedpatmentormonthlypaymentsforayear

*TCC will be closed on all statutory holidays with the exception of Family Day February 10

•TRUStudentUpgrade:$28withaVALIdU-PASSSTICKER•10&40PunchPassesalsoavailableforPool&Track•Patronswithadisabilitypaytheagerateandtheircareaideisadmittedforfree•ForSpecialPoolRatespleaserefertotheSchedulessectioninourActivityGuide•GymAgePolicy-Allyouthaged12-17yearsarerequiredtocompleteaFREEweightroomorientationpriortobeinggrantedaccesstoCityofKamloopsGym.Youth12-14yearsofagearerequiredtobeunderthedirectsupervisionofapayingadult(18+)

Employees DiscountsBronze 5-50 10%Silver 51-100 15%Gold 101+ 20%

First Adult $46 SecondSenior $34SecondAdult $36 EachYouth(14-18) $24FirstSenior $39 EachChild(4-13) $18

services & information

Page 7: City of Kamloops Winter Activity Guide

5kamloops.ca/recreation 250.828.3500

ToURnaMenT CaPITal CenTRe InfoRMaTIonGym age Policy•Allyouthaged12-17yearsarerequiredtocomplete

a FREE weight room orientation

•Uponcompletionofanorientation,youthaged12-14arerequiredtousethegymsunderdirectsupervisionofapayingadult(18+years).Youthaged 15+ may use the gym on their own

•dropinorientations: MonDay - fRIDay 7am,7:30am,3:30pm,&7pm saTURDay & sUnDay 10am,10:30am,3pm,&3:30pm

Guest Code of ConductOurgoalistoprovideafriendly,safeandfunenvironmentforourguests.

•Pleaseberespectfulofothers,theirbeliefs,opinions,belongings,andfeelings.

•Pleaseberespectfulofdirectionsgivenbystafforvolunteers.

•Ensureconversation,behaviour,andlanguage are appropriate for a public facilitythatcaterstoallcultures,diversities,andagegroups.

•drugs,alcohol,anditemsthatwouldbedeemed as weapons are prohibited on site

•Cameras,smartphonesandotherelectronicrecordingdevicesarestrictlyprohibitedunlesspriorapprovalfromthecityisgiven

•Pleasereportanywitnessedmisconductorsuspiciousactivitytofacilitystaff.

ParkingPlease remember to input your stall number into the parking kiosks and take the ticket with you

AdditionalFREEparkingisavailable on the TRU campus after 5:00 pmMondaytoFridayandalldayonweekends.

The indoor track and field house will closed to the public for programming

Monday and Wednesday from 4:00-5:00 pm, Tuesday and Thursday from 4:30-6:00 pm,

november 3rd, 2014 - april 16th, 2015

Public Notice

services & information

Page 8: City of Kamloops Winter Activity Guide

6

access KamloopsAccess Kamloops is a regularly updated directoryofallnot-for-profitandgovernment-fundedresourcesavailabletoresidents of Kamloops Features include:• onlineandpaperresources,• communitynews• eventssection

Toviewthedirectorygoto:www.accesskamloops.org

boogie the bridge Cultural fundTheBoogietheBridgeCulturalFundprovidesfamilieswithchildrenandyouthages5-18inneedoffinancialassistancetheopportunitytoparticipateinCulturalactivities.For more information and application please viewourwebsite:www.kamloops.ca/boogiefund

KidsportKidSportTMisacommunitybasedsport-fundingprogramthatprovidesgrantsforchildrenandyouthages6-18toparticipateinasportseasonoftheirchoice.KidSportTM

missionistoeliminatethefinancialbarrierstosportparticipation.‘SoALLKidsCanPlay!’For more information and application please viewourwebsite:www.tournamentcapital.com

aRCH - affordable Recreation for Community Health THECITYOFKAMLOOPSWANTSTOSUPPORTYOURACTIVELIFESTYLE!

ARCH is an opportunity to access Kamloops facilities and programs

step 1: Visit us at www.kamloops.ca/arch to see if you qualify

step 2: Fill out the application

Applications areavailableonthe web or at the Tournament CapitalCentre,WestsydePool,or Interior SavingsCentre

step 3: Take your application to a public screening agency(WhiteBuffalo,InteriorFriendship Centre or Family Tree)orvisitourwebsite to see all community agencies that refer clients to the ARCH program

step 4: Onceapproved,youwillreceiveanapprovalletter and information package

step 5: Bring your approvalletterand picture ID to the Tournament CapitalCentre,WestsydePool,or Interior SavingsCentreto be registered in the ARCH Program

community resources

Page 9: City of Kamloops Winter Activity Guide

7kamloops.ca/recreation 250.828.3500

City of Kamloops residents and businesses are encouraged to contact theircommunityassociationthroughthee-mailaddresses,websites,

and Facebook pages below

aberdeen neighborwood association Facebook:www.facebook.com/AberdeenNeighborwoodAssociation

barnhartvale Community association Ontheweb:www.barnhartvale.com Facebook:www.facebook.com/Barnhartvale

Dallas Community association Email: dca@kamloopscommunities ca Facebook:www.facebook.com/dallasCommunityAssoc

Downtown Western Residents society Facebook:downtown&WesternResidentsSociety

Juniper Ridge Community association Email: Juniper RidgeCA@gmail com Facebook: search “Juniper Ridge Community Association”

north shore Central Community association Email: northshorecentral@yahoo ca Facebook:www.facebook.com/NorthShoreCentral

Pineview valley Community society Email:[email protected] Facebook: www.facebook.com/PineviewValleyCommunitySociety

The sagebrush neighborhood association Email: south shore ca@gmail com Facebook:www.facebook.com/sagebrushneighbourhoodassociation

sahali Community association Email: sahalicommunityassociation@gmail com Facebook:www.facebook.com/sahalica

valleyview Community association Email:[email protected] Ontheweb:www.valleyviewcommunity.ca

Westsyde Community Development society Email: wcds@westsyde info Ontheweb: wcds westsyde info

NEW! batchelor Heights Community association and the Heffley Creek Community Recreation Association are in development.Staytunedformoreinfo!

Community associationsfaCebooK & eMaIl!Kamloops is home to 13 Community Associations,volunteersgroupswhohelp make your neighborhood shine

You can also be a part of creating stronger communities with one simple action!

like your Community association on facebook and/ or send them your email. That’s it!Communicating with neighbors is one of the most important CAroles,andbeingconnectedbenefitsyouinsomanyways.•Hearaboutblockparties,neighborhoodwalks,orotherwonderfulgrassrootevents.

•ReceiveCAnewsletters.•LearnwhenconstructionorCityservicesaregoingto be happening in your neighborhood

•Voiceideasorfeedbacktohelpimproveyourneighborhood – your CA wants to hear from you

Together we make communities strong!

Visitusatwww.kamloops.ca/cafor more information

comm

unity resources

Page 10: City of Kamloops Winter Activity Guide

Community CommitteesDo you have ideas, projects or concerns you would like to share with the City? Do you wonder who you should talk with?TheCityofKamloopshasseveralcommitteeswhoworktohelpCityCouncilmakeinformeddecisions.Committeesaremadeupofcitizens,Councillors,andadvisingorganizations.Please contact any of the following to share your feedback:

PaRKs anD ReCReaTIon CoMMITTeeadvisesCityCouncilonissuesrelatedtocommunityparks,sportandrecreation.Contact Val Lyons at 250-828-3400 or [email protected]

soCIal PlannInG CoUnCIladvisesCityCouncilonissuesthatimpactyourqualityoflife.Contact Carmin Mazzotta at 250-828-3728 or cmazzotta @kamloops.ca

senIoRs aDvIsoRy CoMMITTeeadvisestheSocialPlanningCouncilonimprovedaccesstoCityservicesforseniors,andtheirfamilies,forparticipationinallaspectsofCitylife.Contact Ben Chobater at 250-828-3582 or [email protected]

yoUTH, CHIlDRen anD faMIlIes aDvIsoRy CoMMITTeeadvisestheSocialPlanningCounciltoensurechildren,youth,parentsandprovidersareinvolvedin the decisions made within the City of Kamloops and in the community that affect them Contact Ben Chobater at 250-828-3582 or [email protected]

DIveRsITy aDvIsoRy CoMMITTeeadvisestheSocialPlanningCouncilonmattersrelatedtoculturaldiversitywithinKamloops.Contact Ben Chobater at 250-828-3582 or [email protected]

MayoR’s aDvIsoRy CoMMITTee foR PeRsons WITH DIsabIlITIesadvisestheSocialPlanningCouncilonmattersrelatedtopersonswithdisabilitiesandtheircommunitywell-being.Contact Ben Chobater at 250-828-3582 or [email protected]

aRTs CoMMIssIonisresponsiblefordevelopingandpromotingtheartswithintheCityofKamloops.Contact Barbara Berger at 250-828-3663 or [email protected]

HeRITaGe CoMMIssIonadvisesCityCouncilonheritagerelatedissues.Contact the Kamloops Museum at 250-828-3576

KaMlooPs sPoRTs CoUnCIladvocateandsupportforlocalsport.Contact Linda Stride at 250-828-3692 or [email protected]

URban aGRICUlTURe & fooD sysTeMs aDvIsoRy CoMMITTeeoverseesthedevelopmentoftheUrbanAgriculture&FoodSystemsStrategy.Contact Carmin Mazzotta at 250-828-3728 or [email protected]

Community Resources

8

community resources

Page 11: City of Kamloops Winter Activity Guide

bIG online Canada is a resource tool and searchable database linking your criteria to availablefunding.Non-profitcommunityorganizations,culturalandsportinggroups

haveanopportunitytoaccessthisonlinesearchengine.

for more information, contact Cara at 250-828-3611 or [email protected]

Are You Looking For Grant Money?

Comm

unity Resources

Grants and ResourcesTheCityofKamloopsunderstandstheimportanceofnon-profitandvolunteerorganizationsinhelpingdevelopanddelivervaluableservicestoKamloopsresidents.Grantsareonesourceoffunding,andtheCityoffersanumberofgrantingopportunitiesforgroupstotakeadvantageof.TogetherweareMakingKamloopsShine!

neIGHboURHooD beaUTIfICaTIon GRanT ThroughtheCommunitiesinBloomInitiativefundingisavailableannuallyintheSpringtocommunitygroupsforimprovingstreetappealofproperties,enhancinglandscapesandactivities,fosteringcivicprideandgrowingaproud,confidentandhealthcommunity.Applicationinformationatwww.kamloops.ca/cib/cibgrants.sht

neIGHboRHooD MaTCHInG fUnDTheNeighborhoodMatchingFundsupportsneighborhood-drivenprojectsthatbringpeopletogetherincelebration.Grantapplications are accepted all year round Application information at www.kamloops.ca/ca

ToURnaMenT CaPITal GRanTsAmateursportorganizationsandindividualsareeligibleforeventsutilizingservicesand/orfacilitieswithintheCityofKamloops.FormoreinformationcontactSeanSmithat250-828-3552orssmith@kamloops.caThemaximumfundsavailableare:• ProvincialTournament(participantsfromBC)$500• WesternCanadianTournament(participantsfromBC,AB,SK&MB)$1,000• NationalTournament(participantsfromCanada)$1,500• InvitationalTournament(participantsfromoutoftown)$1,500

bC sUMMeR GaMes sPoRT DeveloPMenT GRanTTheBCSummerGamesSportdevelopmentGrantisavailabletolocalcoaches,officialsandsportorganizationsinterestedinfurtheringtheirknowledgeintheirrespectivesport.Examplesmayinclude:aLevelIIIcoachpursuingLevelIVcertification;anumpirebeingcertifiedtotrainotherumpires;asportorganizationpresentingahigh-profile“KeynoteSpeaker”thatmightbeofvaluetonumerousindividuals.Applicantsmayreceive50%ofregistrationfeesuptoamaximumof$500.FormoreinformationcontactSeanat250-828-3552orssmith@kamloops.ca

WInTeR GaMes leGaCy fUnDWinterGamesLegacyFundGrantsaretosupportanathleteorgroup(mustberesident(s)ofKamloops)advancesbeyondlocalcompetitionorisrecruitedtoaprovincialornationallyrankedteam.Qualifyingevents,ifapplicable,musthavetakenplacewithinthethreemonthspriortotheapplication.Themaximumamountallocatedis$150forindividualsand$300forgroups.Iffundsarelimited,prioritymaybegiventoyouthapplicants.FormoreinformationcontactSeanat250-828-3552orssmith@kamloops.ca

9kamloops.ca/recreation 250.828.3500

comm

unity resources

Page 12: City of Kamloops Winter Activity Guide

10

The City of Kamloops wants people of all abilitiestobeactive,andwe’llsupportyoueverystepoftheway.Take part in an adapted program or register for oneofthemanyactivitiesfoundthroughouttheguide–THECHOICEISYOURS.Ourgoalsareto,whereverpossible: • Provideaccessibleprogramsandfacilities • Offerqualityactivitiesthatfityourneeds • Makesureeveryonehastheopportunityto

enjoy healthy recreationTheCityofKamloopsdoesnotprovidepersonalcare,administermedicationorgiveone-to-oneassistance.ThoseneedingextrasupportcanbringtheirownassistantatNOAddITIONALCOST.

Formoreinformationcall250-828-3582 orvisitusatwww.kamloops.ca/accessrec

Program Support Easy as 1-2-3

1. Choose your program(s) and register early 2. ContactusorcompleteaRequestforAdaptiveProgramSupport(RAPS)formforanyadaptations

that help support your participation 3. Let’sworktogethertomakesureyour

experience is all it can be

Accessible Recreation

Adapted programming can help you getcomfortablewithanactivitybefore registering in one of our

many other programs The choice is yours!

Adapted Programming

Page 13: City of Kamloops Winter Activity Guide

11kamloops.ca/recreation 250.828.3500

aCTIve lIvInGadapted yoga $48Enjoy basic yoga exercises in a safe and supported environment. Moveat your own pace and learn the joys of mindful exercise. Caregivers arerequired to join in when needed

Yacht Club: Physical Disabilities»Jan13-Feb17 12:00-1:00PM Tue 235585

developmentaldisabilities»Jan13-Feb17 1:30-2:30PM Tue 235586

aQUaTICsadapted swim Join in the fun and splash into our supported swim lessons for kids with developmental or physicaldisabilities. Beginner level is forkidswhoareswimmingforthefirsttime. Intermediate level is for kidswho are becoming comfortable with swimming unassisted. Caregiversare required to ensure a fun and safe environment.

WestsydePool $42.30»Jan14-Mar11 4:00-4:30PM Wed 235593

Canada Games Aquatic Centre $51.70Beginner»Jan10-Mar14 5:00-5:30PM Sat 235594

Intermediate»Jan10-Mar14 5:00-5:30PM Sat 235595

sPoRTsadapted Hockey $50This exciting program is open to boys andgirlswithdevelopmentaldelays.Kids will be taught the basic skating and puck skills that every playerneeds. Siblings are encouraged toparticipate if they help make the experience more comfortable for yourchild.Siblingsmustregisteraswell.Minimumequipment required:helmet with full face mask, neckguard, gloves, skates, and stick.Wearing a full set of equipment isrecommended.Icetimesmayvary.

InteriorSavingsCentre»Jan10-Mar14 8:30-9:30AM Sat 235582

adapted skating $30Learnthebasicsofskating inafunatmosphere Kids will work on balance andskatingskillsinasafe,welcomingenvironment. For individuals withdisabilities. Caregivers are requiredto participate

InteriorSavingsCentre»Jan10-Mar14 7:45-8:15AM Sat 235584

Wheelchair basketball $25Offeredinpartnershipwith Kamloops adapted sports association,wheelchairbasketballisafast-paced,incrediblyfunworkout!Olympicandnational levelplayerswill teachyouchair skills, shooting techniques,and game strategy For all ages and abilities! drop-ins welcome. Chairsareprovided.

Tournament Capital Centre»Jan8-Mar12 7:00-8:00PM Thu 235591

Wheelchair Curling Kamloops adapted sports association presents wheelchair curling Come on out and throw some rocks,meet new friends, and havean awesome time with the newest sportofferedthroughKASA.Broomsnot required

Formoreinformation,[email protected] orvisitkamloopsadaptedsport.com.

Accessible Recreation

2015 Special Olympics BC Winter GamesThisyear,winterinKamloopswill be warmed by an inspiring displayofdedication,skill,andsportsmanship when the 2015 SpecialOlympicsBCWinterGames come to town

Kamloops will be host to the 2015SOBCWinterGamesthisFebruary,markingtheevent’sreturn to our community for the firsttimein12years!

Approximately 600 athletes and200volunteercoachesandmission staff from the eight SOBCregionsinB.C.andtheYukon will come together to competein:alpineskiing,cross-countryskiing,curling,figureskating,floorhockey,snowshoeing,andspeedskating

Getinvolvedasavolunteerandbeinspired!Learnmoreat: sobcgameskamloops ca

athletes of all abilities = Making Kamloops shine!

accessible recreation

Pool PartyLookingtothrowapartywithatwist?

Now you can arrange to book your ownprivateswimpartyatoneofour

pools! For more informationcall us at 250-828-3500.

Spin to WinThanks to the Kamloops adapted

sports association,wehaveahandcycleinourSpinStudio.

SpintoWinisanintegratedspinclass–see page 40 for more details

Page 14: City of Kamloops Winter Activity Guide

12

AquaticsCold Water SurvivalOvermanyyearsCanadiandoctorGordonGiesbrecht– also known as Professor Popsicle – has researched the effects of cold water immersion and has coined thephrase‘1-10-1’asasimplewaytorememberthefirst3criticalphasesofcoldwaterimmersionandtheapproximate time each phase takes 1 - Cold shock: Aninitialdeepandsuddengaspfollowedbyseverehyperventilation.Youmustkeepyourairwayclearorruntheriskofdrowning.ColdShockwillpassinabout1minute.Concentrateonavoidingpanicandgettingcontrolofyourbreathing.Wearingalifejacketiscriticallyimportanttokeepyouafloatandbreathing.10 - Cold Incapacitation: Overapproximatelythenext10minutesyouwilllosetheuseofyourfingers,armsandlegsforanymeaningfulmovement.Concentrateonself-rescueinitiallyandpreparetohaveawaytokeepyourairwaycleartowaitforrescue.Swimfailurewilloccurwithinthesecriticalminutesandifyouareinthewaterwithoutalifejacket,drowningwilllikelyoccur.1 - Hypothermia: Eveninicewateritcouldtakeapproximately1 hour before becoming unconscious due to hypothermia If you understandtheaspectsofhypothermia,techniquesofhowtodelayit,selfrescueandcallingforhelp,yourchancesofsurvivalandrescue will be dramatically increased

Cold Water survival info courtesy of www.coldwaterbootcamp.com.

More water safety tips at kamloops.ca/swim.

Page 15: City of Kamloops Winter Activity Guide

13kamloops.ca/recreation 250.828.3500

DUCK•12-24months

sTaRfIsH•4-12months

sea oTTeR•Frontandbackfloatsandglideswith help

•1mswim with help

salaManDeR•Frontandbackfloatsand swims

•Roll-overswims

•2mswim.

sUnfIsH•Front,back,roll-over,andside swims

•deepwateractivities.

•5mswim.

CRoCoDIle•Front,back,and

side swims and basic front crawl

•deepwaterswimming

•10mswim.

WHale•10mfront,back,

and side swims and basic front crawl

•deepwaterswimming

•15mswim.

sea TURTle•24months-3years

lesson fees: ParentandTot: $52 Preschool: $60 SwimKids (30 min): $47 SwimKids (45 min): $52 SwimKids (60 min): $61

sWIM KIDs 1•Frontandbackfloatsandswims

•Roll-overswimsandbasic front crawl

•5mswim

sWIM KIDs 2•Sideswimsand

basic front crawl•deepwateractivities

•10mswim

sWIM KIDs 3•Frontandbackfloatsandswims

•Roll-overswimsandbasic front crawl

•15mswim

sWIM KIDs 4•15mbackswim•10mfrontcrawl•25mswim

sWIM KIDs 5•15mfrontand

back crawl•Whipkickonback•50mswim

sWIM KIDs 6•25mfrontand

back crawl•15melementary

backstroke•75mswim

sWIM KIDs 7•50mfrontandbackcrawl•25melementary

backstroke and whip kick on front

•150mswim

sWIM KIDs 8•75mfrontand

back crawl•15mbreaststroke•300mswim

sWIM KIDs 9•100mfrontand

back crawl•25mbreaststroke

and side stroke•400mswim

sWIM KIDs 10•100mfrontandbackcrawl•50melementary backstroke,breaststrokeand side stroke

•500mswim

leaRn-To-sWIM PRoGRaM oveRvIeWPaRenT anD ToT lessons(ages 4 months-3 years)•Parentparticipationisrequired.•Progressionisbasedonage.

PResCHool lessons (ages 3-6 years)•Progressionisbasedon completionoflevel.

sWIM KIDs lessons (ages 5-14 years)•Progressionisbasedon completionoflevel.

Thesesamplefeesarebasedona10-classsession.Feeswillbepro-ratedforgreater/fewerclasses.

aquatics

Page 16: City of Kamloops Winter Activity Guide

14

*Schedulesubjecttochange.**ThenextlessonsetstartFebruary11(Mon/Wed),andFebruary10(Tue/Thu).Seelessonhotsheetfordetails-pickoneupatthepoolorvisitwww.kamloops.ca/swim.

aquatics

WInTeR 2015 WeeKDay sWIM lesson sCHeDUleCanaDa GaMes aQUaTIC CenTRe WesTsyDe PoolMon/Wed** Tue/Thu** Mon/Wed** Tue Thu

start Date: Jan 12 Jan 13 Jan 12 Jan 13 Jan 15Starfish 9:30 am 9:30 am 3:30 pm

Duck 10:00 am 4:30 pm 10:00 am 3:30 pm

sea Turtle 10:30 am 4:30 pm 10:30 am 3:30 pm

sea otter

9:00 am9:30 am10:00 am10:30 am11:00 am3:00 pm

4:00 pm4:30 pm5:00 pm6:00 pm6:30 pm7:00 pm

9:00 am9:30 am10:00 am10:30 am

3:00 pm4:00 pm4:30 pm6:30 pm

3:00 pm4:30 pm 5:00 pm 3:00 pm

salamander9:00 am4:00 pm4:30 pm

5:30 pm6:00 pm

9:00 am4:00 pm4:30 pm

5:30 pm6:00 pm 3:30 pm 3:00 pm

Sunfish 6:30 pm 11:00 am4:00 pm

5:00 pm6:30 pm 4:00 pm 5:30 pm

Crocodile 3:30 pm 3:30 pm 7:00 pm 5:00 pm 3:30 pmWhale 3:30 pm 3:30 pm 7:00 pm 5:00 pm 3:30 pm

swim Kids 1 4:00 pm6:00 pm

4:30 pm5:30 pm 5:00 pm 5:00 pm

swim Kids 2 3:30 pm5:30 pm

3:30 pm6:00 pm 5:00 pm 5:00 pm

swim Kids 3 3:00 pm 3:00 pm 5:30 pm 5:30 pm

swim Kids 4 3:00 pm 3:00 pm 6:00 pm 6:00 pm 5:30 pm

swim Kids 5 3:30 pm 3:30 pm 6:00 pm 6:00 pm

swim Kids 6 5:30 pm

swim Kids 7 5:30 pm

swim Kids 8 4:15 pm

swim Kids 9 4:15 pm

swim Kids 10 4:15 pm

adults 6:30 pm

Private lessons 7:00 pm 7:00 pm 6:30 pm 6:00 pm

1.Keeplittlefeetoffthecooldecks–bringclean,non-slipdeckwear2.Wrapthemupinacozytowelrobebefore/after their lesson3.Aswimshirtorthicker‘rashguard’takestheedge off the cooler air4 Be sure to thoroughly dry off and keep clothes dry while changing5.Blow-dryhairandputatoqueonbeforeheading outside after lessons6.Celebratetheirachievementsandwarmthemup with a hot chocolate!

Tips to Warm Up your Winter Swim Lessons

Page 17: City of Kamloops Winter Activity Guide

15kamloops.ca/recreation 250.828.3500

*Schedulesubjecttochange.Seelessonhotsheetfordetails-pickoneupatthepoolorvisitwww.kamloops.ca/swim.

aquatics

WInTeR 2015 WeeKenD sWIM lesson sCHeDUleCanaDa GaMes aQUaTIC CenTRe WesTsyDe Pool

Fri Sat Sun Fri Sat

start Date: Jan 9 Jan 10 Jan 11 Jan 9 Jan 10

Starfish 8:30 am 9:30 am 4:00 pm 10:00 am

Duck 10:00 am 9:00 am 10:00 am 8:30 am 5:00 pm 4:00 pm 10:00 am

sea Turtle 10:00 am 9:30 am 10:00 am 9:00 am10:00 am 5:00 pm 4:00 pm 10:00 am

sea otter9:30 am3:00 pm4:00 pm4:30 pm

5:00 pm5:30 pm6:00 pm

8:30 am9:00 am9:30 am10:00 am10:30 am

11:00 am4:00 pm5:00 pm5:30 pm

8:30 am9:00 am9:30 am10:30 am

11:00 am4:00 pm5:30 pm6:00 pm

3:00 pm5:30 pm

10:30 am11:30 am

salamander 3:00 pm4:30 pm 5:00 pm

8:30 am9:00 am9:30 am10:00 am

10:30 am11:00 am4:00 pm4:30 pm

9:00 am9:30 am10:00 am

10:30 am4:00 pm5:00 pm

3:30 pm5:30 pm

9:30 am11:00 am

Sunfish 4:00 pm 9:30 am4:00 pm 5:00 pm 9:30 am

4:30 pm 5:30 pm 3:00 pm 9:00 am

Crocodile 4:00 pm 10:30 am 4:30 pm 10:00 am 4:00 pm 3:30 pm 9:30 am

Whale 4:00 pm 10:30 am 4:30 pm 10:00 am 4:00 pm 3:30 pm 9:30 am

swim Kids 1 3:30 pm 9:00 am 4:30 pm 9:00 am 4:30 pm 4:30 pm 10:30 am

swim Kids 2 3:30 pm 4:00 pm 10:00 am10:30 am 4:30 pm 9:30 am 4:30 pm 4:30 pm 10:30 am

swim Kids 3 3:30 pm 5:00 pm 9:00 am10:30 am 4:00 pm 9:00 am

10:30 am 5:00 pm 4:00 pm 10:00 am

swim Kids 4 4:30 pm 9:00 am 4:00 pm 10:00 am3:00 pm 5:00 pm 4:30 pm 11:00 am

swim Kids 5 4:30 pm 9:30 am 4:30 pm 10:30 am3:30 pm 4:30 pm 5:00 pm 11:30 am

swim Kids 6 3:30 pm 10:00 am 4:30 pm 10:30 am 5:00 pm 6:00 pm 11:30 am

swim Kids 7 3:30 pm 10:00 am 10:30 am 5:00 pm 6:00 pm

swim Kids 8 5:00 pm 9:00 am 3:00 pm 9:30 am 3:00 pm 12:00 pm

swim Kids 9 5:00 pm 9:00 am 3:00 pm 9:30 am 3:00 pm 12:00 pm

swim Kids 10 5:00 pm 9:00 am 3:00 pm 9:30 am 3:00 pm 12:00 pm

adultslearn to swim 5:30 pm 6:00 pm

adultsstrokes 5:30 pm

Private lessons 5:30 pm 6:00 pm

11:00 am4:00 pm4:30 pm

5:30 pm6:30 pm

3:30 pm6:00 pm 1:00 pm

Page 18: City of Kamloops Winter Activity Guide

We offer a variety of formats, times and days to guarantee fun!

Ask about our swim pass goody bag stuffers!Visit kamloops.ca/swim for pool party details. DIM SWIM

Fun, Music, Atmosphere

Saturdays, 6:00-9:00 pm ∙ September-May ∙ Canada Games Aquatic Centre ∙ www.kamloops.ca/swim

16

oRIGInal aQUaTIC PRoGRaMsadapted aquaticsAre you looking for Adapted Aquatics programs?Weofferswimminglessonsfor children with developmental orphysicaldisabilities.Seepage11fordetails

Gym n’ swim ages: 3-5Childrenenjoysupervisedgymnasticsand swimming while parents enjoy free time at TCC Contact the Kamloops Gymnastics and Trampoline Centre(KGTC)at250-374-6424formore information and to register

Private lessons $22/30 min ages 3+Full or half lesson sets of one-on-one instruction. Work on specificskillstomasteralevel-thecontentis up to you! Ask our staff about a semi-privateoption.VisittheezRegwebsite or call 250-828-3500 toregister

Junior lifeguard $54.90 Club ages 8-12Keeps kids active and interestedin swimming and lifesaving. Anawesome program for aspiring lifeguards Participants must be able toswim25m.Focusisondevelopingwater proficiency and rescue andfirstaidskills.

WestsydePoolandCommunityCentre»Jan15-Mar12 4:15-5:15PM Thu

Pool Paddling - $52 sessions ages 18+

Keep your paddling skills sharp in the comfort of the Canada Games Aquatic Centre Bring your own gear and boat Note: no instruction is provided.

Canada Games Aquatic Centre»Jan14-Feb25 9:00-10:30PM Mon 235932

adult Recreation Water Polo Regular admission ages 15+

drop in for some fun-focusedscrimmage. Swimming ability and“egg beater” kick are required; water polo experience is optional

Canada Games Aquatic Centre»Jan6-Mar10 9:00-10:00PM Tue

aquatics

Did you KNOW?Fragrances,lotionsandhair

products impact pool filtrationandchemistry.

Helpkeepourpoolsclean-Showerbeforeyouswim!

Page 19: City of Kamloops Winter Activity Guide

We ReCoMMenD THIs PaTH...bronze coursesdeveloplifesavingfitnessanddecisionmakingskills.

standard first aidprovidespracticalskillstohandleemergencyresponsesituations

national lifeguard promotespreventionofdrowning and aquatic related injury

Instructor Training prepares you to teach swimminglessonsandlifesavingskills.

bUIlD THe foUnDaTIon foR sUCCess!Lifeguardspreventdrowning,teachwatersafetyandprovideleadershipinourcommunity.

Want help planning your lifeguard training? Consult one of our Aquatic Coordinators by email at [email protected] or by phone at 250-828-3754

optional Training:AEdProvider,BCRPAAquafitnessInstructor,PoolOperatorLevel1

Start Here!bronze star

ForChildren10-13years

bronze Medallion13yearsorBronzeStar

bronze CrossBronzeMedallion

standard first aid15 years

national lifeguard16years,BronzeCross,SFA

Water safety Instructor15years,AWSI

lifesaving Instructor16yrs,BronzeCross

W.H.M.I.S CertificateAvailableatTRUoronline

assistant Water safety Instructor15years,SwimKidslevel10

Dream Job!kamloops.ca/swim

17kamloops.ca/recreation 250.828.3500

JoIn THe TeaMbe a lIfeGUaRD

aquaticsDid you KNOW?

Page 20: City of Kamloops Winter Activity Guide

1818

Days Dates Time Fee Location Program No

bronze star-StudentswilllearnbasicCPR,firstaid,andwaterrescuesandsearches,aswellaswaterhazardawareness.Prerequisites: Strong swimming ability is recommended; 100% attendance is required.

Fri Jan9-Mar13 6:00-7:00pm $95 Canada Games Aquatic Centre 234582

bronze Medallion-Preparesstudentstorespondeffectivelytoavarietyofaquaticemergencies.Studentswilldeveloptheirfitnesslevels,safetyknowledge,waterrescueskills,andjudgment.Prerequisites: Bronze Star or 13 years of age (by last day of course); ability to swim 200 m; 100% attendance is required.

Sat&Sun Jan24-Feb1 1:00-8:00pm $195 Canada Games Aquatic Centre 234583

bronze Cross-Challengesstudentstoperformincreasinglycomplexwaterrescues,firstaid,andCPRscenarios.Preparesstudentsforfurtherlifeguardtrainingandisalsoanexcellentlifeskillandconfidencebuilder.Prerequisites: Bronze Medallion; 100% attendance is required.

Thu-Sun Feb12-15 4:30-8:30pm(Thu&Fri)1:00-8:00pm(Sat&Sun) $170 Canada Games Aquatic Centre 234584

standard first aid (sfa)-ProvidescomprehensivetrainingcoveringallaspectsoffirstaidandCPR.Topicsincludespinal,bone,andjoint injuries; illnesses due to extreme heat and cold; abdominal and chest injuries; and burns Prerequisites: 15 years of age (by last day of course); 100% attendance is required.

Tue&Thu Feb24-Mar5 4:00-9:00pm $195 Tournament Capital Centre 234585

national lifeguard (nl)-NListhenationalstandardforlifeguardsinCanada.Candidateswilllearntoapplyrescuetechniquesandfirstaid skills Prerequisites: 16 years of age (by last day of course); Bronze Cross; SFA; 100% attendance is required.

Mon-Thu Mar16-26 10:00am-5:00pm $350 Canada Games Aquatic Centre 234586

assistant Water safety Instructor (aWsI)-Introducescandidatestothefoundationsofteachingskillsbyfocusingontheoreticaland practical knowledge that supports the learning experience Prerequisites: 15 years of age (by last day of course); Swim Kids 10 (or equivalent); 100% attendance is required.

Fri Jan23-Mar13 4:00-9:00pm $320 Canada Games Aquatic Centre 234587

Water safety Instructor (WsI)-PreparescandidatestoteachtheCanadianRedCrosslearn-to-swimprogramsbyfocusingonstrategiestointroduceanddevelopswimmingandwatersafetyskills.Prerequisites: 15 years of age (by last day of course); AWSI; 100% attendance is required.

ThiscoursewillbeofferedintheSpring/Summersession.

lifesaving Instructor (lsI)-CombinestheoryandpracticetopreparestudentstoteachandevaluateavarietyofLifesavingSocietyprograms,suchasCanadianSwimPatrol,BronzeStar,BronzeMedallion,BronzeCross,andothers.Prerequisites: 16 years old (by last day of course); Bronze Cross; 100% attendance required.

ThiscoursewillbeofferedintheSpring/Summersession.

Refund Policy:Withdrawspriorto7daysofstartdateare100%refundable;withdrawswithin7daysofstartdatearerefundedat50%.No refunds on or after start date

aDvanCeD aQUaTIC CoURses WInTeR 2015

aquatics

Recertification Clinics - Allcandidatesarerequiredtopresenttheiroriginalcertificationatthestartoftheclinic.

Clinic Day Date Time fee location Program no.

WSI Wed Jan 21 5:00-9:00pm $85 Canada Games Aquatic Centre 234588

LSI Mon Feb 16 6:00-10:00pm $75 Canada Games Aquatic Centre 234589

NL Sun Mar1 9:00am-5:00pm $125 Canada Games Aquatic Centre 234590

Page 21: City of Kamloops Winter Activity Guide

19kamloops.ca/recreation 250.828.3500

Kamloops Tournament Capital Centre

Your one stop shop for all ofyour aquatic fitness needs

Your one stop shop for all ofyour aquatic fitness needs

Competitive Swimming • Aqua Fitness • Waterpolo • Synchro

Bring in thisad and receivean additional5% off yourpurchases

Tournament Capital Centre – 910 McGIll Road • On-line store: www.team-aquatic.com

19kamloops.ca/recreation 250.828.3500

Help keep our pools clean - shower before you swimFragrance,lotions,andhairproductsimpactpoolfiltrationandchemistry.

ThinkHealthy-SwimHealthy-BeHealthy kamloops.ca/swim

Page 22: City of Kamloops Winter Activity Guide

20

Early YearsPhysicalLiteracyisaboutdevelopingtheFUNdamentalmovementskillsandtheFUNdamentalsportsskillssokidshavetheconfidenceandcompetencetodoANYTHINGtheywantinordertobeactiveforlife.Thebasicenvironmentswherechildrenshouldlearnfundamentalmovementskillsareontheground,inthewater,onthesnowandiceandintheair.Justaslearningthealphabetisneededtoread,theABCs-agility,balanceandcoordinationaresome of the skills that support physical literacy

Some activities to get you started this winter are:- Preschooliceskating- Buildingasnowman- Makingsnowangels- Jumpingintoapileofsnow- Swimmingduringpublicswims- Buildingasnowfort- Signingupforindoorrecreationprograms

Develop your child’s movement vocabulary

sotheyhavethebestchanceatbeingactiveforlife!Checkoutourphysical

literacy programs in our Early Years section

Page 23: City of Kamloops Winter Activity Guide

Free Winter Activities in Kamloops

There are many fun and FREE WinteractivitiesinKamloopsthat the whole family can participate in Here are a few activitiesandplacesthatwillhelpkeepyouactiveduringtheWinterseason.

snowshoeing• StakeLake• McConnelLake• KennaCartwrightParkWinter Hiking• PetersonCreek• KennaCartwrightParkoutdoor skating• PineviewValley Community Ice Rink• JuniperIceRinkat Juniper Park• dallas-Barnhartvale Church• Heffley–LenHaughton Park• CentennialPark RalphClearwatersSports Complex • Rayleigh’sRae-MorParkTubing and Tobogganing• Rayleigh-overHighway 5 from the Petro Canada gas station• Brocklehurst–SinghStreet SoccerBowl• BachelorHeights–behind BachelorHeightsalongLac Du Bois Road• Abredeen–Manyareasto check out! along the way

aRTs anD CUlTURebeaver bonanza at the $5 Kamloops Museum 4-6 yrs

Join the Kamloops Museum &Archives as we discuss why thebeaver is a Canadian symbol, whyit is part of our history, and somecool facts about this unique animal Createacraft,exploretheMuseum,and make new friends

KamloopsMuseum&Archives»Feb26 10:00-11:00AM Thu 235534

»Mar11 10:00-11:00AM Wed 235535

DanCInGlittle Dancer I $87.50

2½-4 yrsIn this program, your child willdiscoverandexplorebasicmovementskills,musicalawareness,expression,andcreativitythroughdance.

RayleighElem.School»Jan6-Mar10 9:00-9:30AM Tue 233582

Sista’sLovetodanceStudio»Jan10-Mar14 9:00-9:30AM Sat 233583

»Jan10-Mar1411:40AM-12:10PMSat 233584

little Dancer II $94 4-5 yrsIn this program, your child willdiscoverandexplorebasicmovementskills,musicalawareness,expression,andcreativitythroughdance.

Sista’s Love to dance Studio »Jan10-Mar14 9:40-10:25 AM Sat 233588

RayleighElem.School »Jan6-Mar10 9:00-9:45AM Tue 233589

Play anD leaRn frozen $20

3-5 yrs Explore winter fun and create a winter wonderland with your favourite Frozen characters. Enjoystories,songs,andcrafts,andmeetnew friends too! Come wearing your favouritewintercostume.

KamloopsMuseum&Archives»Jan20 10:00AM-12:00PM Tues 234632

Queen of Hearts $20 3-5 yrs

JoinAliceandherfriendsforaMadHatter Tea Party and fun activities.Create some great Valentine’s Day crafts.Learnthroughstories,games,andphysicalactivity.ComedressedasyourfavouriteAliceinWonderlandcharacter

KamloopsMuseum&Archives»Feb10 10:00AM-12:00PM Tues 234633

laughing leprechauns $20 3-5 yrs

Join us for a morning of leprechaun fun!Wewillmakecrafts,findapotofgold,singsongs,andplaygames.Wearyourbestgreenoutfit.

KamloopsMuseum&Archives»Mar10 10:00AM-12:00PM Tues 234634

New

New

21kamloops.ca/recreation 250.828.3500

Early Years

early years

Page 24: City of Kamloops Winter Activity Guide

sPoRTsactive Tots $35

4-6 yrs Throughplayandmovement,childrendevelop FUNdamental movementskillsthatwillprovidethefoundationfor physical activity. The programwillfocusonamulti-sportapproach.Your child will be introduced to Tots Soccer, T-ball and Floor Hockey.This program is in partnership with PacificSportInteriorBC.

WestsydeNeighbourhoodCentre»Jan21-Feb18 9:30-10:30AM Wed 234083

sports on Mats $35 4-5 yrs

Introductoryjudo,karate,wrestling,and gymnastics skills come together to deliverafun,innovativeapproachforkidstomovetheirbodiesinavarietyof ways. Practice tumbling, falling,rolling, and lateral movements todevelopfundamentalphysicalskills.

WestsydeNeighbourhoodCentre »Jan15-Feb1910:00-11:00AM Thu 233934

Tots floor Hockey $25 2½-3½ yrs Introduceyourchildtofloorhockeyfundamentals, plus fun activities,games, songs, and more! Thisprogram will engage children,increasetheirphysicalliteracyskills,and introduce them to new friends

WestsydeNeighbourhoodCentre»Jan20-Feb10 9:30-10:00AM Tue 233936

Tots floor Hockey $30 3½-5 yrs Introduceyourchildtofloorhockeyfundamentals, plus fun activities,games, songs, and more! Thisprogram will engage children,increasetheirphysicalliteracyskills,and introduce them to new friends

WestsydeNeighbourhoodCentre»Jan20-Feb10 10:15-11:00AM Tue 233937

22

early years

Did you know?ThattheCityofKamloopshasfreepre-schoolskating

sessions throughout the winter 2015 season Check our skate website for schedules and more information:

www.kamloops.ca/arenas

Snow PaintingSnowpaintingisagreatwinteractivityandauniquewaytonurtureartistic talent or introduce children to the joy of artistic creation

What you need:

•Snow

•Foodcoloring

•Spraybottles

Fillspraybottlewithwarmwateraddfoodcolouring-makesurewaterbottles haveenoughcoloringinthemtomakethecolourvisibleoncesprayedonthesnow.

Page 25: City of Kamloops Winter Activity Guide

23kamloops.ca/recreation 250.828.3500

early years

. . . always putting children fi rst & always going several steps beyond!

25O.319.9O44 • www.kamloopskidz.com

“A lifetime of learning begins here”

Valleyview Campus1764 Valleyview DrivePreschoolChildcare - Ages 1 to 12

Sahali Campus1585 Summit Drive PreschoolChildcare - Ages 5 to 12

Pineview Campus 1711 Copperhead DrivePreschoolChildcare - Ages 1 to 12

JUNIOR KINDERGARTENMonday & Wednesdaysfrom 11:45am-2:15pm $125/MonthAges: 4 year olds January 5th - June 19th

Code: JKMW

Are you concerned that your child may not be ready for Kindergarten next September? This class is only for children who will be entering kindergarten in September 2015. Our focus will be:

• social/emotional development including play skills;

• skill development including listening and working cooperatively;

• gross and ne motor development including correct pencil grasp, cutting, drawing;

• cognitive and language development including name recognition, name writing, colors, letters, shapes, numbers.

All areas of the whole child will be focused on to ensure your child is ready for Kindergarten – our classes ll quickly – don’t miss out!

JUNIOR PRESCHOOLFridays from 12-1:30pm FREECode: JPFJanuary 12th - February 13th

Ages: 2.5 year oldsThe transition from Toddlers to Preschool can be a little stressful on some children and their parents. This class is designed as an introductory experience away from Mom/Dad. Children will be busy meeting new friends, singing songs, creating art, playing with fun materials. There will also be a large gross motor component where children can run, jump and use up all that energy. Sure to be loads of fun.

Registering NowRegistration now for our January 2015 classes! Childcare

registration is ongoing, enquire

today!

What Our Parents Say“My son learned a love of school and was beyond prepared to start kindergarten”

...Rachel

“Your wonderful location, playgrounds, facility and philosophy were why we chose you, but the extra special care and attention is what keeps me recommending your preschool”

...Erin

Page 26: City of Kamloops Winter Activity Guide

Children

24

Did you know?

Playingactivevideogamesstilldoesn’tgiveyourchildrenthephysicalactivitythattheyrequire.Accordingto activehealthykids.ca,activevideogamesmaygetheart ratesup,butthey’renotsignificantlyhelpingkidsgettothe60minutesofmoderate-tovigorous-intensityphysicalactivityrequiredeachday.Screentime,includingactivevideo games always poses a threat to play; unstructured play in ournaturalenvironment.

Embracethecoldwithagreatattitude,warmclothesandspontaneous,unstructuredactivities.Gettingreadytogooutsidecanseemlikeadauntingtask,butwhynotmakeitfun?Startby creating a list including pictures of items your child will need to stay warm outside This can help your child independently getready-eveniftheycan’treadalist,theycanrefertothepictures.Youcouldevenmakearaceoutofit!Challengeyourchild to get ready before you do

Unplugging and reducing your screen time in the winter doesn’t havetobeachallengingexperience,butratheranopportunitytobondwithyourchild(ren)andenjoyplayingtogether,outsideinournaturalenvironment.

Doll brothersWhetherHudson(10)and Luke(9)areplayingintheirbasement,ontheirdrivewayorontheice,theirfavoriteWinteractivityishockey.Whentheyarenotplayinghockeyyouwillfindthempublic skating at the local arenas or attheWCPoutdoorrink.Aspecialwinter outing is tubing at Harper mountain

Page 27: City of Kamloops Winter Activity Guide

25kamloops.ca/recreation 250.828.3500

aRTs anD CUlTUReart explosion! 6-13 yrsYour child will enjoy a stimulating selection of irresistible ideas and visualexcitement.Sculpt,draw,andpaint a new project each week using materials found around the house A healthysnackwillbeprovided.

OldCourthouse $75»Jan15-Feb12 3:30-5:00PM Thu 233082

$60»Feb19-Mar12 3:30-5:00PM Thu 233083

ParkviewActivityCentre

$75»Jan14-Feb11 3:30-5:00PM Wed 233084

$60»Feb18-Mar11 3:30-5:00PM Wed 233085

Creative exchange $1/child at the Museum 3 yrs +The Museum provides the craftsupplies, you bring the creativity!Create a masterpiece based on our permanent and temporary, or theseason.After,exploretheChildren’sMuseum and discover somethingnew. Adult supervision required,pleasepre-register.

KamloopsMuseum&Archives

»Jan31 2:30-4:00PM Sat 235536

»Mar21 10:00-11:30AM Sat 235537

Portrait stories $10 at the Museum 9-12 yrsAttention shutterbugs! Bring in photos of your life and create a fictionalstoryusingyouasthemaincharacter. Baby pictures, familyphotos, or a great family memorywillserveasthebackdrop,andthenyoudeveloptheplotline.

KamloopsMuseum&Archives»Mar7 10:00AM-12:00PM Sat 235544

Pioneer Games fRee at the Museum 5-12 yrsWhat did kids do before Xbox orNintendo?Beforekids‘pluggedin’toplay,games likecheckers, tag,andSimonSayswerepopularpastimes.Joinusaswediscoversomeof thegames that children played before video games, cell phones, or TV.Pleasepre-register.

KamloopsMuseum&Archives»Mar14 10:00-11:30AM Sat 235547

sensational spring $10 per Days at the session Museum 7-12 yrsAttention nature lovers! duringSpring Break, learn about all thewonderful features of nature, suchas animals, water, the earth, andtrees Each day is a new theme Createcrafts,dohands-onactivities,and make new friends

KamloopsMuseum&ArchivesAwesome Animals»Mar17 10:00AM-12:00PM Tue 235553

WonderfulWater»Mar18 10:00AM-12:00PM Wed 235555

Extraordinary Earth»Mar19 10:00AM-12:00PM Thu 235556

TerrificTrees»Mar20 10:00AM-12:00PM Fri 235557

Digital DetoxTakea‘techtimeout’!Bearolemodelfor your children and put the phones down,turnofftheTVandshutoffthecomputers.Setanexampleofbeingactive,eveninthewintermonths.Positivesocialinteractionswithoutinvolvingscreentime,willbuilthealthierlivesandencouragechildrentobeactivewithfamilyandpeers.Hereareafewactivitiesthatyou can do in the winter months that encourage you to unplug and play:

•AttendactivitiesduringUnplugged andPlay’week.Seetheinsidecover for details •Hostfamilygamenightsandinvite the neighbours

•Takefamilywalksbymoonlight

•Tryicefishing

•Buildasnowfamilyinthe backyard

•Goiceskating

•Shoveltheneighbour’sdriveway together

•Playgamestogetherinthesnow.Soccerandtagcanbefuninthe snow!

•Goonawinterpicnic

•Buildafortinthelivingroomandhaveafamilysleepover

•Tryanewactivitylikecurlingor snowshoeing

•Createawintertreasurehuntforthe children

children

Kamloops Children’s Museum

TheKamloopsChildren’sMuseumislocatedonthefirstflooroftheKamloopsMuseum&Archives,at207SeymourStreetandisopenTuesdaytoSaturday,9:30am–4:30pm.dressupasapioneer,trade supplies in our fur trade

cabin or put on a show in our puppet theatre Come and explore!

Page 28: City of Kamloops Winter Activity Guide

26

spring break Photo $125 Camp for Creative Kids

9-13 yrsStudentswillcreatetheirowncomicbook storyboard by bringing their story to life with photography This three-day camp will have studentsshooting in manual in no time! They will begin by using aperture and shutter priorities and graduating to manual by the end of the camp! Students must bring their owncamera

ExposurePhotoStudio»Mar24-26 8:00AM-3:00PM Tue-Thu 235637

egyptology for Kids $10 at the Museum 9-12 yrsExplore the world of ancient Egypt in two hours! Learn aboutmummification,createacanopicjar,anddiscoverwritinginhieroglyphics.CanyouwalklikeanEgyptian?

KamloopsMuseum&Archives»Mar28 10:00AM-12:00PM Sat 235545

In the studio fReeCreate a portrait of yourself using props and backgrounds at the KamloopsMuseum&Archives.Staffwill take your photo so you can bring it home to share Dress up as a pioneer or fur trader! Please pre-register.

KamloopsMuseum»Feb7 1:00-3:00PM Sat 235589

DanCInGIntro to Irish Dancing $125 1 - Reel fun 6-8 yrsA high-energy, fun class in whichdancers will learn the basics of soft shoe Irish dancing Dancers will develop grace, poise, and goodposture while learning the steps of theBeginnerReel.developphysicaland mental skills through aerobic exercise, listening, and followinginstructions.Someteamdancingandceilidh dancing will be introduced at the end of the course

SouthKamloopsSec.School»Jan8-Mar12 5:15-6:15PM Thu 234164

Intro to Irish Dancing $125 1 - Reelin’ n’ Jiggin’ 9-12 yrsA high-energy, fun class in whichdancers will learn the basics of soft shoe Irish dancing Dancers will develop grace, poise, and goodposture while learning the steps of the Beginner Reel and Beginner Jig develop physical and mental skillsthrough aerobic exercise, listening,and following instructions. Someteam dancing and ceilidh dancing will be introduced at the end of the course

SouthKamloopsSec.School»Jan8-Mar12 6:30-7:30PM Thu 234165

Movers and Groovers $100 6-8 yrs

Get into thedancemoveswith thisupbeat introduction to hip hop dance techniques Each lesson will take you through a choreographed dance sequence. Before you know it, youwill be dancing like a star!

Sista’sLovetodanceStudio

»Jan10-Mar14 10:30-11:30AM Sat 233592

Musical Theatre $100 8-14 yrs

Singing, acting, choreography,movement, improvisation, andcharacter development will becombinedinthisperformance-basedclass! Broadway music and pop songs will be explored in a new way as we journey into the world of musical theatre

Sista’sLovetodanceStudio

»Jan7-Mar11 4:00-5:00PM Wed 233594

square Dancing fRee 7 yrs +

Learnthebasicsofsquaredancing.Ifyoucanwalk,youcansquaredance!Partners and/or dance experienceare not required

ArthurHattonElem.School»Jan16-Mar13 2:45-4:00PM Fri 234979

children

Raising “5-2-1-0” Children

Let’sallaimtoraisehealthierchildrenbyfollowingthe5-2-1-0message.Atleast5fruitsandvegetables,nomorethan2hoursofscreentime,atleast1hour

ofphysicalactivity,and0sugarydrinksdaily.

Page 29: City of Kamloops Winter Activity Guide

27kamloops.ca/recreation 250.828.3500

Ukrainian Dancing $85 beginner 7 yrs +Learn traditional Ukrainian danceand have fun with many characterdances that incorporate role playing and story lines Experience is not required Dance slippers are an additional cost to this program

StuartWoodElem.School»Jan14-Jun17 6:00-7:30PM Wed 235439

sPoRTs ball sports $30

7-12 yrsYour child will explore different ball sports through fun games and activities,whilelearningfundamentalmovementskillstohelpbuildphysicalliteracy

WestsydeNeighbourhoodCentre»Jan13-Feb3 3:00-4:30PM Tue 233935

Darts $35 11-14 yrs

Come on out and join in this fun recreational activity. developyour hand-eye coordination,concentration,andmathskillswhilebuildingselfconfidenceandmeetingnew friends

WestsydeNeighbourhoodCentre»Jan4-Mar10 233932 Sun,10:00-11:00AM Tue,6:00-7:00PM

Junior badminton $30 8-12 yrs

Learn the fundamentals ofbadminton, including all strokes(forehand, backhand, clear, smash,andnetshots),footwork,rules,andstrategy Free play and games at the end of each session. Must supplyyour own racquet

Bert Edwards

»Jan8-Feb5 6:00-7:00PM Thu 233736

Junior Tennis $125 spring break Camp 8-12 yrsThese tennis camps are designed to helpyouryoungsterimproveandhavefun! Tennis Canada and provincialassociation partners has introduced a new community program called Progressive Tennis. With smallercourts, smaller racquets and softerballs, the game is fun and easy toplay This camp is in partnership with the Kamloops Tennis Association

Kamloops Tennis Centre

»Mar16-20 9:00AM-12:00PM Mon-Fri 234880

soccer Drills and skills $20

6-9 yrsThis clinic is for players who are new to soccer Drills and skills will be covered,aswellasgameplay.

WestsydeNeighbourhoodCentre

»Feb21 10:00AM-12:00PM Sat 233938

Jam Can bonspiel - $40 Team Registration 6-13 yrsCome out to the Kamloops Curling Club’s Jam Can Curling Bonspiel and try a new sport! You’ll get two full daysoffunwithyourfriends.Luncheswill be provided. Must register asa team, maximum four per team.Childrenmustbesupervised.

Kamloops Curling Club»Mar28/29 8:00AM-5:00PM Sat-Sun 235832

Jam Can bonspiel - $10 Individual Registration

6-13 yrsCome out to the Kamloops Curling Club’s Jam Can Curling Bonspiel and try a new sport! You’ll get two full days of fun with your friends Lunches will be provided. Childrenmustbesupervised.

Kamloops Curling Club»Mar28/29 8:00AM-5:00PM Sat-Sun 235833

children

Thecoldesttemperatureeverrecordedintheworldwas-128degreesCelsius,inVostokStationinAntarcticain1983.

(http://en.wikipedia.org/wiki/List_ofweather_records)

Did you Know?

New

New

New

Page 30: City of Kamloops Winter Activity Guide

28

outdoor Community Rinks Winteristhetimetotakepartintheageoldtraditionofgettingtogetherwithfamilyandfriendsforskatingattheoutdooricerink.Wehappilyhandleafrostynoseandtinglingtoesforthesimplejoysofchasingeachotheraroundtheice,holdinghandswithasweetheart,orslappingapuckwithbuddies

KamloopshasoutdoorrinksinJuniperPark-JuniperRidge,PineviewValleyCommunityIceRink,CentennialPark(Westsyde),andHeffleyCreek–LenHaughtonPark.Theserinksaremaintainedbycommunityvolunteers.

Sopackathermoswithcoffeeorhotcocoa,putonsomewarmclothes,andenjoythewonderfulwinterweather at your neighborwood outdoor rink

Youth

doyouwanttobeactiveandmakenewfriendthiswinter?CheckoutourPublicSkatingandStickandPuckprograms.Forschedulesandprogramguidelinespleasevisitour

website:www.kamloops.ca/arenas

Public Skating and Stick and Puck

Note: In most cases the rinks are floadedinthelateeveningsso they all not open for skating during the early day time hours

Page 31: City of Kamloops Winter Activity Guide

New

29kamloops.ca/recreation 250.828.3500

aRTs anD CUlTUReface Painting $50 Workshop 101Face painting can bring out the artist in anyone! This workshop will giveyou tips and tricks Fee includes a facepainting kit

ParkviewActivityCentre»Mar10 6:30-8:30PM Tue 235093

face Painting $60 Workshop 201Learn how to face paint like aprofessional with appropriate products and tools. If you havepreviousexperienceorattendedtheFace Painting Workshop 101, thisworkshopisforyou.Mustbringyourown face painting supplies

ParkviewActivityCentre»Mar31 6:30-8:30PM Tue 235094

Printmaking $45Learn the basics of printmaking byusing everyday household objectssuchassponges,mesh,string,wool,bubblewrap,paperclips,cardboard,and paper All supplies will be providedforthisworkshoptocreateyour masterpiece!

OldCourthouse»Jan24 1:00-3:00PM Sat 235445

»Feb20 1:00-3:00PM Fri 235446

spring break Photo Camp $125Create your own comic book storyboard by bringing your story to lifewithphotography.Plus,innotime,this three-day camp will have youusing your camera’s manual setting! You will begin by using aperture and shutter priorities and graduating to manualbytheendofthecamp.Mustbring your own camera

ExposurePhotoStudio»Mar24 8:00AM-3:00PM Tue 235638

The storyteller - $250 Teen Photography Class This eight-week program teachesstudents the technical, artistic, andemotional aspects of photography throughhighlycreativephotoshoots.Photographeverythingfromfashiontoexplosionstolightpainting.Mustbring your own camera

ExposurePhotoStudio»Jan14-Mar4 3:30-5:00PM Wed 235632

DanCInGbelly Dancing $80This program will introduce participantstothebasicmovementsof theartofbellydance.Workshopincludes warm-up, isolations,technique, combinations, andcool-down. Workshop is geared tobeginners,butisopentoalllevels.

BeattieSchooloftheArtsMcGillCampus»Jan14-Mar4 7:00-8:00PM Wed 235435

Hoop Dancing $40This new form of dance, fitness,and self-expression is electrifying,and it’s inspiring people across the countryandaroundtheworld!Learna variety of basic moves and thenexplore tricks and techniques that will expand your skills This beautiful performance art is a fun workout for building confidence,gettingfit, andhaving fun.Noprevious experienceis necessary Practice hoops will be provided.

OldCourthouse»Feb5-19 6:30-7:30PM Thu 235092

sPoRTs ball sports - Girls only

$35 13-15 yrsJoin us in this program designed for girlswanting to try a variety ofsports.Havefun,meetnewfriends,andenjoysomephysicalactivity!

WestsydeNeighbourhoodCentre»Feb3-24 4:30-5:30PM Tue 233939

ball sports - boys only $35

13-15 yrsJoin us in this program designed forboyswantingto tryavarietyofsports.Havefun,meetnewfriends,andenjoysomephysicalactivity!

WestsydeNeighbourhoodCentre»Feb4-25 4:30-5:30PM Wed 233940

youth Darts $35 15-18 yrsJoin this fun activity! developyour hand-eye coordination,concentration,andmathskillswhilebuildingself-confidenceandmeetingnew friends

WestsydeNeighbourhoodCentre»Jan4-Mar10 233933 Sun 11:00AM-12:00PM Tue 7:00-8:00PM

doyouwanttobeactiveandmakenewfriendthiswinter?CheckoutourPublicSkatingandStickandPuckprograms.Forschedulesandprogramguidelinespleasevisitour

website:www.kamloops.ca/arenas

Public Skating and Stick and Puck

Agameofspeed,power,andagility,wheelchairbasketballisa sport for all ages and abilities! StartingJanuary8everyThursdayat7PM.drop-inswelcome!Sport

chairsprovided.

Wheelchair Basketball

youthNew

New

New

New

New

Page 32: City of Kamloops Winter Activity Guide

30

Parks Tot Lots

WesTsyDe

bRoCKleHURsT

abeRDeen saHalI

valleyvIeW

JUnIPeR RIDGe

Dallas

baRnHaRTvale

baTCHeloR HeIGHTs

MoUnT DUffeRIn

RayleIGH

KaMlooPs InDIan

ReseRve no.1

aberdeenPineviewValleyPark 1925 Hugh Allan DrWestHighlandsPark 1185 Links Way

barnhartvaledallas/Barnhartvale Nature Park 1210 Eliza Rd

batchelor HeightsBatchelor Nature Park 1750 Batchelor Dr

brocklehurstBrocklehurst Park 2470 Fleetwood Ave

Campbell CreekCampbell Creek Nature Park

9080 Trans-Canada Hwy EastCity Centre

Exhibition Park 1055 River StPioneer Park 40 7th AvePrince Charles Park 1145 Nicola StRiversTrailParkBridge 100 Lorne StRiversTrailParkPlace 894 Lorne StRiversidePark 100 Lorne St

SahaliTerraceNaturePark 980 3rd AveWaterfrontPark 20 Mt Paul Way

Heffley CreekTournament Capital Ranch 5355 Yellowhead Hwy

Juniper RidgeThe Kamloops Bike Ranch 1105 Highland RdValleyviewNaturePark 220 Valleyview Pl

Mission flatsMissionFlatsNaturePark 2710 Mission Flats Rd

Mount DufferinKenna Cartwright Nature Park 2000 Hillside Dr

north shoreMcArthurIslandPark 1525-1580 Island ParkwayMcdonaldPark 262 King StOverlanderPark 247 Kitchener Cres

sahaliAlbertMcGowanPark 2025 Summit DrHumphreySanctuary Nature Park 1801 Springhill Dr

Peterson Creek Nature Park 1440 Glenfair Dr

valleyviewJackGregsonWalkingTrail 1598 Lorne St EastValleyviewCentennialPark 2288 Park Dr

WestsydeRiversTrailParkWestsyde 2525 Oak Hills BlvdWestsydeCentennialPark 705 Franklin Rd

1

1 613

14 19

20

21

22

23

24

25

26

27

28

29

15

16

17

18

7

8

9

10

11

12

2

3

4

5

2 23

24 25

16 173 6

2719

18

5

4

28

29

15

22

10 12 14 8

7

9

11 26

13

2021

Page 33: City of Kamloops Winter Activity Guide

31kamloops.ca/recreation 250.828.3500

Tot Lots

WesTsyDe

bRoCKleHURsT

abeRDeen saHalI

valleyvIeW

JUnIPeR RIDGe

Dallas

baRnHaRTvale

baTCHeloR HeIGHTs

MoUnT DUffeRIn

RayleIGH

KaMlooPs InDIan

ReseRve no.1

aberdeenSiftonTotLot 2046 Sifton Ave

batchelor HeightsSouthviewTotLot 1564 Southview Terrace

brocklehurstAcadiaTotLot 1067 Acadia Pl

CambridgeTotLot 637 Cambridge Cres

EdgemountTotLot 2235 Edgemount Ave

InvermereTotLot 845 Invermere Crt

McLeanTotLot 1190 McLean St

SpartanTotLot 1610 Spartan Pl

Campbell CreekCampbellCreekTotLot 8701 Dalls Dr

City CentredominionTotLot 1351 Dominion Cres

KinsmenSouthTotLot 975 Pleasant St

DallasBogettiTotLot 4308 Bogetti Pl

north shore8thTotLot 1153 8th St

BelmontTotLot 709 Cumberland Ave

KinsmenNorthTotLot 605 Comox Ave

MooseTotLot 385 Schubert Dr

RichmondTotLot 601 Richmond Ave

SherbrookeTotLot 1026 Sherbrooke Ave

YewTotLot 514 Mackenzie Ave

RayleighCammerayTotLot 4705 Cammeray Dr

sahaliGlenNevisTotLot 818 Gleneagles Dr

SahaliTotLot 435 Arrostone Dr

West endAllanPowersTotLot 330 Centre Ave

ConnaughtTotLot 225 Connaught Rd

Grandview-dufferinTotLot 461 Dufferin Terrace

McIntoshTotLot 502 Battle St West

WestsydeHookTotLot 1545 Collingwood Dr

RainbowTotLot 670 McCurrach Pl

WestPinesTotLot 616 Harrington Rd

17

813 20

26

27

28

29

21

22

23

24

25

14

15

16

17

18

19

9

10

11

12

2

3

4

5

6

1

637

2829

208 18

2 27

13 1417

17

19 16

23 2625 24

4

5

21

22 11 10 12

parks & tot lots

Page 34: City of Kamloops Winter Activity Guide

32

FamilyUsing Your Five Senses to be WinterActiveEncourageunstructuredactiveplayoutsideinthesnow.JolandaHengstmanfromSixtySecondParenthasanactivitythatnotonlygetskidsoutdoors,butgetsthemthinkingabouttheoutdoors,too.

Takeyourkidsonawalkandhavethemchooseoneofthefivesenses and ask them questions about how they are using that sense

Hearing:Whatdowehear?Isitloudorsoft?Canyoumimicthesound?Thesecanbenaturalsoundsaswellasman-madesounds.

Touch:Canyoutouchsomethingtall,round,oryellow?Isitroughorsmooth?Isitwarmorcold?

sight:Playthegame“ISpy…”oraskwonderingquestionslike,“Howcanyouseeifthewindisblowing?”

Taste: Whatdoyouthink_____tasteslike?doestheairhaveataste?

smell:Whatdoyousmell?doesthishaveasmell?Youmayalsoincreasethefunbychallengingyourkidstorun,jump,hop,skiporslide on snow

for more ways to be active, visit www.activeforlife.ca

Did you knowCooking with kids is a great

way to conect and spend quality time together as a family while teaching little ones important healthyeatinghabits.Sogetcooking with your little chef today! For some hearty and nutritiouswinterrecipes,visit

www.healthycanadians.gc.ca

Page 35: City of Kamloops Winter Activity Guide

John Tod’s New Beginning

Thisfall,thenewlyrenovatedJohn Tod Centre opened its doorsat150WoodStreet.Thenew Centre brings together the operations of the Boys and Girls Club of Kamloops and the KamloopsCommunityYMCA/YWCAinanexcitingandboldnew community partnership thatwillprovideprogramsandservicestochildren,youth,families,seniorsandthe broader community

TheYMCA/YWCAfitnessoperations formerly located inNorthillsMallwillnowbe based in the John Tod Centre,alongwitharangeofotherprogramming,including a toy lending library and a child care resource and referral program

The Boys and Girls Club of Kamloops brings their licensedchildcare,RogersRaisingtheGrade,PowerStart,afterschooldrop-in,summercamp,andotherprogramsandservicesinto the new facility as well Together in the John TodCentre,theKamloopsCommunityYMCA/YWCAand Boys and Girls Club of Kamloops are creating a new space for community

33kamloops.ca/recreation 250.828.3500

aRTs anD CUlTURestorytime fRee at the Museum Join us as we explore pioneer pastimes,worldsoflongago,ancientcivilizations,seasons,andfunstories!Museumstaffwillbereadingpicturebooks and everyone is welcome toattend. After the stories, stay andexplore the Children’s Museum.Pleasepre-register.KamloopsMuseum&Archives»Jan30 10:00-10:30AM Fri 235538

»Feb27 10:00-10:30AM Fri 235539

»Mar31 10:00-10:30AM Tue 235540

In the studio fReeCreate a portrait of yourself using props and backgrounds at the KamloopsMuseum&Archives.Staffwill then take your photo allowing you to take your portrait home to share Dress up as a pioneer or fur trader.Pleasepre-register.KamloopsMuseum&Archives»Feb7 1:00-3:00PM Sat 235589

Chinese new year $1/child at the Museum Celebrate Chinese New Year at the Kamloops Museum. We will bereadingstories,creatingcrafts,andlearning about Chinese culture Adult supervision required. Please pre-register KamloopsMuseum&Archives»Feb19 10:00AM-12:00PM Thu 235550

CooKInGPie in the sky Parent $40 1st Child fRee 8 yrs +An introduction to the world of pies Learn to make a versatile flakypastry, suitable for fruit or savouryapplications Also an introduction to tartsandavarietyoffillings.SouthKamloopsSec.School-LowerCampus»Mar2 6:00-8:00PM Mon 235088

Italian Cooking Parent $40 1st Child fRee

8 yrs +Family members will learn to cook together while preparing basic and traditional Italian recipes that the whole family will enjoy SouthKamloopsSec.School-LowerCampus»Mar5 6:00-8:00PM Thu 235089

DanCInGbelly Dance for fun fReeModelling healthy activities is thebest way to teach our children Join us for this fun, one-day, motheranddaughterclass.Learnthebasicmovementofbellydancing,includingwarm-up, isolations, technique,combinations, and cooldown. Opentoalllevels.TCC-TournamentCapitalCentre»Jan25 1:30-2:30PM Sun 235436

Play anD leaRnDallas Play Group fReeThis is a play group for parents and children under five years old.Comeoutandsocializewithfamiliesfrom dallas and Barnhartvale. Theplay group runs in conjunction with school days Parent participation is required.dallasElem.School»Jan5-Mar9 9:00-11:00AM Mon 230234

sPoRTsfamily sports night $40Joinus for familynight,where youcan play a variety of sports andgames Get some exercise and enjoy fun family time!WestsydeNeighbourhoodCentre»Jan16-Feb6 6:30-8:00PM Fri

family

Did you know

Page 36: City of Kamloops Winter Activity Guide

34

family

FamilydayFestivalandGranFondoisonSunday,February 15 at the Tournament

CapitalCentre.Comeandenjoythefestivities! More info: www.kamloopsgranfondo.ca

Save the DateBenefits of Volunteerig

Career exploration - Volunteering can be an excellent way to learn more about a particular career possibilities Personal Growth - Lifelonglearningincludeshands-onexperiencesasavolunteercanteach you about issues such as environmentaltopublichealthtoanimal welfare socialize - Volunteering can be afun,meaningfulwaytomakenew friends and get to know others who care about the same things you do Have an Impact - Whateveryourpassion,howeveryougetinvolved,volunteeringoffersawaytohavearealandlastingimpact for you and your community

Volunteer Highlightaiden Henderson age 13Aidenhasalovefortheatre,whichleadhimtovolunteerwithX-Fest2014 Volunteering with ProjectXgavehimtheopportunity to connect with professional actors and expand his knowledge ofwhatisinvolvedinproducing a three week outdoor theatre production Aidenalsovolunteersathisschool,BeattieSchooloftheArtsandheisanavidhat collector

Matt,Anna,Nico(4years)andSkyla(1year)enjoydancing,swimming,soccer,bikeriding,andhikingvarioustrailsinKamloopsincluding Kenna Cartwright Park They enjoy 4 seasons weather and like the friendly people they meet when participating in recreational activities.(Annahasbeeninstructingchildren’sdanceprogramswiththe city since 2010)

Active Family

abC family literacy Day:Saturday,January31st from9:00am-12:30pmattheHenryGrubeEdcuation

Centre Kamloops families come together to spend quality timewitheachotherenjoyingcrafts,activitiesand

entertainment from many local talents for more information, phone 250-554-3137 ext. 582

abC family literacy Day

family Day festival & Grand fondo

Page 37: City of Kamloops Winter Activity Guide

35kamloops.ca/recreation 250.828.3500

family

Save the Date

Page 38: City of Kamloops Winter Activity Guide

36

AdultGET WINTERACTIVE

Whilethewintermonthsmayseemliketheperfecttimetocurlup,hibernateandenjoythepleasureofourinhomeelectronics,weencourageyoutotrysomethingdifferentthisyear!Whynotchallengeyourselfto put down the electronics and enjoy some time beinginteractivewithyoursurroundingswithoutthedistractions!

Leavethephoneathome(oratleastinthecar)andtakeasnowyhikewithfriends,tryanewactivitylikecrosscountryskiing,orsimplyruleonedayaweekasadigitaldetox day with the intent of banishing your electronics for thebenefitsofinteractingwithothers.

WhileyoumayfeelmoreconnectedtoothersbyregularlycheckingyouremailandupdatingyourFacebookstatus,research shows that technology addiction is a real concernandcanleadtofeelingsofisolation.Socheckinwithyourself,andhaveagoodlookatyourtechhabits.

Wechallengeyoutodigitally detoxthiswinter,andgetWinteractivewithyourenvironment!

Did you know?TheKamloopsMuseum&Archiveshasanactivecollectionpolicy.Weareinterestedinobjectsthathelp us to tell the story of Kamloops to our many visitors.Ifyouhaveauniqueobjectthatyouwould

liketoseeinthemuseum,giveusacall.

Page 39: City of Kamloops Winter Activity Guide

37kamloops.ca/recreation 250.828.3500

fITness In MoTIon20-20-20 $63 Getajumponyourfitnessgoalswith this perfectly balanced routine: 20minutesofcardio,20minutesofstrength,and20minutesofcore!Thiscalorie-blastingworkoutwillhaveyoutoningandsculptingyour muscles while building your endurance TCC-TournamentCapitalCentre»Jan13-Mar10 5:15-6:15PM Tue 234893

aqua express Circuit $63Get the best of both worlds with this high-intensity, interval-style class.Work your aerobic and anaerobicsystems using circuit training in a non-impact environment. Travelfromstationtostationusingnoodles,weights,andyourownbodyweightfor exciting and challenging exercises while using elements of water running forrecovery.

Canada Games Aquatic Centre»Jan15-Mar12 6:30-7:30AM Thu 234882

back to basics $80Learn the basics of strength

trainingwithaprogressiveprogramgeared towards beginner exercisers andactive agers. This programwillstart in thefitnessstudioandworkintoafull-bodyprograminthegym.At theendofeightweeks,youwillhavetheconfidencetocompletetheprogram on your own

TCC-TournamentCapitalCentre»Jan12-Mar9 10:00-11:00AM Mon 234892

beginner boot Camp $63Are you looking for a great, full-body workout to shake up your fitness routine? This beginner-friendly interval class will combinestrength and cardio drills to get your heart pumping! Enjoy longer rest breaks while experimenting with newequipmentsuchasBOSU®andmedicineballstoaddvarietytoyourworkout!!

WestsydeNeighbourhoodCentre»Jan13-Mar10 6:00-7:00PM Tue 233884

bootcamp $64 18 yrs +

Are you looking to take your exercise routinetothenextlevelwithaheart-pumping,leg-burningworkout?Eachclass will incorporate a different mode oftraining,ensuringadynamic,full-body workout every time, resultinginahealthier,leanerbody.

TCC-TournamentCapitalCentre»Jan12-Mar9 5:30-6:30PM Mon 234894

»Jan14-Mar11 5:30-6:30PM Wed 234895

HIIT - High Intensity Interval Training 18 yrs +Using tabata-style intervals (highintensity training followed by a short rest),youwillblastyourentirebodyforachallengingandrewardingfull-body workout Come prepared to sweatwiththisfast-pacedclass.

TCC-TournamentCapitalCentre $49»Jan14-Mar11 6:00-7:00AM Wed 233886

$47.25»Jan15-Mar12 5:15-6:00PM Thu 233887

WestsydeNeighbourhoodCentre$63

»Jan15-Mar12 6:00-7:00PM Thu 233888

Interval fit Circuit $56Get a great workout, circuit style!This class is a fun, time-efficient,total body workout that combines strength,cardio,core,andflexibilitytrainingusingintervalstationsandavarietyofequipment.

WestsydeCommunityCentre»Jan12-Mar9 6:00-7:00PM Mon 235172

low Intensity Circuit This total body workout is a

circuit-styleclassthatcombinescardiowithcore,flexibility,andstrength training This introductory class is designed for you to work at yourownindividualfitnesslevel.WestsydeCommunityCentre $84»Jan12-Mar9 9:00-10:30AM Mon 235178

$94.50»Jan14-Mar11 9:00-10:30AM Wed 235179

$94.50»Jan16-Mar13 9:00-10:30AM Fri 235180

Power Hour $63Areyou looking forahigh-intensityworkout that includes strength,cardio, and intervals? Ramp upyourmetabolismandfitnessusingavarietyof traditionaland innovativefitnesstechniques.Useballs,bands,BOSU® balls, and weights forstrengthwork,andmixintraditionalaerobics to get your heart pumping Join us for an hour of power!

WestsydeNeighbourhoodCentre»Jan14-Mar11 5:45-6:45PM Wed 233891

adult

Did you know?Drop-in Fitness Classes

Lookingforadrop-infitnessclasses?Seepages48-49forValue Added Fitness Classes

(free to TCC members)

Page 40: City of Kamloops Winter Activity Guide

38

Runners’ Core and flexibility $56Get on the right track for an injury-free season with this class,which focuses on the unique needs of runners.Combinecoreandflexibilityto increase muscle strength while increasing efficiency and promotingmuscle recovery. Join us for yourbest running season yet!

TCC-TournamentCapitalCentre»Jan12-Mar9 6:30-7:30PM Mon 235232

sun Run Walk/Run Clinic $142Get started on a healthy, activelifestylefortheNewYear.SportMedBCand the Cityinvite walkers, novicerunners, and nordic walkers to theInTrainingprogram,whichculminateswiththeVancouverSunRuninApril!Usingagraduatedtrainingprogram,you will be guided through the basics of starting an exercise program Topics covered include footwear,clothing,nutrition,hydration, injuryprevention, and cross-training.Program fee includes an InTraining T-shirt,atraininglogbook,registrationfortheVancouverSunRun,aneventT-shirt,andlotsofexpertadviceandgroup support

Heritage House»Jan17-Apr11 8:30-11:00AM Sat 233382

Water Running $63doyoulovetorun,areyoulookingforsomecross-training,ordoyouhavean injury? This deepwater runningworkoutwillusesimilartoolstoland-based running, including pickupsand drills, to increase your fitnessin a low-impact environment.Workat your own pace for a great way to build your running base without the repetitiveimpactofrunning!

Canada Games Aquatic Centre»Jan13-Mar10 6:30-7:30AM Tue 235235

Weight Room fRee orientationsAreyounewtotheweightroom?doyouhavequestionsabouthowtousethecardioandstrengthequipment?Join one of our certified fitnessprofessionals to learn how to use theequipmentsafelyandeffectively.You will be shown proper technique for various machines and cardioequipment

WestsydeCommunityCentre»Jan14 6:00-7:00PM Wed 235257

»Feb4 6:00-7:00PM Wed 235258

»Feb25 6:00-7:00PM Wed 235259

»Mar11 6:00-7:00PM Wed 235260

ZUMba® 18 yrs +Come join the dance sensation! Zumba® is a fusion of Latin andinternational music that creates a dynamic, exciting, effective fitnesssystem! The dance routines feature aerobic/fitness interval trainingwith a combination of fast and slow rhythms that will tone and sculpt the body

Yacht Club $64»Jan12-Mar9 5:30-6:30PM Mon 235297

TCC-TournamentCapitalCentre $72»Jan14-Mar11 6:30-7:30PM Wed 235298

Hal Rogers $72»Jan15-Mar12 5:30-6:30PM Thu 235299

IfyouhavebeenoutinWestsydelatelyyoumayhavenoticedchangestotheformerWestsydeElementarySchool.TheCityofKamloops is pleased to welcome theWestsydeNeighbourhoodCentre,locatedat3550WestsydeRoad.

Thismulti-usefacilityincludesavarietyofprogramsandservicestofurtherservetheneedsoftheWestsyde,Bachelor Heights and North Kamloops populations

look for winter programs including:

- fitness classes

- yoga classes

- sport Programs for Tots

- Drop In table tennis

- family sport nights

- and much more!

You will also notice improvementstotheWestsydeCommunityCentre(located at 859 Bebek Road) Withanexpandedworkoutarea,andadedicatedstrength room there is somethingforeveryone!

Whetheryouarelookingfora great cardio or strength workout,circuitstyleclasses,aquafitorswimlessonslooknofurtherthantheWestsydeCommunity Centre

Westsyde Neighbourhood

Centre

adult

Did you know?Allofourfitnessclassareratedaseitherbeginner,intermediateor

advanced?Seepg.48-50forindividualcourselevels.

Page 41: City of Kamloops Winter Activity Guide

39kamloops.ca/recreation 250.828.3500

adult

Canada’s Tournament Capital

Kamloops IndoorGranFondo & Family Day Festival!SUNDAY, FEBRUARY 8TH at TCC! 10 AM – 4 PM

EVENT RELATED INQUIRIES: ALEX DE [email protected] • 250-828-3828

GRANFONDO FUNDRAISER: TRINA [email protected] • 250.314.0773

FREE ACTIVITIES FOR THE WHOLE FAMILY!Come enjoy Kamloops’ biggest Family Day celebration

with PacificSport Kidzone Activities, Tots Bike Parade, and a free swim at Canada Games Pool from 1-4 pm!

Interested in cycling and taking part in the MS Society Fundraiser?

FOR MORE INFORMATION VISIT

WWW.KAMLOOPSGRANFONDO.CA

Page 42: City of Kamloops Winter Activity Guide

40

sPInDrills and Hills $63discover indoor cycling with thismotivating workout. This class willinclude a variety of intervals andcycling drills that are guaranteed to challengeyourcurrentfitness level.Workatyourown intensitythroughhill climbs, speed intervals, andactiverecovery!

TCC-TournamentCapitalCentre»Jan13-Mar10 9:00-10:00AM Tue 235305

»Jan14-Mar116:15-7:15PM Wed 235306

»Jan15-Mar12 9:00-10:00AM Thu 235307

High Intensity spin $42Push your limits with this high-intensity spin class designed to increaseyourcardiovascularcapacityand improve your performance.Whetheryouareaweekendwarrior,fitness enthusiast, or just enjoy achallengingworkout,thisclassisforyou. The use of a variety of high-intensity intervals is guaranteed tomakeyousweatwhileyou improveyour strength and power!

TCC-TournamentCapitalCentre»Jan12-Mar9 6:15-7:00AM Mon 235313

simply spin $17.50This 30-minute, entry-level, indoorcycling class will introduce the basic techniques of spinning indoors Learnthe‘howtos’ofindoorcycling,includingbikeset-up,ridingpositions,and drills This class is designed to build confidence and fitness usingsimple drills to prepare you for longer classesinthefuture.*Pleasenote-theWednesdayclassisnotKeeponMoving(KOM)designated.

TCC-TournamentCapitalCentre»Jan13-Feb10 10:00-10:30AM Tue 235315

»Jan14-Feb11 5:15-5:45PM Wed 235316

simply spin and beyond! $21Building on the foundation of SimplySpin,thisclassgoesbeyondthe basics and introduces longer intervals.Learnhow tocomfortablyuse the gears and explore different riding positions on the bike to work at your own intensity for a quality workout! Geared towards the beginner exerciser, this classis a great way to test out a longer class before adding in the intensity of drills and Hills. *Please note -theWednesdayclassisnotKeeponMoving(KOM)designated.

TCC-TournamentCapitalCentre»Feb17-Mar1010:00-10:45AM Tue

235317

»Feb18-Mar11 5:15-6:00PM Wed 235318

spin fusion $94.50 18 yrs +

Enjoy 50 minutes of intense cardio on thespinbike,followedby20minutesofcoreandabwork fora full-bodyworkout.Wrapuptheclasswith20minutes of stretching to balance out the body

TCC-TournamentCapitalCentre»Jan13-Mar10 7:30-9:00PM Tue 235319

spin it, then HIIT it! $94.50 18 yrs +

Join us for 50 minutes of high intensityspin,followedby25minutesof tabata-inspired high intensityintervals! Wrap up this great classwith a relaxing 15 minute stretch

TCC-TournamentCapitalCentre»Jan15-Mar12 7:30-9:00PM Thu 235321

spin to Win 18 yrs +Are you looking for a challenging interval spin class? This class willprogress from week to week in both intensity and interval times. It willcombine drills with speed intervalsand hill climbing alternated with activerecovery.Thisisagreatclassto enhance your current riding,get you ready forwinter sports, orsupplement your current fitnessprogram

TCC-TournamentCapitalCentre $70»Jan12-Mar9 4:30-5:45PM Mon 235322

$94.50»Jan15-Mar12 6:00-7:30AM Thu 235323

adult

Save the Date?didyouknowthatJune6,2015marksthe3rdAnnualNationalHealthandFitnessday?MarkyourcalendarsandwatchformoredetailstocomeintheSpring/SummerActivityGuide!Areyouabusinessinterestedinparticipating?Contactfitness@kamloops.catoseehowyoucan getinvolved.

Page 43: City of Kamloops Winter Activity Guide

41kamloops.ca/recreation 250.828.3500

yoga spin $96Join us for 45 minutes of high-intensity spin, combining differentintensities and drills for a hard workout Finish off with 45 minutes ofyoga, includingaseriesofposeswoventogetherwithbreathtoquietthemindandbuildstrength,balance,focus,andflexibility.

TCC-TournamentCapitalCentre»Jan12-Mar9 7:00-8:30PM Mon 235325

yoGabeginner yoga Bypractisingsimpleyogapostures,breathing exercises, and easymovements, youwill build strengthand flexibility and improve yourposture in a relaxed atmosphere Learnacompleterangeofbasicposesinthisnon-intimidatingenvironment.Modificationswillbeprovidedtohelpyougetthemostoutofeachclass,no matter your fitness level. Noexperience is necessary

TCC-TournamentCapitalCentre $64»Jan12-Mar9 5:15-6:15PM Mon 235328

$72»Jan14-Mar11 7:45-8:45PM Wed 235329

ValleyviewCommunityHall $64»Jan12-Mar9 6:00-7:00PM Mon 235330

WestsydeNeighbourhoodCentre $72»Jan13-Mar10 9:00-10:00AM Tue 235332

$108»Jan14-Mar11 7:00-8:30PM Wed 235333

$72»Jan15-Mar12 9:00-10:00AM Thu 235334

Intermediate yoga $96Yoga is an Eastern approach to a full body/mind workout. If youhavebeenpractisingforoverayearconsistently and would like to deepen yourunderstandingand loveof theyogapostures, breathing exercises,and meditation, then this class isfor you! You will practise a varietyof poses and enjoy powerful yogic techniquesforimprovedenergyandattitude!

WestsydeNeighbourhoodCentre»Jan12-Mar9 7:00-8:30PM Mon 235340

Power yoga $72Whether you are an athlete or aweekend warrior, improve yourstamina, strength, balance,flexibility,andcorewhileinvigoratingyour body! You will be exploring a variety of poses as well as flowingsequences while linking breath with movement.Pastyogaexperience isrecommendedas this class ishigh-intensity

TCC-TournamentCapitalCentre»Jan13-Mar10 6:30-7:30PM Tue 235343

yoga for Relaxation $72Relax your mind while experiencing the soothing meditative qualitiesof yoga by linking breath with movement.Thisclassexploresbasicyoga poses to promote a conscious mind/body relaxationwhileworkingto combat stress and fatigue Poses are held longer to achieve a deep,cleansing stretch for the muscles as well as the mind Each class will conclude with a peaceful, guidedrelaxation for a tranquil end to your day

Hal Rogers»Jan13-Mar10 7:15-8:15PM Tue 235350

ValleyviewCommunityHall»Jan15-Mar12 7:15-8:15PM Thu 235351

PRe anD PosT naTalaquanatal Exercise during pregnancy can help you to prepare physically and psychologically for the demands of labourandchildbirth.Joinacertifiedinstructor to experience safe and weightless exercise By using the natural buoyancy of thewater, youwillstrengthenyourcoreandpelvicmuscles without straining your joints and ligaments Enjoy a beautiful feeling of weightlessness while you experience the benefits of aquaticexercise

WestsydeCommunityCentre $40»Jan15-Feb12 6:30-7:30PM Thu 235352

$32»Feb19-Mar12 6:30-7:30PM Thu 235353

stroller fit - beginner outdoor/Indoor $56Enjoya safe, low-impact classwithyour baby or toddler in his/herstroller.Walkyourselfbackintoshapewithspeeddrills,squats,lunges,andstroller drags

TCC-TournamentCapitalCentre»Jan12-Mar9 1:00-2:00PM Mon 235354

TRaInInG & assessMenTsTrain smart Package $99 (90 minutes) This one-on-one personal trainingsession allows you to discuss your goals with a personal trainer while completinga30-minuteassessmentto establish your baseline fitnesslevel.Thesecond60-minutesessionis spent learning your personalizedfitness program to help yougain confidence in your exerciseprogram

234233

adult

Cancellation PolicyPersonal Training Refund Policy: 24 hour cancellation

notice required No refund or credit for unused sessions Valid for one year from the date of purchase

Page 44: City of Kamloops Winter Activity Guide

42

Personal Training add-onsOnce you have completed a TrainSmartpackage,youcanaddadditional60-minutepersonaltrainingsessions.These appointments can be made at your convenience, whether youwould like to meet regularly to help with motivation or just when yourequire updates to your program

1 session $65234234,234235,234236

4 sessions $250234237,234238

12 sessions $690234239,234240

Train smart, with a friend! $320Put a fun twist on one-on-onepersonal training and bring a friend! This semi-private session packagewith a personal trainer will help build your motivation while addressingyourpersonalgoals.Thefirstsessionwillincludeanassessment,followedbythree60-minutesessionstogainconfidence in your new exerciseprogram

234241

Train smart assessment with a Kinesiologist $150If you have an injury, chroniccondition,orconcernsaboutthesafetyofexercise,thisprogramisdesignedforyou!Completeacomprehensivefitness assessment and exerciseprogram with a Kinesiologist. Withfocused education ranging from chronic disease to orthopaedics,working with a Kinesiologist will help you meet your fitness goals safelyand effectively (program includestwo 60-minute sessions). Contact250-828-3742forinformation.

235741

Train smart with a Kinesiologist add-ons These 60-minute sessions aredesigned with the client’s specificrehabilitation needs in mind Clients must first complete a Train Smartassessment with a Kinesiologist

4 sessions $280235742

8 sessions $540235743

12 sessions $780235745

sPoRTsCo-ed volleyball $55Allskill levelswillenjoyaneveningof recreational volleyball. This is agreatwaytokeepactive,havefun,and meet new people Beginners are welcome!

MarionSchillingElem.School»Jan13-Mar3 7:45-9:45PM Tue 233733

»Jan15-Mar5 7:45-9:45PM Thu 233734

Women only Competitive volleyball $70Competitive volleyball for womenonly! Players sign up individuallyand will be placed on teams at the first session. Previous volleyballexperience and an understanding of 6-2-5-1rotationsarerequired.

JuniperRidgeElem.School»Jan6-Mar10 6:30-9:30PM Tue 233735

floor Hockey - Co-ed $40If you are looking for ways to make new friends and have fun whilegetting fit, give floor hockey a try.Teams and game schedule will be created depending on the number of players Please bring your own floor hockey stick. Registration feeiswaivedforgoalieswiththeirownequipment

dufferinElem.School»Feb4-Mar11 6:30-8:00PM Wed 233732

learn to Play Co-ed Ice Hockey - beginner $72Learn skating skills, stick handling,and puck control techniques,and finish off the session with ascrimmage. Full gear and CSA-approvedhelmetarerequired.

InteriorSavingsCentre»Jan11-Feb1 11:00AM-12:30PM Sun 233737

learn to Play Co-ed Ice $80 Hockey - IntermediateEnhance your skills!With the focuson individual skill development andtherulesofthegame,thisprogramprovides a unique experience forall players Beginner program recommended Full gear required

MemorialArenaandInteriorSavingsCentre»Feb8-Mar8 11:00AM-12:30PM Sun 233738

adult

Wheelchair BasketballAgameofspeed,power,andagility,wheelchairbasketballisasportforallagesandabilities!startingJanuary8everyThursdayat7PM.drop-inswelcome!

Sportchairsprovided.

See page 11 for registration details.

Peter Mahaits

New

Page 45: City of Kamloops Winter Activity Guide

43kamloops.ca/recreation 250.828.3500

adultTennis eZ Play - $65 beginnerThisfour-weekprogramprovidesanintroductiontotennisfundamentals,including basic technique and tactics The clinic is in partnership with the KamloopsTennisCentre.Ifrequired,racquets can be purchased at the Kamloops Tennis Centre

Kamloops Tennis Centre»Feb2-Mar2 6:30-8:00PM Mon 234876

Tennis eZ Play - $75 Intermediate This program is for players who have previous tennis experienceand understand basic positions in doubles You will learn ball control andpolishyourservingandvolleyingskills

Kamloops Tennis Centre»Mar9-30 6:30-8:00PM Mon 234877

DanCInG

belly Dance Workshop $90This program will introduce participantstothebasicmovementsof the sensual art of belly dance Workshop includes warm-up,isolations, technique, combinations,andcool-down.Workshop isgearedto beginners, but is open to alllevels.

BeattieSchooloftheArtsMcGillCampus»Jan14-Mar4 7:00-8:00PM Wed 235434

Introduction to $45 Hoop Dance This new form of dance, fitness,and self-expression is electrifying,inspiring people across the country and the around world! You will be introduced to a variety of basicmoves,and thenexplore tricksandtechniques that will expand your skills This beautiful performance art isafunworkoutforthemind,body,and soul. No previous experienceis necessary Practice hoops will be provided.

OldCourthouse»Feb5-19 6:30-7:30PM Thu 235592

Irish Dancing I $130 Reel fun A high-energy, fun class in whichdancers will learn the basics of soft shoe Irish dancing Dancers will develop grace, poise, and goodposture while learning the steps of the Beginner Reel and Beginner Jig. develop physical and mentalskills through listening and following instruction and aerobic exercise Some team dancing and ceilidhdancing will be introduced at the end of the course

SouthKamloopsSec.School»Jan8-Mar12 7:45-8:45PM Thu 234166

latin Dance $165 Couple $90 singleThe Cha Cha is one of the most popularofthesocialLatin-Americandances.Thelively‘one,two,chachacha’rhythmisflirtatious,andfullofpassion and energy. Everybody canlearn the Cha Cha!

SouthKamloopsSec.School»Jan12-Mar9 7:00-8:30PM Mon 235032

aRTs anD CUlTURearchives orientation $4 at the MuseumLearnallabouttheMaryBalfArchiveslocated in the Kamloops Museum& Archives. Join the archivist andexplore the collection, learn howto access resources and start researching your topic today

KamloopsMuseum&Archives»Jan31 10:00-11:30AM Sat 235532

Museum Guided Tour $4Join Kamloops Museum & Archivesstaff for a guided tour of all the latest exhibits, galleries, and displays.Gain a greater understanding and appreciation of Kamloops’ history,learnaboutthelivesoflocalpioneers,and hear some interesting stories

KamloopsMuseum&Archives»Feb12 12:00-1:00PM Thu 235541

»Mar14 3:00-4:00PM Sat 235542

How to Manage your Personal archives $4JointheKamloopsMuseumarchivistand learn all about preservingyour personal archival documents,familyphotographs,andmultimediamaterials. discover the basics ofarchival preservation and explorevarious options and resources forprotecting your personal treasures

KamloopsMuseum&Archives»Mar7 10:00-10:45AM Sat 235533

Peter MahaitsPeterhasbeenavolunteerattheKamloopsMuseum&Archivesforfiveyears.Peterdoesarchivalfilingand research and assists the museum curator As aretiredCNlocomotiveengineer,Peter’sknowledge of trains and railway equipment has beenveryvaluabletothemuseum

New

Page 46: City of Kamloops Winter Activity Guide

44

Creative Writing $125 WorkshopThis interactive course incorporatesthe generating of ideas, plotdevelopment,useofthefivesenses,pace,setting,andediting,allleadingto the writing of short stories There will be several stress-freewriting activities per session in asupportive atmosphere. The courseisappropriateforthosewritingfictionandnon-fiction.

SouthKamloopsSec.School»Jan26-Mar2 7:00-9:00PM Mon 235438

face Painting - $50 beginners This workshop offers tips on how to face paint Face painting can bring out the artist in anyone! Fee includes a facepainting kit ParkviewActivityCentre»Mar10 6:30-8:30PM Tue 233882

face Painting - $60 advanced Learn how to face paint like aprofessional with appropriate products and tools. If you havepreviousexperienceorattendedtheFace Painting - Beginnerworkshop,thisworkshopisforyou.Mustbringyour own facepainting supplies

ParkviewActivityCentre»Mar31 6:30-8:30PM Tue 233883

Guitar - level 1 $90Have you always wanted to playtheguitar, butnevergot around toactually starting? In this fun, non-intimidating setting, you will learnthe very basics of playing guitar,includingidentificationofthepartsofthe guitar and learning some chords and simple melodies

NorkamSec.School»Jan21-Mar11 6:45-7:45PM Wed 235548

Guitar - level 2 $90This program is intended for beginners who have had a smallamount of experience on the guitar and would like to learn a bit more Participants should feel comfortable playing a few chords prior to taking this class You will learn some basic chord progressions, a scale, anda song, as well as explore finger-picking techniques

NorkamSec.School»Jan21-Mar11 8:00-9:00PM Wed 235549

Knit Circle fReeKnitters of all ages and skill levelsare invited to spend time togetherknitting and chatting about their projects. Bring your own yarn,needles,scissors,andsupplies.

Heritage House»Jan14-Mar25 6:30-8:30PM Wed 235554

Photography - Intro $30 to Digital PhotographyIntended for new users of digital cameras or for anyone considering a new digital camera, this sessionwill address such topics as digital photography vs. film, megapixels,and what to look for in a digital camera.Wewilllookatvarioustypesofdigital cameras,postprocessing,and storage

SahaliSec.School»Jan6 7:00-8:30PM Tue 234786

Photography - Posing Women $150Learn how to pose your subject inways that will make your client fall in love with themselves. The keyto selling images is in making the subject feel beautiful In this full day class, wewill explore the secret tocreating the hourglass shape and posing subjects inways that flattertheir body type

ExposurePhotoStudio»Jan10 10:00AM-3:00PM Sat 235633

Photography - Composition $40Intended for those people who want to take their photos beyond the snap shotlevel.Joinanexperiencedlocalphotographer to examine easily applied composition techniques used by the pros to produce those special photos These techniques can be applied immediately and used with any type of camera Cameras are required Tripods recommended

SahaliSec.School»Jan13 7:00-9:00PM Tue 234986

Photography - beyond $85 Point and shoot Learn to be more creative withyour camera andmove beyond themanufacturer’s settings Each of the threeclassesisastand-alonetopic,so you can register separately or sign upforallthree.Learnaboutapertureand depth of field, shutter speed,and low light photography Each classisastandalonetopic,andyoucan register separately for specifictopics Cameras required and tripods strongly recommended

SahaliSec.School»Jan20-Feb3 7:00-9:00PM Tue 234787

Photography - aperture and Depth of field $40In thisBeyondPoint&Shootclass,learntobemorecreativewithyourphotos! discover how to produceimages that highlight subjects while blurring background and foreground clutter These skills are particularly usefulwhenphotographingportraits,flowers,pets,andwildlife.

SahaliSec.School»Jan20 7:00-9:00PM Tue 234789

adult

Register Now!

New

Page 47: City of Kamloops Winter Activity Guide

45kamloops.ca/recreation 250.828.3500

SchedulesJoinustotryover15fitnessclassesthatrangefrombeginnertoadvanced.ClassesarefreetoTCCmemberswithamonthlyorannualpass*.

Attendatleastoneclassthroughouttheweektobeeligibletowinafree13weekfitnessclassintheSpringof2015.

Entries available at the Tournament Capital Centre (Wellness Centre) beginning January 5, 2015

*Notamember?Noproblem,purchaseadropinfitnesspassbeforethestartofyourclass. **Limitedtothefirst19participants.

Mini Fitness Session “Try before you buy!”

MonDay, JanUaRy 5 TUesDay, JanUaRy 6 WeDnesDay, JanUaRy 7 THURsDay, JanUaRy 8 fRIDay, JanUaRy 9

High Intensity spin**6:15-7:00AMSpinStudio

High Intensity Interval Training (HIIT)6:00-7:00AMNorth Court

Gentle Circuit8:00-9:00AMFieldhouse

Gentle Circuit8:00-9:00AMFieldhouse

Gentle Circuit9:00-10:00AMFieldhouse

Drills & Hills**9:00-10:00AMSpinStudio

Gentle Circuit9:00-10:00AMFieldhouse

Gentle Circuit9:00-10:00AMFieldhouse

iflow Challenge12:10-12:55PMFitnessStudio

Drills and Hills**12:10-12:55PMSpinStudio

Core strength12:10-12:55PMFitnessStudio

Drills and Hills**12:10-12:55PMSpinStudio

High Intensity Interval Training (HIIT)12:10-12:55PMFitnessStudio.

Runner’s Core and flexiblity6:30-7:30PMFitnessStudio

Gentle Touch yoga1:00-2:00PMFitnessStudio

Zumba6:30-7:30PMFitnessStudio

High Intensity Interval Training (HIIT)5:15-6:00PMFitnessStudio

Page 48: City of Kamloops Winter Activity Guide

46

admission Policy: Children 6 years of age or under must always be accompanied in the water and be within arm’s length of a parent or other person 16 years of age or older Ratio of children6yearsorundertoparent/guardianmustbenogreaterthanthreetoone.

Diving boards: Childrenmustbe7yearsofageoroldertousethe3mor5mdivingboards.

Hot Tub, steam Room, and sauna: Children 12 years of age and under must be accompanied by a parent or guardian (16 years or older)

Waterslides: Childrenunder42in.(1.07m)inheightarenotpermittedonthewaterslide.Children6yearsofageandunderwhomeettheheightrestrictionmustbecloselysupervisedbyanadult.Singleridersonly-nochainsormultipleridersallowed,includingparentswithchildren.Seeposted“WaterSlideRules”forfulldetails.

Wellness Centre and Weight Room: Youthages12-17mustcompleteanorientationpriortousingtheweightroom.Uponcompletionofanorientation,youthages12-14MUSTbedirectlysupervisedbyapayingadult.dryshirts,shorts,andclose-toedshoesarerequired.

ViewourCodeofConductandHealthandSafetyRulesatwww.kamloops.ca/swim.

our goal is to promote a safe and positive swim. Please review with all posted safety rules and report to a lifeguard if you need assistance.

• All persons who are not toilet trained MUST wear a swim diaper.

IMPoRTanT safeTy InfoRMaTIon

CanaDa GaMes aQUaTIC CenTRe

CanaDa GaMes Pool fees effective Jan 1, 2014-Dec 31, 2015

*25mlaplanesunlessotherwisenoted.•*Poolspacemaybelimitedduringlessontimes•Poolcloseddec12-14(swimmeet)Visitkamloops.ca/swimforChristmasschedule(dec20-Jan4)•Schedulesubjecttochange.

schedules

910McGillRoad effective January 5-March 13, 2015 250-828-3655

MonDay TUesDay WeDnesDay THURsDay fRIDay saTURDay sUnDayPoolOpenLapandLeisure*

6am-11pm(50m6-8am) 6am-11pm 6am-11pm

(50m6-8am) 6am-11pm 6am-11pm(50m6-8am) 8:30am-9pm 7:30am-9pm

Waterslide 6:30-9pm 6:30-9pm 6:30-9pm 6:30-9pm 6:30-9pm 1-4pm6-9pm

1-4pm6-9pm

divingBoardsand Deep End 7:30-9pm 7:30-9pm 7:30-9pm 7:30-9pm 6:30-9pm 1-4pm

6-9pm1-4pm6-9pm

Sauna,SteamRoom,andHotTubs

6am-11pm 6am-11pm 6am-11pm 6am-11pm 6am-11pm 7:30am-9pm 7:30am-9pm

Swimming Lessons*

9-11:30am3-7:30pm

9-11:30am3-7:30pm

9-11:30am3-7:30pm

9-11:30am3-7:30pm 3-6:30pm 8:30-11:30am

3-7pm8:30-11:30am

3-7pm

Aquafitness(Deep) 9-10am 9-10am 9-10am 9-10am 9-10am

Aquafitness(Aqualite) 11am-12pm 11am-12pm

KCSMasters Swimming 6:30-7:30pm 6:30-7:30pm 6-7am

sInGleaDMIssIon

PUnCH CaRD (10 aDMIssIons)

PUnCH CaRD (40 aDMIssIons)

Toddler(0-3) fRee!

Child(4-13) $3.75 $31 $114

Youth(14-18) $5.25 $45 $160

Adult(19-59) $7 $60 $208

Senior(60+) $5.25 $45 $160

Familydrop-in $3.75each(max$16) n/a $114

(1 punch per person)

sPeCIal RaTes•EarlyBirdandNightOwl:$3.75-firstandlasthour,MondaytoFridayonly.•LiquidLunch:$3.75-11:30am-12:30pm,MondaytoFridayonly.•LessonRate:$3.75-EnjoyaswimorsoakinthehottubwhileyourchildisinaCityofKamloopsswimlesson.oTHeR aDMIssIon InfoRMaTIon•Afamilyisamaximumoftwoadultsandallchildrenaged18yearsandunderwhoarerelatedbybirth,legalstatus,ormarriageandlivingwithinthesameresidence.Alegally

dependent person with a disability will qualify regardless of age Please note that the family punch card can only be used for adult admission when swimming with an eligible child or a legally dependent person with a disability •

•Patronswithadisabilitypaytheagerateandtheircareaideisadmittedforfree.

Page 49: City of Kamloops Winter Activity Guide

47kamloops.ca/recreation 250.828.3500

WesTsyDe Pool anD CoMMUnITy CenTRe

*Allfeaturesavailable.Somepoolfeaturesopen.¤OnlyavailableOct4-dec13.†Poolspacemaybelimitedduringlessontimes.Visitwww.kamloops.ca/swimfortheweeklyWackyWednesdayeventthemeandtheChristmasschedule(dec20-Jan4).

Schedulesubjecttochange.Weightroommaybeoccasionallyunavailabletoaccommodatelandfitnessclasses.

WesTsyDe Pool fees effective Jan 1, 2014-Dec 31, 2015

Make Your Next PartY a SPlaSh!

schedules

We offer a variety of formats, times and days to guarantee fun!

Ask about our swim pass goody bag stuffers!Visit kamloops.ca/swim for pool party details.

859 Bebek Road effective January 5-March 13, 2015 250-828-3616

MonDay TUesDay WeDnesDay THURsDay fRIDay saTURDay sUnDayEveryoneWelcomePublicSwim* 6:30pm-8pm 6:30pm-8pm

WackyWednesday 6:30pm-8pm 1-4pm 1-4pm

EveryoneWelcomeLeisureSwim

12:30-2pm3-6:30pm

2-5:30pm6:30-8pm

12:30-2pm3-6:30pm

2-5:30pm6:30-8pm

12:30-2pm3-6:30pm 9:30am-1pm*

LapSwim 6-10:30am12:30-6:30pm

2-5:30pm6:30-8pm

6-10:30am12:30-6:30pm

2-5:30pm6:30-8pm

6-10:30am12:30-6:30pm 9:30am-1pm*

Sauna,SteamRoom,and Hot Tub

6-10:30am12:30-8pm

2-5:30pm6:30-8pm

6-10:30am12:30-8pm

2-5:30pm6:30-8pm

6-10:30am12:30-8pm

9:30am-1pm*1-4pm 1-4pm

SwimmingLessons† 3-6:30pm 3-7pm 3-6:30pm 3-7pm 3-6:30pm 9:30am-1pm

Aquafitness(Shallow) 9-10am 9-10am 9-10am

Aqualite 2-3pm 2-3pm 2-3pm

Aquafitness (Deep) 5:30-6:30pm 5:30-6:30pm

WeightRoom 6am-8pm 6am-8pm 6am-8pm 6am-8pm 6am-8pm 9:30am-1pm*1-4pm¤ 1-4pm

sInGleaDMIssIon

PUnCH CaRD (14 aDMIssIons)

PUnCH CaRD (40 aDMIssIons)

one MonTHPass

Toddler(0-3) fRee!

Child(4-13) $3.25 $37.50 $96 $26

Youth(14-18) $3.75 $45 $115 $32

Adult(19-59) $5 $61 $155 $45

Senior(60+) $3.75 $45 $115 $32

Family* $3.25each(max$13) $37.50(1punchperperson) $96(1punch

per person) n/a

WeightRoomOnly $3.75 $45 $115 $32

sPeCIal RaTes anD oTHeR aDMIssIon Info•TalktoaCustomerRelationsRepresentativeformoreinformationonswimpasses.•LessonRate:$3.25-EnjoyaswimorhottubwhileyourchildisinaCityofKamloopsswimlesson.•Afamilyisamaximumoftwoadultsandallchildrenunder18yearsofagewhoarerelatedbybirth,legalstatus,ormarriage.

A legally dependent person with a disability will qualify regardless of age •Patronswithadisabilitypaytheagerateandtheircareaideisadmittedforfree.

Page 50: City of Kamloops Winter Activity Guide

48

Tournament Capital Centrefitness schedule Winter 2015

Formoreclassinformationandcoursecodes,seepages37to58orvisitwww.kamloops.ca/ezreg.*GentleCircuitparticipantsarerequiredtopurchaseatrackpass.Patronswithoutatrackpasswillbesubjecttoregularfitnessdrop-infees.**ValueaddedclassesarefreetoTCCpassholders(monthlyandannual).Patronswithoutamembershipwillbesubjecttoregularfitnessdrop-infees.Pleasenote:unlessotherwiseindicated,theagepolicyonallfitnessclassesrequiresparticipants(registeredordrop-in)tobe13yearsorolderatthetime of participation Instructors and classes are subject to change without notice

LEGENd

= Mild/all levels - For beginners or those returning to exercise after an extended absence These classes are gentle on the joints with low to no impact

= Intermediate -Forindividualswhoarecurrentlyexercisingandarelookingforamorechallengingclass. Theseclassesmayfeatureintervals,strengthtraining,andmoreadvancedexercises.

= advanced -Forexperiencedexerciserswhoarelookingforahighintensityclasswithadvancedexercisetechnique. Theseclassesmayincludehighintensityintervals,cardiovascularcomponentsandstrengthtraining.

REGISTERTOdAYBYCALLING250-828-3500

Register now!

Oops! We cancelled it ...…becausewedidn’tknowyouwantedit!

Weencourageyoutoregisteratleastoneweekprior to class so we can reduce class cancellations

schedules

MonDay TUesDay WeDnesDay THURsDay fRIDay

MoR

nInG

HighIntensitySpin6:15-7:00am

WaterRunning6:30-7:30am

HIIT (High Intensity IntervalTraining) 6:00-7:00am

SpintoWin6:00-7:30am

Gentle Circuit 8:00-9:00am*drop-in

Aqua Express Circuit

6:30-7:30am

Drills and Hills 9:00-10:00am

Tai Chi (Beginner) 8:30-9:30am

Gentle Circuit 8:00-9:00am*drop-in

Gentle Circuit 9:00-10:00am*drop-in

Osteofit19:45-10:45am

Gentle Circuit 9:00-10:00am*drop-in

Gentle Circuit 9:00-10:00am*drop-in

SimplySpin10:00-10:30am

Tai Chi (Intermediate) 9:45-10:45am

Drills and Hills 9:00-10:00am

SimplySpinandBeyond! 10:00-10:45am

(Feb 17)

Osteofit19:45-10:45am

Back to Basics 10:00-11:00am

Osteo211:00am-12:00pm

SensationalSurvivors

11:00am-12:00pm

Osteofit2 11:00am-12:00pm

Page 51: City of Kamloops Winter Activity Guide

49kamloops.ca/recreation 250.828.3500

Tournament Capital Centrefitness schedule Winter 2015

TCC Annual Full Facility pass holders enjoy a 50% discount on most TCC and Westsyde fitness classes.only available when registering by phone or in person.

REGISTERTOdAYBYCALLING250-828-3500

schedules

MonDay TUesDay WeDnesDay THURsDay fRIDay

afTe

Rnoo

n

iFlow Challenge 12:10-12:55pm**Value Added

Drills and Hills 12:10-12:55pm**Value Added

CoreStrength12:10-12:55pm**Value Added

Drills and Hills 12:10-12:55pm**Value Added

HITT-HighIntensityIntervalTraining12:10-12:55pm** Value Added

StrollerFit1:00-2:00pm

Gentle Touch Yoga 1:00-2:00pm

Aquatic Gentle Fit 2:00-3:00pm

Aquatic Gentle Fit 2:00-3:00pm

Aquatic Gentle Fit 2:00-3:00pm

SensationalSurvivors 2:00-3:00pm

SpintoWin 4:30-5:45pm

even

InG

Beginner Yoga 5:15-6:15pm

20/20/205:15-6:15pm

SimplySpin5:15-5:45pm

HITT-HighIntensityIntervalTraining5:15-6:00pm

Boot Camp 5:30-6:30pm

SimplySpin&Beyond5:15-6:00pm

(Feb 18)

Boot Camp 5:30-6:30pm

Runners' Core and Flexibility6:30-7:30pm

Power Yoga 6:30-7:30pm

Drills and Hills 6:15-7:15pm

YogaSpin7:00-8:30pm

SpinFusion7:30-9:00pm

ZUMBA® 6:30-7:30pm

SpinitthenHIITit!7:30-9:00pm

Beginner Yoga 7:45-8:45pm

Page 52: City of Kamloops Winter Activity Guide

50

Community-based fitness schedule Winter 2015

Westsyde fitness schedule Winter 2015REGISTERTOdAYBYCALLING250-828-3500

REGISTERTOdAYBYCALLING250-828-3500

Formoreclassinformationandcoursecodes,seepages37to58orvisitwww.kamloops.ca/ezregPleasenote:unlessotherwiseindicated,theagepolicyonallfitnessclassesrequiresparticipants(registeredordrop-in)tobe13yearsorolderatthetimeofparticipation.Instructors and classes are subject to change without notice

LEGENd

= Mild/all levels - For beginners or those returning to exercise after an extended absence These classes are gentle on the joints with low to no impact

= Intermediate - Forindividualswhoarecurrentlyexercisingandarelookingforamorechallengingclass. Theseclassesmayfeatureintervals,strengthtraining,andmoreadvancedexercises.

= advanced -Forexperiencedexerciserswhoarelookingforahighintensityclasswithadvancedexercisetechnique. Theseclassesmayincludehighintensityintervals,cardiovascularcomponentsandstrengthtraining.

TCC Annual Full Facility pass holders enjoy a 50% discount on most TCC and Westsyde fitness classes.only available when registering by phone or in person.

schedules

MonDay TUesDay WeDnesDay THURsDay fRIDay

MoRnInG

Beginner Yoga 9:00-10:00am

WestsydeNeighbourhoodCentre

Beginner Yoga 9:00-10:00am

WestsydeNeighbourhoodCentre

LowIntensityCircuit9:00-10:30am

WestsydeComm.Centre

LowIntensityCircuit9:00-10:30am

WestsydeComm.Centre

LowIntensityCircuit9:00-10:30am

WestsydeComm.Centre

ZUMBA®Gold11:00am-12:00pm

WestsydeNeighbourhoodCentre

ZUMBA®GoldToning11:00am-12:00pm

WestsydeNeighbourhoodCentre

afTeR-noon

IntervalFitCircuit6:00-7:00pm

WestsydeComm.Centre

Beginner Boot Camp 6:00-7:00pm

WestsydeNeighbourhoodCentre

Power Hour 5:45-6:45pm

WestsydeNeighbourhoodCentre

HIIT-HighIntensityIntervalTraining6:00-7:00pm

WestsydeNeighbourhoodCentre

evenInGIntermediate Yoga

7:00-8:30pmWestsydeNeighbourhood

Centre

Beginner Yoga 7:00-8:30pm

WestsydeNeighbourhoodCentre

Aquanatal 6:30-7:30pm

WestsydeComm.Centre

MonDay TUesDay WeDnesDay THURsDay

MoRnInGZUMBAGold

11:00am-12:00pmYacht Club

afTeR-noon

Gentle Touch Yoga 1:30-2:30pm

Hal Rogers

evenInG

ZUMBA®5:30-6:30pm

Yacht Club

ZUMBA®5:30-6:30pm

Hal Rogers

Beginner Yoga 6:00-7:00pmValleyviewHall

Yoga for Relaxation 7:15-8:15pm

Hal Rogers

Yoga for Relaxation 7:15-8:15pmValleyviewHall

Page 53: City of Kamloops Winter Activity Guide

Events in Kamloops

51kamloops.ca/recreation 250.828.3500

schedules

PUblIC sKaTInG evenTs & PRo D Days ArenasCome on out and check out our freeevents&Proddaysthisseason.SponsoredbyTimHortons.For information: www.kamloops.ca/arenas

WaCKy WeDnesDaysWestsyde Pool6:30pm - 8:30pmevery Wednesday, starting Jan. 7FunActivitieswithanewthemeeachweekFor info: 250-828-3378 or [email protected]

DIM sWIMCanada Games Aquatic Centre6–9pmevery saturday, starting Jan. 10Allattractionswillbeopen,lowlight,musicrequests&sportactivities.For information: 250–828–3754 or [email protected]

UnPlUG & Play lITeRaCy WeeKDaily events • January 24–31Find a healthy balance between technologyandbeingactive.AnumberoforganizationsofferingFREEactivitiesthroughttheweekFor information: 250 828 3611 or www.literacyinkamloops.com

MayoR’s Gala foR THe aRTsCoast Kamloops Hotel and Coference Centresaturday, January 31Everyyearourcommunityleadersgatheratthisprestigiouseventtocelebrate and support the professional artsinKamloops-TheKamloopsArtGallery,KamloopsSymphonyandWesternCanadaTheatre. Ticketsare$125perpersonatKamloopsLive! BoxOffice250-374-5483or www.kamloopslive.ca

PUT yoUR HeaRT InTo ITTCC, Westsyde & Community Fitness ClassesMonth of februaryAttend2fitnessclasseseachweekin february to enter to win the grand prizeofafreeclassintheSpringsession For information: (250) 828–3698

sPIn yoUR HeaRT oUTTournament Capital CentreMonth of februaryEachspinclasswillcompetetocoverthe most distance in February! Push the pace to win a free class in the Springsession.For information: 250-828–3698

KaMlooPs InDooR GRan fonDo & faMIly fesTIvalTournament Capital Centre10am–4pm • Sunday Febuary 93rd Annual Family Day weekend! JoinourMSSocietyFundraiserbyregistering for the Kamloops Indoor GranFondo! Family Fun all day with FREEFor information: 250–828–3828 orwww.kamloopsgranfondo.ca

PRo–D sWIMCanada Games Aquatic Centre12–3pm • February 20All attractions open For information: 250–828–3754 or [email protected]

WeaR ReD DayThroughout the communityall DayFebruary 20 is wear red day! SupportHeartandStrokeawarenessby wearing your best red shirt to school,orwork!For information: 828–3698

HealTHy HeaRT faIRTournament Capital Centre9am–1pmStopbytheTCCforthe4thannualhealthyheartfair!Learnabouthealthynutrition,checkyourbloodpressure,learnaboutAEd’sandsomuch more A face painter will be on sitefrom9-11am,aswellasaPro-dSwimfrom12-3pm.For information: 250–828-3698

annUal KaMlooPs aRTs CoUnCIl’s aRT exPoseDKamloops Old Court House Cultural CentreFebruary 27 • 6pm–8pm opening night february 28 - March 810:00am-5:00pmThis open exhibition and art sale providesemerginglocalartistsofallageswithconstructivecriticismandvisibility.Itlsanexcellentopportunity for the artists to build their resume and compete with peers All mediums are welcome For information: 250–372–7323 or www.kamloopsarts.com

annUal sPRInG bReaK evenTCanada Games Aquatic Centre11am–9pm • March 16–27Ancient Empires theme Games,activities&prizes.For information: 250–828–3754

sPRInG bReaK CaMP aT THe KaMlooPs MUseUMMuseum & Archives9am–4pm • March 18–21Jointhekamloopsmuseum&archivesthisspringbreak!Exploreall the treasures hidden behind closeddoors,discoverpastworlds&learnallaboutlocalhistory.dosomething different this spring break!For information: 250–828–3576 orwww.kamloops.ca/museum

JaM Can 2015Kamloops Curling Club8am–5pm • March 28–29An opportunity For children ages 6–12 years to try the sport of curlingFor information: 250–372–5432

Jan

2

Jan

7

Jan

10

Jan

24

Jan

31

feb

1

feb

1

feb

8

feb

20

MaR

28

feb

20

feb

20

feb

27

MaR

17

MaR

18

Page 54: City of Kamloops Winter Activity Guide

52

WeaR a HelMeTBraininjuryisthenumberonekilleranddisablerofpeopleundertheageof45.WearingaC.S.Aapprovedhelmetistheeasiestwaytopreventbraininjurywhileontheice.

PaRTy on THe ICe!HostapartyontheiceduringourpublicskatesessionsonFriday,SaturdayorSunday’satValleyviewArena.The$85admissionincludes:2hour pre-determinedpublicskatesession,3hourprivatepartyroomrental,insurance fees and 10 skate admissions A total of 25 participants can be accomodated in the party room Additional skate passes can be purchased Formoreinformationvisit www.kamloops.ca/arenas or call 828-3653 to book your party

PUblIC sKaTInG/sTICK & PUCKPreschool(0-4) fReeChild(4-13) $3.75Youth(14-18) $4.50Adult(19-59) $5.50Seniors(60+) $4.25Family (up to 4) $11.00

DRoP-In HoCKeyAdult(19-59) $6.50Goalies fRee

To view currenTcancellaTions,

schedules & evenTs please visiT

www.kamloops.ca/arenas

Toreceivethemostcurrentwebversionandinformation,youneedtoclearyourinternet cache and refresh your browser

noT sURe HoW?Contact Nicole Beauregard

at 250-828-3653

Did You Know?

Did You Know?

aDMIssIon RaTesCashOnly(smallbillsappreciated)

Check out our punchcard rates at www.kamloops.ca/arenas

ThatBrockandValleyviewArenasallowpatronsinwheelchairsonthe ice during public skate sessions Helmets are mandatory for the

person in the wheelchair The wheelchair attendants must wear a helmet and skates

PUblIC sKaTInG,sTICK & PUCK,& DRoP In HoCKeyWinter2015

Page 55: City of Kamloops Winter Activity Guide

53kamloops.ca/recreation 250.828.3500

adultPhotography - shutter $40 speedIn thisBeyondPoint&Shootclass,examine how shutter speed settings allow us to capture those images of silky waterfalls, circular star trails,freeze sports action and so muchmore In addition we will be seeing how to use ‘bursts’ to capturemovement such as kids, pets, orathletes Cameras are necessary and tripods strongly recommended

SahaliSec.School»Jan27 7:00-9:00PM Tue 234790

Photography - low $40 light and IsoIn thisBeyondPoint&Shootclass,wewillexplorethevastrealmoflowlight photography. Learn how ISOsettings and the Histogram allow most modern dSLRs to be used insituationswhereeventhehumaneyehasdifficulty.Someflashphotographywill also be covered. Join us asweenter an area of photography that is oftenoverlooked.

SahaliSec.School»Feb3 7:00-9:00PM Tue 234791

Photography - adobe lightroom and Photo Critiquing $150 This six-hour class is designedto introduce intermediate levelphotographers to the world of Adobe Lightroom-apowerfulphotoeditingtool. Studentswill be given severalshooting objectives with groupfeedbackandcritique.Studentswillneed a digital camera that has the abilitytocaptureinRAW.

ExposurePhotoStudio»Feb8 10:00AM-4:00PM Sun 235635

Cell Phone Photography $40discoverhowtouseyourcellphoneto produce truly outstanding images No longer limited to the popular and fun selfies and snapshots,users of newer model cell phones are producing outstanding images Learntousefreeprocessingappstoproduce stunning images

SahaliSec.School»Feb17 7:00-9:00PM Tue 234987

flower Photography $125For those of you that are passionate aboutcapturingimagesofflowersandbotanicals-thisistheclassforyou!The class is designed to help guide you through the process of seeing flowers as a piece of art, focusingoncomposition,backgroundchoice,lighting and lens choice. Studentswillneedatripod,acamerathathastheabilitytoswitchto‘Manual’,andabunchofyourfavouriteflowerstophotograph This class will be held indoors and will be working with natural light!

ExposurePhotoStudio»Mar1 11:00AM-3:00PM Sun 235636

Printmaking - beginner $45

Learn the basics of printmakingto create beautiful greeting cards,using everyday household objectssuch as wool, bubble wrap, paperclips,andcardboard.Allsupplieswillbeprovided.

OldCourthouse»Jan24 10:00AM-12:00PM Sat 235443

»Feb11 6:00-8:00PM Wed 235444

spanish - beginner $95This fun, informal class is designedfor individualswhohave littleornoexperiencespeakingSpanish.LearnbasicSpanishgrammarandhowtoread,write,andspeakSpanish.Bookis extra

SouthKamloopsSec.School»Jan12-Feb4 7:00-9:00PM Mon,Wed 233193

Heritage House»Jan12-Feb5 9:00-11:00AM Mon,Thu 233194

spanish - Intermediate $95This program will build on the skills learned in the beginner Spanishclass or if you feel you are ready for an intermediate class Intermediate Spanishisdesignedforthosewantingtoimprovetheirconversationalskills.Book is extra

SouthKamloopsSec.School»Feb16-Mar11 7:00-9:00PM Mon,Wed 233195

Heritage House»Feb16-Mar12 9:00-11:00AM Mon,Thu 233197

spanish - advanced $95This class is designed to continue developing and enhancingcommunicationskillsoftheSpanishlanguage. Previous participantsof the Intermediate class can continue building their confidencewith interacting in various socialsituations

Heritage House»Jan12-Feb5 11:30AM-1:30PM Mon,Thu 233198

»Feb16-Mar12 11:30AM-1:30PM Mon,Thu 233199

New

New

New

New

Page 56: City of Kamloops Winter Activity Guide

54

The art of letter fRee WritingLivinginthetechnologicalageofsocialmedia and instant communication,rediscovering the lost art of letterwriting is an enjoyable journey From choosing stationery and writing utensils, to practicing penmanship,you will enjoy this workshop learning the art of letter writing

KamloopsMuseum&Archives»Jan24 1:00-3:00PM Sat 235596

Watercolour - $120 beginners Fun and easy projects are designed to teach basic techniques and build confidence for students to painta basic landscape or a flower. Noexperienceneeded!Mustbringownsupplies

SouthKamloopsSec.School»Feb3-Mar10 7:00-9:00PM Tue 235442

Watercolour - $105 open studioFully explore your favouritetechniquesfrompreviousclassesatyour own pace in the open studio watercolour session. You will havethe chance to review techniquesfrom the beginners’ class and work independently Guidance and gentle criticism will round out the experience

SouthKamloopsSec.School»Jan20-Mar10 6:45-9:00PM Tue 235440

CooKInGspanish Tapas $45Want to add some Spanish flair toyour appetizer repertoire? Learn tomakeavarietyofSpanishtapas.

NorKamSec.School»Jan12 6:30-9:30PM Mon 235087

Cajun Cuisine $45Cajun cooking is one of the hottest cuisines around. Learn to createsome amazing cajun recipes fromaround the world

SouthKamloopsSec.School-LowerCampus»Jan22 6:30-9:30PM Thu 235090

Gluten-free baking $45This program will cover the basicsof gluten-free baking. A variety ofalternatives to wheat flour will beused and discussed Participants will alsotakehomeabagofgluten-freebaking mix This program is offered in partnership with Interior Community Services.

Mt.PaulUnitedChurch»Jan24 9:00AM-12:00PM Sat 235082

Gyoza $45 (Japanese Dumplings) Pork gyoza are Japanese-styledumplings that are a popular appetizerchoiceatmanyrestaurants.Theycanbesteamed,boiled, fried,or deep-fried. Learn how to wrap,fry,andmakethebeststuffinganddipping sauce

SahaliSec.School»Feb10 6:30-9:30PM Tue 235084

Thai $45discover and cook traditional Thaicuisine using common ingredients such as lemon grass, ginger, andkaffirlimeleaves.

NorkamSec.School»Feb12 6:30-9:30PM Thu 235091

Crêpes $45Learn to create the perfect crêpe.This delicate French thin pancake is excellent in many applications -appetizer,entree,ordessert.

NorkamSec.School»Feb16 6:30-9:30PM Mon 235086

Canning $45Learn the art of food preservation!This class takes a step-by-stepapproachtothetechniquesinvolvedin canning. Learn in an hands-onenvironment. This program is inpartnership with Interior Community ServicesCommunityKitchens.

Mt.PaulUnitedChurch»Feb21 9:00AM-12:00PM Sat 235083

Teriyaki Chicken $45Teriyaki chicken is one of the most popular meal choices at Japanese restaurantsinCanada.InJapanese,‘teri’meansshinyorglazedand‘yaki’means grilled or baked You will learn to properly prepare the chicken and makeadelicious,homemadeteriyakisauce

SahaliSec.School»Feb24 6:30-9:30PM Tue 235085

adultNew

New

New

New

Page 57: City of Kamloops Winter Activity Guide

55kamloops.ca/recreation 250.828.3500

Cardiovascular Rehabilitation and Prevention

For more information please contact: 250 314-2727

VASCULARIMPROVEMENT

PROGRAM

LUNGHEALTH

SWEET MOVESDIABETES

EDUCATION

ONTRACK

For more information please contact: 250-851-7976

For more information please call the Diabetes Education Program at 250-314-2457

Speak to your doctor for a program referral or for more information please contact 250-828-3742

The Strategic Health Alliance is a relationship between the City of Kamloops and Interior Health. The exercise programs delivered through this innovative partnership offer individuals with chronic conditions a way to get moving using the clinical expertise of medical staff in a

recreation setting. All Strategic Health Exercise programming is by Physician referral.

StrategicHealth Alliance

FOR REFERRAL FORMS, PLEASE VISITWWW.KEEPONMOVING.CA/PHYSICIANS

Page 58: City of Kamloops Winter Activity Guide

Adults55+,previouslyActiveAgersisasectionofourActivityGuidecommittedtooffering

programmingtokeeptheagingpopulationactiveand engaged Don’t let the title of this section

fool you! The programming in this section may be enjoyed by anybody aged 18 years and older

Adult 55+

56

Adult 55+No Bake Holiday Wreath Cookies: Yield:about11/2dozen Cooktime:3Minutes Preptime:25Minutes Other:30Minutes

Ingredients:

•1(12-oz.)packagevanillacandycoating,brokenup •Greenpastefoodcoloring •21/2cupscoarselycrushedminishreddedwholewheat cereal biscuits •Minicandy-coatedchocolatepieces,redcinnamoncandies,swirledholidaywhitemorsels

Directions: MicrowavevanillacandycoatinginamediumbowlatMEdIUM(50%power)3minutes,stirringaftereveryminute.Stirindesiredamountoffoodcoloring.Addcereal,stirring gently to coat Drop cereal mixture by heaping tablespoonfuls onto wax paper; shape each spoonful into a wreath.decoratewithassortedcandies.Letcookiesstandabout 30 minutes untilfirm.

Cookingisawonderfulactivitytodowiththelittlepeople in your life The holiday season brings us together whether we are a family by birth or a family by choice The age of technology means that many youngsters areconstantlydistractedbyscreens.Whynottakeadvantageoftheopportunitytoconnectandmakesomememories (don’t forget the camera!) The kids will feel a great sense of accomplishment when they show off their finishedproduct.Hereisarecipetotrywithgrandkidsorspecial little friends:

Page 59: City of Kamloops Winter Activity Guide

57kamloops.ca/recreation 250.828.3500

fITness In MoTIonaquatic Gentle fit Acertifiedinstructorinarthritis,

post-rehabilitation therapy, andaquatic fitness leads this program.Classes progress by building on each other to safely challenge your physicalfitness.

Canada Games Aquatic Centre

$24»Jan12-Feb2 2:00-3:00PM Mon 234883

$30 »Jan14-Feb11 2:00-3:00PM Wed 234884

$30 »Jan15-Feb12 2:00-3:00PM Thu 234885

$24 »Feb16-Mar9 2:00-3:00PM Mon 234886

$24 »Feb18-Mar11 2:00-3:00PM Wed 234887

$24 »Feb19-Mar12 2:00-3:00PM Thu 234888

Gentle Circuit Drop-indesignedforthebeginnerexerciser,this circuit covers everything fromwalking to strength exercises to offer aunique,full-bodyworkout.Combineimproved balance, strength, andcoordination training with cardio to start exercising in a safe and fun environment.

TCC-TournamentCapitalCentre»Jan5-Mar13 Mon,Wed,Fri 9:00-10:00AM Tue,Thu 8:00-9:00AM

Gentle Touch yoga This class is for those participants whofindregularyogaclassestobea little toomuch.Enjoy a fun, non-intimidating class that includes the use of chairs and modified poseswhile working on bringing greater mobilityandflexibilitytothejoints.If you are experiencing any stiffness associatedwithagingor injury,thisclassisforyou!Eachclasswillhaveaten-minutebreakandconcludewithguided relaxation

Hal Rogers $64»Jan12-Mar9 1:30-2:30PM Mon 235358

TCC-TournamentCapitalCentre $72»Jan13-Mar10 1:00-2:00PM Tue 235359

Tai Chi (beginner) $54The practice of Tai Chi has been shown to improve one’s balance,body awareness, power ofobservation, memory and overallwell-being.Learnthefirst29TaiChibeginnermovesinanon-judgmental,supportiveatmosphere,taughtbyanexperienced Tai Chi instructor

TCC-TournamentCapitalCentre»Jan14-Mar11 8:30-9:30AM Wed 235360

Tai Chi (Intermediate) $54Ifyouarecomfortablewiththefirst36movesoftheTaiChiset,youmayready for the rest of themoves inthe intermediate session Continue to improveyourbalance,memoryandco-ordination in a fun and relaxedenvironment.

TCC-TournamentCapitalCentre»Jan14-Mar11 9:45-10:45AM Wed 235482

active aging

The Clubhouse

The Clubhouse is a program withinCanadianMentalHealthAssociation(CMHA).Avarietyofprograms/servicesinourcommunityfor adults 18+ years with a diagnosis of a mental illness tohelpmaximizetheirindependence within the community

The Clubhouse offers healthy,recreationalactivities;referralstoothercommunity support and programs; and assists in learning life skills A varietyofservicesareavailabledailysuchas:meals/snacks,clothingdonations,supportstaff,laundryservices,andcomputer access to name a few

If you require any additional information please contact sheena Christian at (250) 374-0440 [email protected]

Page 60: City of Kamloops Winter Activity Guide

58

Zumba® Gold Zumba® Gold targets the largestgrowingsegmentofthepopulation-babyboomers.IttakestheZumba®formula and modifies the movesand pacing to suit the needs of the active aging participant, as well asthose just starting their journey to afitandhealthylifestyle.Whatstaysthe same are all of the elements theZumba®FitnessPartyisknownfor - zesty Latin music like salsa,merengue, cumbia, and reggaeton;exhilarating, easy-to-follow moves;and an invigorating, party-likeatmosphere

Yacht Club $64»Jan12-Mar9 11:00AM-12:00PM Mon 233892

WestsydeNeighbourhoodCentre $72»Jan14-Mar11 11:00AM-12:00PM Wed 233893

Zumba® Gold Toning $72Are you looking to take your Zumba®classtothenextlevel?TheZumba®GoldToningclasscombinesthe excitement and exhilaration of a traditional Zumba® class withstrengthtraining.Jointhemovementand help build muscle strength,mobility, posture, and coordination.Specifically adapted for the activeolder adult or beginner exerciser,this class combines all the benefitsoffitnesswiththefunatmosphereofZumba®!

WestsydeNeighbourhoodCentre»Jan16-Mar13 11:00AM-12:00PM Fri 233895

sPeCIalTy fITness

Osteofit 1 Are you at an increased risk for

osteoporosisorhaveyousufferedafracture in the past?Join a certifiedinstructor to increase your fitnesslevel safely and effectively byimproving posture and balance.Build stronger muscles and bones while decreasing the risk of falls and fractures This class is also appropriate for participants with arthritis or osteoarthritis, as wellasbeginner exercisers

TCC-TournamentCapitalCentre $60»Jan13-Feb12 9:45-10:45AM Tue,Thu 235361

$48»Feb17-Mar12 9:45-10:45AM Tue,Thu 235362

Osteofit 2 Safely progress your exercisefromOsteofit1withthismorechallenging class, building on

the principles learned in Osteofit1.Increase your balance, strength,and coordination with exercises designed to challenge you in safe andfunenvironmentwhilemanagingyour risk for falls and fractures!

TCC-TournamentCapitalCentre $30»Jan13-Feb10 11:00AM-12:00PM Tue 235364

$24»Feb17-Mar10 11:00AM-12:00PM Tue 235365

$30»Jan15-Feb12 11:00AM-12:00PM Thu 235366

$24»Feb19-Mar12 11:00AM-12:00PM Thu 235367

sensational survivors $115This all-women, cancer-specificexercise program will provide youwith a safe way to exercise in all stages of treatment and recovery.You will work one-on-one with anexercise professional to create an exercise program specific to you,followedbysixweeksoftwice-weekly,supervisedgroupexercisesessions.Please contact 250-828-3742 formore details

active aging

January is Alzheimer’sAwarenessMonth.

This year the theme is ‘seeme,notmydisease’

Did you know?

KeepOnMovingdesignatedexercise programs are a safe and fun way to keep

yourselfactive.Fitnessclassesareidentifiedwiththelogothroughouttheactivityguide.Formoreinformation,pleasevisitwww.keeponmoving.ca

Page 61: City of Kamloops Winter Activity Guide

ThattheSeniorsQuickGuideisresourcetooldevelopedforseniorsandtheircaregiverstohelpnavigatethehealth,wellnessandsocialservicessystemlocally,provinciallyandnationally.CheckoutAccessKamloopshttp://www.accesskamloops.

org/toviewtheSeniorsQuickGuide.

Did you know?

59kamloops.ca/recreation 250.828.3500

active aging

sPoRTsDrop-in badminton $30

Punch CardEveryone is welcome to join in thefun sport of badminton!Bring your racquet and enthusiasm.For $30,participants can purchase a punch card at TCC, Westsyde Pool, orKamloopsMuseum&Archives.

TRU-ThompsonRiversUniversity»Jan5-Mar9 9:30-11:30AM Mon

»Jan9-Mar6 9:30-11:30AM Fri

Drop-in Pickleball $30 Punch Card

Pickleball is a cross between badminton and table tennis It uses a lightweight wooden paddle and a whiffle ball.Learn the basic skills,techniques, and rules of the gamewith an emphasis on fun!For $30,participants can purchase a punch card at TCC, Westsyde Pool, orKamloopsMuseum&Archives.

TRU-ThompsonRiversUniversity»Jan5-Mar9 8:00-10:00AM Mon

»Jan7-Mar11 8:00-11:30AM Wed

»Jan9-Mar6 8:00-10:00AM Fri

SummitElem.School(for beginner players only)»Jan6-Mar10 7:00-9:00PM Tue

Drop-in Table Tennis $30 Punch CardEveryone is welcome to join us inplaying table tennis It is a great way togetsomephysicalactivityinalow-impact sport and meet new friends Punchcardscanbepurchasedfor$30atTCC,WestsydePool,orKamloopsMuseum&Archives.

WestsydeNeighbourhoodCentre»Jan8-Mar12 7:15-9:15PM Thu

January is Alzheimer’sAwarenessMonth.

This year the theme is ‘seeme,notmydisease’

Did you know?

PAR-QAreyouplanningtobecomemorephysicallyactive?Toensureyoursafetyinallfitnessclasses,pleasereviewthePAR-Qat:csep.ca/cmfiles/publications/parq/parq.pdfpriortoyourparticipation.Ifyouhaveconcernsregardingyoursafety

please speak to your physician

Page 62: City of Kamloops Winter Activity Guide

60

InTeResTeDIn beCoMInG

a CoaCH?Check out our Coach Enhancement Ad on page 66 for more

information!

JoinusonFebruary20thand21stforthefirsteverPhysicalLiteracyandHealthSummitinKamloops!

Save the Date

Did you know?FromFebruary13-March1,2015,PrinceGeorgeandNorthernBritishColumbiawillplayhostto2,400athletes,1,000coachesandofficials,upto4,500volunteers,hundredsofmediaand

thousandsofvisitorsattheCanadaWinterGames. Followyourfavoriteeventsandathleteshere:

http://www.teambc.org

WHO ARE WE? Theprovincialnetworkofeightnot-for-profitPacificSportcentrescollaboratetosupportincreasedsportparticipationandimprovedsportperformancethroughoutBC.Thesemulti-sportcentresarecommitedtodevelopingsportatalllevelsbyintegratingathleteservices,coachingeducationandphysicalliteracyopportunities.WeserviceKamloops,100MileHouse,Merrit,SalmonArm,Revelstoke,Golden and all areas in between throughout the interior region

PacificSportInteriorBCwouldliketothanktheCanadianSportInstitutePacific,ViaSportBCandtheProvinceofBritishColumbiafortheirsupportofourBC-basedsportinitiativesatallstagesoftheCanadianSportforLife(CS4L)continuum.

Interior BC

Page 63: City of Kamloops Winter Activity Guide

61kamloops.ca/recreation 250.828.3500

Finally...wecanofficiallysayCONGRATULATIONSdYLANonyour2008OlympicBronzeMedalANd2010InternationalAthletics Federation Indoor WorldChampionshipBronzeMedal!!dylanArmstrongisCanada’sfirstOlympicmedallist in a throwing eventinalmostacentury.Armstrong made his OlympicdebutatBeijing2008 where he initially finishedfourth,missingoutthebronzebyjust one centimetre Ittooksixyears,butCanadian shot putter Dylan Armstrong is finallygettinghisOlympicmedal!Thiscomes a year after third-placeholderAndreiMikhnevichofBelarus was hit with a lifetime ban for doping dylanisatwo-timePan American Games goldmedallist(2007,2011) and the 2010 Commonwealth Games Champion and also wontheoveralltitleinshot put for the 2011 diamondLeague.dylanhopes to compete at the 2015 world outdoor championships in Beijing andthe2016OlympicGames in Rio de Janeiro GoodLuck,dylan!

Check out our Programs!Availabletoallmembersof

the community

Dylan Armstrong2008 Olumpic Bronze Medalist

in Shot Put

Athlete Profile

pacific sport

PaCIfICsPoRT InTeRIoR bC910McGillRoad Kamloops BC V2C 6N6Fax250-828-3619

LookforusonFacebookFacebook.com/PacificsportInteriorbc

www.pacificsportinteriorbc.com

Carolynn boomerGeneralManager [email protected]

eryn bulmer barrettSportPerformanceCoordinator250-828-3583ebarrett@pacificsport.com

Katie KlassenSportParticipationCoordinator/[email protected]

Josée WarrenSportdevelopmentCoordinatorMerrittOffice250-315-1075jwarren@pacificsport.com

Powering sport - What We DoPacificSportcentresofferavarietyofprogramsandservicesforBC-basedathletes at all stages of the Canadian SportforLife(CS4L)continuum.

sport Participation and DevelopmentGrassroots programs that support physical literacy and ensure that BC youth have the opportunity to beinspired by sport and lead a healthy andactivelifestyle.

sport Performance and leadershipHigh-performance programs thatprovide BC athletes and coachesaccesstotrainingfacilities,innovativesportsciencetechniques,andsupportservicestoprovideeveryadvantageto win medals for Canada

education and advocacyOpportunitiesforsporteducationatalllevelsoftheCS4Lpathwayincludingcurrent and interactive seminars,workshops, and conferences thatassist in furthering community sport developmentandperformance.

support and ResourcesSpecialized equipment, technologyinnovations, and grants to assistwith the transfer and acquisition of knowledge, technical, and tacticalimplementation as well as the administrativeprogressoflocalsportorganizations.

PacificSport ProgramsFor more information or to register for any of these programs, contactPacificSport at 250-828-3583, orvisitourwebsite:

www.pacificsportinteriorbc.com.

Group/team rates are available formost programs:

$100foragroupof8-12

$150foragroupof12-15

ContactPacificSportformoredetails!

Page 64: City of Kamloops Winter Activity Guide

62

Visit www.pacificsportinteriorbc.com to sign up for our monthly newsletter!

pacific sport

sPoRT PeRfoRManCe PRoGRaMsOpen to all athletes, coaches, andparents

WorkshopsareFREEforallIPSandPacificSport carded athletes andcoaches

For a complete listing of all sport performance programs, workshops,and new additions to the calendar in 2015,pleasegoto

www.pacificsportinteriorbc.com/index.php?p=3_1.

PRo D Day WoRKsHoPsPacificSport is offering a series ofSportPerformanceWorkshopsonProD days Expand your knowledge and improve your performance withoutmissing school or team practices! The workshopsareFREEforPacificSport-registered athletes, and will beoffered on February 20 and April 20

nCaa scholarships $20 and Recruiting 14+ yrsA basic introduction to the NCAA systemwillteachyouhowtonavigatethe recruiting process and market yourself to coaches in order to earn a scholarship. Ken Olynyk, TRUAthletic director and coach, leadsthis workshop, which will focus onathleteself-marketingstrategies,SATexams, as well as decision-makingtools that are important to potential CISathletes.

TCC-TournamentCapitalCentre»Feb20 1:30-3:00PM Fri 235392

CoaCH eDUCaTIon WoRKsHoPsfield Testing Kit 18+ yrs Coach Training The field testing kits provide thenecessarytoolsforserviceprovidersto assess the physiological parameters of their athletes using Best Practice as well as system alignment with the Canadian Sport for Life model.These kits are equipped to do a general battery of tests to assess leg power,speed,balance,coordination,muscular endurance, and aerobicpower

video analysis and 18+ yrs Dartfish Training Theseworkshopsprovideinstructionon enhanced performance feedback through effective use of videotechnology. Coaches will leave theworkshop with resources and access tovideoanalysisequipment.Topicscoveredwillinclude:

- How biomedical principles driveperformance analysis;

-Choosingtherightvideoequipment;and

-Videoanalysisbestpractices,fromtapingtoreview.

BC Athletics and the Kamloops Track&FieldClubareextremelypleased to announce that Olympian,WorldAthleticsChampionship800mSilverMedallistandCanadianRecordHolderat800m,GaryReed,is returning to Kamloops to assume the role of Interior BC Regional Athletics Coach–Middledistance&Cross Country beginning September2014.Retiredfromcompetitivetrackandfieldindecemberof2010,aftercompetingsincetheageof13,Gary’seight year professional running career included twoOlympicGamesandsixWorldChampionships.His new role will allow him to connect with developingathletes,coaches,schoolsandclubs in both the Interior andOkanaganRegionsof British Columbia It is excitingtohaveachampionin the community who will continue the ongoing developmentofAthleticsin Canada and help shape our future track champions WelcomebacktoKamloops,Gary!

Gary ReedReginal Athletics Coach

Middle Distance & Cross Country

Coach Profile

Prince George is hosting thefirsteverCanadaWinterGamesinBritishColumbia in February 2015 This is the third

time British Columbia has hosted a Canada Games as NewWestminsterhostedtheCanadaSummerGames in 1973 and Kamloops in 1993

CWG Fun Fact

Page 65: City of Kamloops Winter Activity Guide

63kamloops.ca/recreation 250.828.3500

pacific sport

COACH ENHANCEMENT PROGRAMSNCCP COACH CERTIFICATIONThe National Coaching Certi�cation Program (NCCP) is a coach training and certi�cation program o�ered in over 66 sports across Canada. The NCCP is a collaborative program of the Government of Canada, provincial/territorial governments, national/provincial/territorial sport organizations, and the Coaching Association of Canada. For more information, visit ViaSport's website at www.viasport.ca. This fall, we will be running the following coach training courses. Please visit our website, www.paci�csportinteriorbc.com, for more details.

Are you looking for the NCCP Level 1, 2, or 3 courses? The modules

have been renamed Intro to Competition and Introduction to Competition Development.

For more information, please contact Paci�cSport or ViaSport BC.

Register for NCCP programs by phone at 250-828-3500 or online at www.kamloops.ca/ezreg.

All courses will be located at the Tournament Capital Centre (TCC), 910 McGill Road. For more information about any of the NCCP coach training courses, please contact Eryn Bulmer Barrett, Sport Performance Coordinator, at ebarrett@paci�csport.com or 250-828-3583, or visit our website at www.paci�csportinteriorbc.com.

NCCP Competition Introduction Modules NCCP Competition Introduction Modules3-Course Bundle: Teaching & Learning, Designing a Basic Sport Program, and Basic Mental Skills. Jan 17 and 18. $99. Course No. 235387.Jan 17 - Teaching & Learning - 8:30 am-4:30 pm. $80. Course No. 236433.Jan 18 - Designing a Basic Sport Program - 8:30 am-12:30 pm. $60. Course No. 236434. Jan 18 - Basic Mental Skills - 1:30-4:30 pm. $45. Course No. 236435.

Psychology of PerformanceFeb 21, 8:30 am-12:00 pmInstructor: Glenn Armstrong.$40 Course No. 235389.

Coaching and LeadingApr 17, 6:30-9:30 pm, and Apr 18, 8:30 am-4:30 pmInstructor: Glen Armstrong.$95 Course No. 235391.

Planning a PracticeMar 14 - 8:30 am-4:30 pm$80 Course No. 235390.

Changes to Competition Introduction Module Delivery - Former Part A and BPreviously, the six multi-sport modules were o�ered as stand alone or grouped into Part A or Part B workshops. (Part A: Making Ethical Decisions, Planning a Practice, and Nutrition; and Part B: Design a Basic Sport Program, Teaching & Learning, and Basic Mental Skills). The Coaching Association of Canada has moved away from using the language Part A and B in reference to these modules, so they stand alone like the Competition Development modules. Save money and register for the course module bundles, or just sign up for the individual module you need for your sport-speci�c certi�cation requirements!

COACHES' CORNERCoaches' Corner is a great opportunity for coaches and sport administrators to learn and network. Join us for fun and informal "lunch and learn" sessions on the following dates:

JANUARY 15 and MARCH 1212:00 noon SHARP

Frick and Frack Restaurant, 577 Victoria Street

RSVP to Eryn Bulmer Barrett, Sport Performance Coordinator

250-828-3583ebarrett@paci�csport.com

Prince George is hosting thefirsteverCanadaWinterGamesinBritishColumbia in February 2015 This is the third

time British Columbia has hosted a Canada Games as NewWestminsterhostedtheCanadaSummerGames in 1973 and Kamloops in 1993

CWG Fun Fact

Page 66: City of Kamloops Winter Activity Guide

64

pacific sport

sPoRTMeD bC WoRKsHoPsSportMedBCworkshopsareofferedin collaboration with SportMed BC,and are open to coaches, athletes,and parents These workshops are often approved for BCRPA/CMTBCContinuing Education credits A certificate of completion will beissued

» Athletic Taping

»ConcussioncManagementWorkshop

»SportsFirstAid

»SportSmart

For more information, visit www.sportmedbc.com/eventsorcallAlexat604-294-3050ext.107.

affIlIaTeD sPoRTs

alPIne sKIInGsun Peaks alpine ski ClubOurgoalistopromotealpinesportsas healthy, enjoyable activities forpersons of all ages and abilities,while focusing on building character athletes through the sport of alpine ski racing Go to www sunpeaksracers catoexploreorNGSL,U14,andU16programs,orvisitusonFacebookatSunPeaksRacers.

The nancy Greene ski league (nGsl)» “FUNdamental” stage of ski racing forchildren5-12yearsofage.» Introduces basic skiing techniques and skills and develops the ABCs(agility, balance, coordination,strength/speed).» Children have the option ofparticipating in competitions with other clubs in the Interior Programs runonSundays from thefirstweekof January to theendofMarch.For more information, contact PamJacoby (NGSL rep) at pjjacoby@shaw ca

bC alpine U14/U16 series» This is the next step after completing the Nancy Greene SkiLeague(NGSL)program.»Opentoallathletesages12-15todevelopracingandskiingskillsandprogress according to ability » Experienced coaches provide astrong technical foundation » A low-stress, low-cost program,withzonecompetitions.» Program runs weekly from mountain opening to the end of ski season For more information, contact LisaSmillie(U14/U16rep)atlisasmillie@telus net

Harper Mountain ski ClubRioTintoAlcanNancyGreeneSkiLeague Ages4-12 Program Coordinator: Robert Brettell harperskiclub@gmail com 250-579-0104 Visit www harpermountain com for more information » The Harper Mountain Ski Club(HMSC),established in1973,offersalpine ski racing instruction for childrenages4-12 inafun,family-oriented atmosphere » Club members participate in the Nancy Greene Ski League and aretaughtalpineskiracingutilizingtheHuskySnowStarProgram(Canada’sNationalAlpineSkiSkilldevelopmentProgram)bycertifiedskiinstructors/coaches » HMSC offers a freestyle programfor kids ages 8-14 (limited spaceavailable). The freestyle programis geared towards kids possessing advancedskierabilitywhowouldliketotryanalternativetoalpineracing.Moguls,park,pipe,aerials,andbigmountain disciplines will be explored and theirvarious techniques taughtin a fun and engaging atmosphere by certified park and freestyleinstructors » Both programs (alpine racing and freestyle) will offer the athletes an opportunity to compete against other clubs at various mountainsthroughout the Interior (competing is not mandatory) The HMSC winter season programsrun Sundays, January throughMarch,from9:30amto2:30pmatHarperMountain(a20-minutedrivefromKamloops).Clubfees:$350

aTHleTICsKamloops Track and Field Club Head Coach: Oleg Bondarchuk (allevents)National Throws CentreCoach: Dr Anatoly BondarchukBC Reginal Coach: Gary Reed Office:250-851-2512www.kamloopstrackandfield.ca

about UsThe Kamloops Track and Field Club has a proud history of producing successful athletes. We currentlyemploya full-timeHeadCoachanda National Throws Coach and many part-timecoaches toensurequalityprograms from the grassroots to the high-performanceathlete,aswellasamastersprogram.Wearecommittedtoensuringthatallparticipantshaveapositiveexperience!

Training facilitiesSeptembertoMarch-TCCFieldhouseApriltoAugust-HillsideStadium

Programs» Cross-country - Middle distance(AllAges):Fitness-basedtrainingforanyathlete(3days/week).

» Track Rascals (Ages 6-8): Trackand field fundamentals and fun(6weeks,1day/week,Wednesdays,5:00-6:00pm).

» Juniordevelopment (Ages9-12):Introduction to track and field andbasicskills(15-16weeks,2-3days/week),TuesdaysandThursdays.

» Midget (Ages 13-15): Advancedtraining opportunities No attendance rules (15-18 weeks, 4-5 days/week)

»Juvenile,Junior,Senior(Ages16+):Specialized training opportunities.Mandatoryattendance(16-18weeks,5days/week).

» Masters (Ages 35+): All-roundtraining. All events are covered (3days/week).

RegistrationForinformationonwinterprograms,visit www.kamloopstrackandfield.caorcallHeadCoach,OlegBondarchuk,at250-819-1512.

Page 67: City of Kamloops Winter Activity Guide

65kamloops.ca/recreation 250.828.3500

baseballCoach: Ray Chadwick rchadwick@tru ca

The TRU WolfPack baseball teamplays all of its games at Norbrock Stadium,locatedonMcArthurIsland.Home games are played as double headers, usually on Saturdays andSundays. League play starts inMarchandfinishes inApril,withanexhibition schedule in the fall

basKeTballContact:KenOlynyk kolynyk@tru caCoach:JoeEnevolsonwww kamloopsbasketball com

Girls - Grade 6-12SixSessionsCoach:ScottReeves

Kamloops basketball academyMore information and registrationforms at www kamloopsbasketball com

Canoe/KayaKKamloops Canoe and Kayak ClubShumwayLake

www kamloopscanoeandkayakclub ca Forclubinformation,email: info@kamloopscanoeandkayakclub ca ClubPresident:BethMorgan 250-851-9862 BCRegionalCoach:StanMarek

Sprint canoe and kayak racing areverysuccessfulCanadiansportsandour athletes continue to medal at theOlympicGames.Sprintracingisa great form of exercise that instills discipline,determination,andagoodwork ethic, skills that athletes willutilizetherestoftheirlives.Membersof Kamloops Canoe and Kayak Club can train in both disciplines of the sport, canoe and kayak. Levels ofcompetition vary from recreationalto highly competitive. For moreinformation, please visit ourwebsite

CRoss-CoUnTRy sKIInGoverlander ski ClubCross-countrySkiingCoach:danaManhard250-573-6024dmanhard@shaw cawww.overlanderskiclub.com

ProgramscommenceOctober8,seewebsite for details

Programs»SkiLeagueages5-8

»SkiLeagueages8-12

»Juniordevelopmentages12-20

Annual program

»Mastersprogramages20+

» Introductory or skill developmentlessons for all ages and abilities

Formoreinformationonanyprograms,visit www.overlanderskiclub.com.The programs offer age-specificskills following the Cross Country Canadadevelopmentmodel. Cross-country skiing is a “lifetime” sport suitable for individuals and familiesof all ages and abilities

CURlInGCurl bCRegional Coach: Brenda Nordinbnordin@curlbc ca250-329-6038

McArthurIslandCurlingClubwww mcarthurislandcurlingclub com250-554-1911micc1@telus net

Kamloops Curling Club700VictoriaStreetKamloops BC V2C 2B6www kamloopscurlingclub com250-372-5432paula@kamloopscurlingclub com

pacific sport

Practicingfundamentalmovementskillsasachildfor2-3hours a week can reduce the risk of them getting injured duringphysicalactivityasanadult.Formoreinformation

visitwww.activeforlife.ca

Physical Activity/CS4l

Page 68: City of Kamloops Winter Activity Guide

66

pacific sport

DIvInGRiptech DivingInfo@riptech cawww riptech ca250-320-0436

diveRightIn!WithRiptechdivingRecreationaltocompetitiveprogramsfor ages 5 and up

Introductory program for beginners Learn the fundamentals of divingin a fun and safe environment.Individuals progress at their ownrate.Instructorsfocusondevelopingcoordination, flexibility, strength,fitness, posture, listening skills,concentration,and,of course,FUN!Prerequisite: participants must be able to swim comfortably in deep water

Competitive programs by invitationonly Unless you are transferring fromanothercluborfromadvancedgymnastics/trampoline, we requirealldiverstostartinFundive.

Programs run year-round withregistration ongoing

fIGURe sKaTInGKamloops skating Clubwww kamloopsskatingclub com250-554-4944Find us on Facebook - KamloopsSkatingClubPresident: Andrea Veitchkcspresident@hotmail caRegistrar: Rhonda Rowlandkcsregistrar@hotmail ca

Winter RegistrationRegistration is ongoing New program startsJanuary6,2015.Pleaseemailkscpresident@hotmail ca for more information

Programs offered:

Preschool - ages 3-5A10-weekLearntoSkateprogram.

Canskate - ages 5-12 A10-weekLearntoSkateprogram.SkatersworkattheirownlevelandprogressthroughtheSkateCanadabadge system at their own pace

Junior academy Program - advanced Canskate ProgramPrepares the skater for advancingintotheStarSkaterprogram.

starskaters (Test and Competitive)Contact the club for more information on this program

GyMnasTICs/TRaMPolInePossibilities play at KGTC Join the fun in our incredible indoor playground!

KamloopsGymnastics/ Trampoline CentreTournament Capital Centre910McGillRoad250-374-6424info@kgtc cawww kgtc ca

adult with Tot Drop-in (14 months-3.5 yrs)Mon,Wed,Fri11:00am-12:00noon

Just Me Drop-in (3-5 yrs)Mon,Wed,Fri11:00am-12:00noon

active start Programs (14 months-5 yrs)Check out our website to learn more about the the variety of preschoolprograms designed to enhance your child’sdevelopment.

Recreational Programs (6-13 yrs)(beginner through Intermediate)Recreational programs follow the CANGYM/CANJUMP programsfor skill acquisition, focusing oncontinuous achievement in a fun,safeenvironment.

advanced Recreational Programs (7-13 yrs, with coach invite or by assessment)Traintoachievemoreadvancedskilldevelopment. Build skill sequencesfor fun and optional participation in performance-based events anddisplays

Gym sport activities (6-10 yrs)A 10-week program option onFridays,asan introductiontoKGTCgymactivitiesonallapparatus.

High school Training (11-18 yrs)Nopreviousskill required.Setyourown goals for each apparatus and worktoachievethem.

Gymnastics for ParkourAnactiveandfunfree-runningfitnessprogram, teaching you to moveefficiently and safely, developingcritical thinking skills and overallawareness

Development/Competitive streamKGTC offers artistic men’s and women’s,trampoline,tumbling,andcheerleading programs Athletes learn to train and train to win

adult Drop-in (18+ yrs, Co-ed)Allabilitieswelcome!Supervisedbycoaches to ensure safety while you explorethefunofmovement.

Registered adult ProgramsCheck out our website for further information

birthday PartiesSundays throughout the year.Games, pit relays, trampoline, andrope swings Incredible fun with friends and family!

Camps/special eventsPro-ddayCamps/ChristmasCamps/Spring Break Camps/Summer FunCamps/Parents’NightOut

Registrationisavailableonline24/7!For detailed schedules and program information,visitwww kgtc ca

Page 69: City of Kamloops Winter Activity Guide

67kamloops.ca/recreation 250.828.3500

pacific sport

laCRosselacrosse bCCome out and play Canada’s oldest sport-thefastestgameontwofeet!SeasonalprogramsincludebothBoxandFieldlacrosseinafun,safe,anddevelopmentalclubenvironment.Allages and skill levelswelcome.Visitour website for additional information and registration KamloopsRattlersLacrosseClubBCRegionalCoach/President: Doug Clarkpresident@kamloopsrattlers comwww kamloopsrattlers com box lacrosse ProgramsRegistration: January of each year viawebsite. Season:March-June.Mini-Tyke-5-6yrsTyke-7-8yrsNovice-9-10yrsPeeWee-11-12yrsBantam-13-14yrsMidget-15-16yrs

field lacrosse ProgramsRegistration: July of each year viawebsite Season:September-december.Under 8 (U8)Under 10 (U10)Under 12 (U12)Under 14 (U14)Under 16 (U16)

Save these dates and check ourwebsite frequently for the latest information and program updates

sofTballKamloops Minor fastball associationwww kamloopsminorfastball comEmail: kmfa2001@yahoo caContact: VinaNeumanat 250-554-2138Find us on Facebook!

sPeeD sKaTInGKamloops long blades speed skating Club CoachCoordinator:SandiVyse250-573-4517or250-851-1481Email: speedskate@shaw cawww kamloopslongblades comPractices are Monday, Tuesday,Wednesday, andThursdayeveningsatMcArthur IslandSportandEventCentre. Competitive, Recreational,High Performance, Learn to Skate,andLearntoSpeedSkateprograms.All ages and abilities welcome New and improved Skating andSpeedSkatingLessons!Fee is$75,payable by cash or cheque

learn to skate/learn to speed skate Weareofferingsix-weeklessonsforboth Learn to Skate and Learn toSpeedSkate.Mondays, Jan 26-Mar 9 (no skating on Family Day)Participants are welcome to use Kamloops Long Blades skates at noextracost,ortheirownskates.Otherequipment will be needed and discussed at time of registration Participants need to be able to skate across the width of aniceranktoparticipateintheLearntoSpeedSkateprogram.

Club ProgramsRegistration is ongoingRecreationalpracticeonceperweek,Competitivetwiceperweek,andHighPerformance four times per week Try it once before joining the club Early bird and family discounts available. Speed skates includedwith registration

sWIMMInGKamloops Classics swimming Head Coach: Brad Dalkewww swimkamloops comadmin@swimkamloops comCanada Games Pool 910McGillRoad250-828-3660

Kamloops Classic Swimming isdedicated to providing the best availableteaching,coaching,training,&competitiveopportunitiestoalllevels of swimmers at an affordable cost

learn to swim with swimskill lesson ProgramOur learn to swim program (forages 5-12) focuses on strokedevelopment. Register online atwww swimkamloops com or by phone at 250-828-3660. $130 forsixteen 45-minute sessions (greatvalueat$10.83/hour).

Winter session - all levels*MondaysandWednesdays,Jan12-Mar9,3:30or4:15pm(No lesson Feb 9)*TuesdaysandThursdays,Jan13-Mar10,3:45,4:30,or5:15pmMini-Meet-AllswimmersWed,Mar11,3:30-5:00pm.

spring session - all levels*MondaysandWednesdays,Mar25-May27,3:30or5:15pm(NolessonApril3,6,orMay18)Mini-Meet-AllswimmersFri,May29,3:30-5:00pm.

Club swimmingWhetheryouryoungathleteislookingforasportforpersonaldevelopmentandfun,orlookingforacompetitivesport they can grow into, ClubSwimming is a great choice! Thisyear-round training program is forall ages and levels. The coachingstaffareprofessionallycertified,andathletes have regional/provincial/national competition opportunities

Masters swimmingFor those swimmers 19 years of age orolderwhowant to improve theirswimmingskillsandstamina,here’san opportunity to meet and make newfriends,compete,andtravel.Mon,Wed,6:30-7:30pmFri,6:00-7:00am FREEONE-WEEKTRIALANYTIME!Ongoingregistrationatwww.swimkamloops.com,orcall250-828-3660.

Page 70: City of Kamloops Winter Activity Guide

68

pacific sport

synCHRonIZeD sWIMMInGKamloops sunrays synchronized swimmingPresident:MandyCurtiswww kamloopssynchro comkamloopssunrays@gmail com

Love to dance? Interested ingymnastics? Are you artistic?Expressive? do you like to swim?Then synchronized swimming is foryou!Synchronizedswimmingisasportofstrength,flexibility,andcreativity.Itisdemandingbutfun.Inthewater,synchronized swimmers achievethe aquatic endurance of speed swimming, theprecisionandpowerof gymnastics, and the artistry ofdance.TheKamloopsSunraysofferaffordableintroductory,recreational,andcompetitiveswimmingprogramsforbeginnertoadvancedswimmersfrom the ages of 7 to 19, as wellas Masters sessions for swimmers over18.

free see It, Try It sessionsFind out if synchro is the sport for you and see where you should begin yoursynchronizedswimmingcareer.drop-in sessions at the CanadaGames Pool are available. Pleasevisit ourwebpage to see upcomingdates and times

Call from anywhere in Kamloops, and we will safely drive you and your

vehicle home.

November 28 and 29December 5, 6, 12, 13, 19, 20, 26,

27, and 31

250-372-5110All donations go to Paci�cSport and supporting amateur athletes in Kamloops.

TennIsKamloops Tennis CentreRegional Head Coach: Kelly Hubbardwww kamloopstennis cominfo@kamloopstennis com250-372-1783

Junior Tennis ProgramsAges5-17

adult Tennis ProgramsAdultprogramsrunyear-round.Formoreinformation,visitwww kamloopstennis com or call 250-372-1783.

Page 71: City of Kamloops Winter Activity Guide

69kamloops.ca/recreation 250.828.3500

pacific sport

Youth SPORTS CAMPSPro D Day CampsEvery Pro D day, there is a camp that o�ers your child the opportunity to experience Olympic and Paralympic sports. Your child will spend the day learning traditional and non-traditional sports led by certi�ed coaches from our community, plus enjoy a recreational swim! We invite Olympians, the Kamloops Blazers, Olympic hopefuls, high-level coaches, and other sport experts to share their experiences and skills with your child. Join us and �nd your game! Ages 7-12.

Thursdays, April 2-May 21 TCC North Court6:30-8:30 pm Course No. 235433

Date Location Course No.Friday, February 20 TCC North Court 234683Monday, April 20 TCC North Court 234687Monday, May 11 TCC North Court TBA

$25 per child 8:30 am-4:30 pm

Two NUT-FREE snacks are provided.

Spring BreakAre you looking for something fun and active for your child this Spring Break? Try our popular XploreSportz Spring Break Camps! Each day, the kids will participate in two di�erent sports and a recreational swim at the Canada Games Aquatic Centre. Ages 7-12.

Date Location Course No.

March 16-20 TCC North Court 234697

March 23-27 TCC North Court 234698

$150 per child, $130 for each additional child.

Includes two NUT-FREE snacks each day, a camp T-shirt, and a prize!

In this fun, non-competitive, skill-based environment, girls ages 7-12 have the chance to try two sports and a recreational swim. A certi�ed female coach will introduce the girls to the skills and games relating to their sport or activity. Improve your athletic skills and con�dence while making new friends!

TBA

Page 72: City of Kamloops Winter Activity Guide

7070

Page 73: City of Kamloops Winter Activity Guide

71kamloops.ca/recreation 250.828.3500 71kamloops.ca/recreation 250.828.3500

LEARN TO SKI OR SNOWBOARD PROGRAMSThe perfect introduction for first time skiers and snowboarders including lesson, equipment rentals, and learning area pass. Available daily.Sun Kids (6–12) Full Day Includes supervised lunch (9:00am to 3:30pm): $99Morning (9:00am to 12:00pm): $80 Afternoon (1:30pm to 3:30pm): $59 Youth & Adult (13+)Full Day (9:00am to 3:30pm): $99 Afternoon (1:30pm to 3:30pm): $69

NORDIC SKIING PROGRAMSIntro to Nordic PackageIncludes a Nordic ticket, rental gear, and 2 hours of instruction for the perfect introduction to Nordic skiing.$69 | Daily: 9:00am, 11:00am, and 1:30pm

2 Hour Group Lessons$59 | Daily: 9:00am, 11:00am, and 1:30pm

Private LessonsAdd a friend to your private lesson for just $38!2 Hours: $115 | Daily: 9:00am, 11:00am, and 1:30pm1 Hour: $79 | Daily: 9:00am, 10:00am, 11:00am, 12:00pm, 1:30pm

FREESTYLE PROGRAMSTaught by certified Freestyle Coaches for all ability levels, learn the fundamentals of Freestyle skiing and snowboarding in a fun and safe environment.Weekend Programs (6–12 years & 13–18 years)10 Consecutive Full Day Saturdays Program: $399 (1 Day $79)Starting January 10, 10:00am to 3:00pm10 Consecutive Half Day Sundays Program: $219 (1 Day $49)Starting January 11, 1:00pm to 3:00pm3-Day Freestyle Camps (6–12 Years): $129December 26–28 and March 14–16, 9:00am to 12:00pm

SPREAD ACROSS THREE AMAZING PEAKS!

ONE GIANTCLASSROOM

LOCALS PROGRAMSEnjoy 10 consecutive weekly lessons at a great price, with the same instructor and group of peers. Local Kids (4–12) 10 Consecutive Weeks: $205 Choose from either 10:00am to 12:00pm or 1:00pm to 3:00pmSaturdays, starting January 10; Sundays, starting January 11 Local Adults (13+)10 Consecutive Saturdays: $309 Starting January 10, 10:00am to 12:00pm

OFF-PISTE PROGRAMSSo much more than world-class groomers, Sun Peaks was developed in the 1960s for its steeps, glades, moguls, and exceptional powder skiing. These camps are tailored for intermediate to expert skiers—let us show you the ropes!Beyond the Groomers CampDiscover the best hidden stashes along with lift line priority, video analysis, and après ski.3-Day Camp: Adults (13+) $399 | Kids (6–12) $329Monday to Wednesday, 9:00am to 3:00pm each dayAll Mountain Skills CampIntroduction to terrain assessment, hazard analysis, overnight survival, and companion rescue; with transceiver, probe and shovel techniques.2-Day Camp: Adult (13+) $299 | Youth (10–16) $259Thursday to Friday, 9:00am to 3:00pm each day

Whether you’re new to our mountains or a seasoned veteran, you can always improve. Develop your technique, define your style, and enrich your experience on the snow at Canada’s second largest resort!

Rates are subject to tax and unless otherwise stated,do not include lift tickets. Subject to change without notice.

For more information call 250.578.5505or visit SunPeaksResort.com/School

Page 74: City of Kamloops Winter Activity Guide

7272

www.vvsc.ca or [email protected] for registration informationion

TAKE YOUR SKATING TO THE NEXT LEVELPOWER SKATINGHockey players - improve your strength, speed andagility on the ice!

www.vvsc.ca

Winter sessions beginthe week of January 5th, 2015

SHITO-RYU KARATETraditional Okinawan/Japanese • In Kamloops Since 1984

Muso Jikiden Eishin Ryu & Takeda Ryu Iaido (Sword) - Call for infoMonday & Wednesday on the Southshore at Lloyd George School

Children • Aged 7 - 13 • 6:00 - 7:10 pm Adults & Students • 7:15 - 9:00 pm

TRY OUR FREE INTRODUCTORY WEEKFEES: Children & Students: $ 0/month • Adults: $ 0/month

No Contracts • GST/PST Included • Plus Association Dues • Family rates available

INSTRUCTORS: Paul and Charlotte RobertsonInstructors are certifi ed by Karate Canada

and have been police checked.

For information contactPaul or Charlotte at 250-376-7551

Member of Karate BC, Sport BC, Karate Canada & Sport CanadaRenshikan

St. Andrews Presbyterian Church - 6th Ave & Douglas StMondays: 1st, 3rd, 5th Children 6:30-7:40pm Students/Adults 7:45-9:30pmWednesdays: Children 6:00-7:10pm Students/Adults 7:15-9:00pmFridays: 2nd, 4th Children 6:00-7:10pm Students/Adults 7:15-9:00pm

We also teach Iaido - Japanese sword on Saturdays 9:00 to 10:30am - $40.00 month

FEES: Children & Students: $60/month • Adults: $70/month

Page 75: City of Kamloops Winter Activity Guide

73kamloops.ca/recreation 250.828.3500 73kamloops.ca/recreation 250.828.3500

Creative Beginnings1440 Hugh Allan Drive (Beside Aberdeen McDonald’s)

PRESCHOOL Mon/Wed/Fri 8:45-11:15 $165/monthTues/Thurs 8:45-11:15 $110/monthTues/Thurs 11:30-2:00 $110/monthDAYCARE/PRESCHOOL0-3 years: prices vary3-5 years: Full-time $675/month ~ $40/dayAFTERSCHOOL CARE$340.00/month(Pickups from Summit, McGowanAberdeen,Dufferin,Paci c Way)

*Montessori enhanced program *Self-motivated learning experiences*Extensive academic programming *Language and Reading Programs

REGISTER NOW - SPACES ARE FILLING

Cheapest Rates in Kamloops!

250-377-8700 or 250-319-8586www.creativebeginningspreschool.ca

Page 76: City of Kamloops Winter Activity Guide

7474

A Safe & Clean Indoor Play Centre for

children and their families

Have fun on the interactive game fl oor, climb up to the top of the treehouse and be sure to check out our themed crafts each week.

We have sandwiches, treats, specialty coffees and real fruit smoothies.

Check Facebook for our winter programs and information on our monthly pizza nights!

DROP-IN PLAY ADMISSION

WE DO BIRTHDAY PARTIES!

UNLIMITED PLAY TIME

701-1801 Princeton Kamloops Hwy, Kamloops • 250-377-7529Monday - Friday 9:30am - 4:30pm ~ Sat/Sun 10:00am - 5:00pm • www.lilmonkeystreehouse.com • Find us on Facebook!

Page 77: City of Kamloops Winter Activity Guide

75kamloops.ca/recreation 250.828.3500 75kamloops.ca/recreation 250.828.3500

START CURLING THIS WINTERLEARN TO CURL8 Week Program: $99 + taxWednesdays at 7pm January 14th - March 4th

19+, LOTS OF FUN • COACHING AND EQUIPMENT PROVIDED • NO CURLING EXPERIENCE NECESSARY!

SPONSORED BY

Page 78: City of Kamloops Winter Activity Guide

7676

Page 79: City of Kamloops Winter Activity Guide

77kamloops.ca/recreation 250.828.3500 77kamloops.ca/recreation 250.828.3500

BEAVERS: AGES 5-7 SHARING-SHARING-SHARING CUBS: AGES 8-10 DO YOUR BEST!SCOUTS: AGES 11-14 BE PREPARED

VENTURES: AGES 14-17 PLAN YOUR OWN PROGRAM

OTHERS: BE PART OF THE SERVICE TO COMMUNITY...

VOLUNTEER YOUR TIME...VOLUNTEERS FROM THE UNIVERSITY ACQUIRE

SERVICE HOURS FOR YOUR PROGRAMS

FOR MORE INFORMATIONCall Roxy 250.374-1137www.scoutskamloops.ca

PAID ADVERTISEMENT

BE PART OF THE ADVENTURE!THERE’S A PLACE FOR YOU IN SCOUTING

Page 80: City of Kamloops Winter Activity Guide

7878

Boys and Girls Club of

Kamloops has been providing essential programs

and services for children, youth and families,

since 1955.

Come see us at our new location! John Tod Centre – 150 Wood St

www.bgckamloops.com 250-554-KIDS (5437)

Parenting Skills &

Family Meals

RECREATIONAL & SOCIAL SKILLS

AND MUCH MORE!

Page 81: City of Kamloops Winter Activity Guide

79kamloops.ca/recreation 250.828.3500 79kamloops.ca/recreation 250.828.3500

CLASSES RESUME ON JAN.5TH, 2015

ACTING

My World of Discovery Childcare

Open Monday to Friday6:45am - 5:00pm

Ages 11 months - 12 yearsDrop o� and Pick up at

Arthur Stevenson Elementary

Limited space also available at the Aberdeen Location - 250.828.6603

Westsyde Campus

Gorgeous and safe location, full size

gymnasium, excellent programs and big

private playground.

myworldofdiscoverychildcare.weebly.com

2826 Bank Road,Kamloops, B.C.778.472.3303

Find us on Facebook!www.facebook.com/pages/My-World-of-Discovery-Childcare

Page 82: City of Kamloops Winter Activity Guide

8080

Get in Sync with the SunraysSynchronized swimming combines athleticism, artistry and teamwork in a challenging, supportive and fun environment• A range of programs, from recreational to competitive, start at age 6• Excellent athlete to coach ratios• Train at Canada Games Pool

For more info, please see our website www.kamloopssynchro.com or email [email protected]

www.kamloopssynchro.com

Call for FREETrial Class!

See It Try ItRegular classes throughout the year, check our website for dates and times!

Regular Classes Began September 8th - If you are interested in joining please Call 250.377.1249

YMCA YWCA Violence Against Women Intervention

and Support Services

• Y Women’s Emergency Shelter 250.374.6162Text: 250.682.7931

• Children Who Witness Abuse Program

250.376.7800

• Outreach Services Program 250.320.3110

Building healthy communities

653 Victoria St. • highcountrystainedglass.com

For more info or to register for a class, call 250-851-0876

High Country Stained Glass

Looking for a Winter Escape?

Come in this Winter and Learn how to Brighten your Life with Stained Glass!

No experience necessary classes for all ages!

Cafe withSupervisedPlay Area

Drop in Childcare

SchoolLunchProgram+ +

sweethomecafeforyou.com / Phone 778-471-5579 / #2 1380 Hillside Drive Sweet Home Cafe

Makes Both Parents and Kids Happy

Before/After school care - licensed group care - exceptional educators for children who attend South Sahali Elementary

We operate Mon-Fri 7:30 am- 5:30 pm (including non instructional days)

Page 83: City of Kamloops Winter Activity Guide

81kamloops.ca/recreation 250.828.3500 81kamloops.ca/recreation 250.828.3500

Learn to Skate with the Best!

NATIONAL COACHING STAFF• Coach Heather Ansley ~ Team Leader For Skate Canada• Coach Jennifer Yates ~ National Coach• Teaching all levels and disciplines of skating for ages 3 & up• Programs include Learn to Skate, Freestyle, Ice Dance & Pairs • Private, Semi Private & Group lessons

REGISTRATION AT McArthur Island Sports CentreDecember 8 • 4:30 pm - 6:00 pmDecember 9 • 5:30 pm - 7:00 pmJanuary 5 • 4:00 pm - 6:00 pmNext program starts Jan. 6 & 7Visa, Mastercard or Debit

Call 250-554-4944 Download registration form at [email protected]

Check our website forcoaching updates!

at at omom

Find us on Facebook!

Page 84: City of Kamloops Winter Activity Guide

8282

real women. real harmony. real fun.rreeaall wwoomen.nn rreeaall hhaarrmmoonnyyy.r rrreeeaaalll fffuuunnn..

We invite you to come and experience Desert Sounds Harmony Chorus

during a weekly rehearsal - you can sing 4-part A Cappella

harmony with this exciting group of women who share a common goal of musical and performance excellence.

Curious?Come and join the fun on Tuesday evenings!

Rehearsals at St. Andrews Presbyterian Church, 1136 6th Avenue, 6:30pm

Contact Leanna @ 778.220.0325 or Deb @ 250.318.7290

Visit us at dshchorus.ca

2014 Desert Sounds Harmony celebrates 35 years

www.KamloopsMontessori.ca

OPEN HOUSE

Feb. 28th 10am - 2pm

ACCEPTING NEW STUDENTS!

For January 2015

Visit our website for registration info.

KAMLOOPS VILLAGE GARDEN MONTESSORI EARLY LEARNING CENTRE

700 Hugh Allan Drive 250-372-9915

KAMLOOPS MONTESSORI PRESCHOOL/KINDERGARTEN

920 Greystone Crescent250-372-9945

ABERDEEN HILLS MONTESSORI PRESCHOOL KINDERGARTEN

2191 Van Horn Drive • 250-372-9940 located in Aberdeen Elementary School

SAHALI MONTESSORI PRESCHOOL KINDERGARTEN

700 Hugh Allan Drive250-374-4264

Developing

HarmonyIn Life.

Fostering a

PassionFor Excellence.

Building

Character& Universal Values

Encouraging

ServiceTo Humanity

Providing Excellence in Montessori Education Since 1998

Kamloops

MONTESSORI

D

HD l i F i

PPi

CCCB ildi Encouraging

CHILDCARE • PRESCHOOL / KINDERGARTEN • BEFORE & AFTER SCHOOL CARE PROGRAMS

INVESTING IN THEIR FUTURE MADE EASY.

A Division of Peace Educational Services Corp.

Page 85: City of Kamloops Winter Activity Guide

83kamloops.ca/recreation 250.828.3500 83kamloops.ca/recreation 250.828.3500

Junior Lessons - Private$40 for 45 minutes. Lessons included practice time before and after each lesson.

• Voted #1 Golf Instructor in Kamloops• CPGA Professional for 16 years• 2008 Kamloops Sports Council Coach of the Year• 6 years as Head Coach for the TRU WolfPack Golf Team - 2008 National Champions• 17 Professional Wins• Former PGA of BC player of the Year and Order of Merit Winner• NCAA Div. 1 4 Year Letter Award Winner - Golf Scholarship

Short Game Lessons - $45Beginner and intermediate Golfers welcome. Lessons designed for those looking to improve on stroke saving shots from 75 yards and in. 1 hour Free Practice time after each lesson.

6:00-7:30pmClass 1 - Putting - April 22Class 2 - Bunker Play - April 27Class 3 - Chipping and Pitching - April 29Class 4 - Bunker Play - May 4Class 5 - Putting - May 11

Private Lessons - Beginner to Professional golf-ers welcome. All lessons include V1 Video Analysis. Private lessons to accommodate your schedule and time. Unlimited practice time before and after each lesson. All aspects of golf covered. 1 lessons - $60 3 lessons - $160 5 lessons - $250

Group Lessons Put a group together and give me a call or send me an email as these packages are quoted on class size and number of lessons. Free practice time included with each package.

Ladies (19+): 6:00-7:15pmClass 1 - April 21, 23, 28, 30Class 2 - May 5, 7, 12, 14Class 3 - May 19, 21, 26, 28Class 4 - June 2, 5, 9, 11

Active Adults (50+): 10:00-11:00amClass 1 - April 21, 23, 28, 30Class 2 - May 5, 7, 12, 14Class 3 - May 19, 21, 26, 28Class 4 - June 2, 5, 9, 11

Adult Mixed (19+): Mondays 6:00-7:15pm4 week classClass 1 - May 4, 11, 18, 25Class 2 - June 8, 15, 22, 29

FREE CLASS! - Your choice of the following dates. 9:00-10:15amMay 16, June 13 or July 11

LEARN TO GOLF - PLAY BETTER GOLF IN JUST TWO WEEKS! Fee: $99.00Beginner and Intermediate golfers welcome. Lessons designed for those looking to take up the game or sharpen their skills. Small class size ensures maximum personal instruction. Golf lessons covering the full swing, chipping, putting, pitching, sand play, basic rules and etiquette. 15 minute Free Practice before and after each lesson. Sign up today - pay later - and receive a 5th Lesson FREE.

CONTACT: The Dunes Pro Shop250.579.3300 • [email protected] • golfthedunes.com

Golf Lessons

Page 86: City of Kamloops Winter Activity Guide

8484

Winter/Spring Sessions start February 2nd• Active Kidz Gymnastics (14 mths- 5 yrs)• Recreational Gymnastics (6+ yrs)• Performance Gymnastics• Developmental Gymnastics (boys & girls)• Competitive Gymnastics & Trampoline• Birthday Parties• 10 and 20 week programs

REGISTER ONLINEDecember 15 th

tt FFrs)

rls)er

FFeebbruaarryy 22nnddd

)

December

www.kgtc.caKamloops Gymnastics | Trampoline | Cheer

P. 250.374.6424 E. [email protected] KGTC - 910 McGill Road (inside TCC)

Page 87: City of Kamloops Winter Activity Guide

85kamloops.ca/recreation 250.828.3500 85kamloops.ca/recreation 250.828.3500

FINE ART PAINTING CLASSES

Oil & Acrylicwith

PROFESSIONAL ARTISTDEBBIE MILNER LIVELY

BEGINNER TO ADVANCEDAGES 12 AND UP

debbiemilnerlively.com

[email protected]

Phone: 250-320-3779

Come paint with Debbie in a positive,

encouraging atmosphere!

KAMLOOPS MINOR HOCKEY ASSOCIATION

HOCKEY PROGRAMS FOR BOYS & GIRLS AGED 4 – 17Thank you to all our valued sponsors and volunteers for

helping keep 1350+ kids playing hockey!

2015/2016 SEASON REGISTRATION

Registration for returning players will open online February 2nd, 2015.

New + Transferring player registrations will be accepted starting June 1st, 2015

Join us on Wednesday, March 11th, 2015

at McArthur Island Sports Centre for our

ANNUAL NIGHT OF CHAMPIONS

Check out our website at www.kamloopsminorhockey.com for Weekend Game Schedules, Tournament Dates,

Team and Division information plus more!Phone: 250-376-1788 Email: [email protected]

Page 88: City of Kamloops Winter Activity Guide

8686

February 28, 2015

Register For Music Lessons Today.Reg

Why Choose Long & McQuade?Music lessons for all ages, stages and styles.Professional instructors make learning fun.Convenient lesson times for busy families.

No Registration Fees. Affordable Instrument Rentals.No

hW

Where tWhere the music begins!

955 Lorne St., Kamloops 250.828.2315

Yamaha group music classes are available for children 3 and up. Call for a free demo.Yama

Guitar, Piano, Drums, Bass, Sax, Flute, Trumpet, Violin, Clarinet ,Voice and More!

Yamaha Junior Group Classes - Intro to music for Ages 3 & up. FREE DEMOS!

Guitar, Piano, Drums, Bass, Sax, Flute, Trumpet, Mandolin, Clarinet, Dobro, Voice and More!

Page 89: City of Kamloops Winter Activity Guide

87kamloops.ca/recreation 250.828.3500 87kamloops.ca/recreation 250.828.3500

Copy

right

201

3, M

ake

Child

ren

Firs

t Kam

loop

s M

CFK-

011

Des

ign

by w

ww

.koc

hink

.com

Page 90: City of Kamloops Winter Activity Guide

8888

250-374-6683leesmusic.net•1305 Battle St.

Sales • RepairsLessons • Service

$130 - 16 lessons – 45 MINUTE LESSONS!

Monday & Wednesday January 12th - March 9th • 3:30 or 4:15 pm

Tuesday & Thursday January 13th - March 10th • 3:45pm, 4:30pm or 5:15pm

*No class on February 9th

MINI-MEET FUN DAYWednesday, March 11th – 3:30 - 5:00pm

YOUTHSWIM LESSONS

WINTER SESSIONS 2014(Ages 5-12)

REGISTER NOW!Full registration online at

swimkamloops.com(250) 828-3660

[email protected]/MC Accepted

FREE SWIM ASSESSMENTS!

MASTERS SWIMMINGCertifi ed Coaches • Improve your stroke

Fun, social atmosphere • Recreational to competitiveMONDAY/WEDNESDAY 6:30-7:30PM

FRIDAY 6:00-7:00PM

AGES 18+CLUB SWIMMING

Whether your young athlete is looking for a sport for personal development and fun,

or looking for a competitive sport they can grow into, Club Swimming is a

great choice!

This year-round training program is for all ages and levels. The coaching staff are professionally certifi ed, and athletes have regional/provincial/

national competition opportunities.

FREE ONE-WEEK TRIAL ANY TIME!

AGES 6-19

Page 91: City of Kamloops Winter Activity Guide

89kamloops.ca/recreation 250.828.3500 89kamloops.ca/recreation 250.828.3500

We are offering a FREE OPEN SKATE at MacArthur Island Park on Sunday, December 7th, 3 to 4 pm.

Come and try on and try out speed skates on the ice; meet the coaches and some of our more experienced speed skaters; as well as register for the winter sessions.

Kids Learn to Skate: (must be 4 years or older)Winter: 8 classes from January 15 – March 5 2015Thursday’s @ McArthur Island Park5:30 pm – 6 pm$90 with equipment; $70 without equipment

Intro to Speed Skating: (kids and adults welcome!)Winter: 8 classes from January 15 – March 5 2015Thursday’s @ McArthur Island Park4:45 pm – 5:30 pm$100 with equipment; $80 without equipment

Experienced Speed Skaters: September – March 2015McArthur: Thursday: 4:00 pm – 5:30 pm Friday: 6:30 am – 7:30 am Sunday: TBAPrice TBA

Programs: Note – all times are subject to change see website for detailsFor more information please contact Michelle at [email protected] our website www.kamloopsspeedskating.com

The Kamloops River City Racers Club (RCR) offers recreational and competitive programs for the skating enthusiast wishing to learn how to skate or more uniquely, how to speed skate! Qualifi ed coaches & master mentors provide a safe, team oriented, EASY and FUN environment to help YOU learn fundamental techniques & skills through games, drills & interclub competitions.

RCR will be providing the learn to skate + learn to speed skaters with all the equipment needed: helmet, speed skates, neck guard & knee pads. (fi rst come fi rst served!)

Come and be a part of one of Canadian’s favourite pastimes –

SKATING & SPEED SKATING!

Skating Made Fun And Easy - Be A part Of The Uniqueness!

Page 92: City of Kamloops Winter Activity Guide

9090

Fresh Prints: Carving CommunityWednesday, January 21, February 4, 18, March 4, 183:00 to 5:00 pm

Youth and Young Adults$50 (Members) / $80 (Public) per five-class course

Fresh Prints is an after-school printmaking program for youth and young adults facilitated by local printmaker and KAG art instructor Melaina Todd. Suitable for beginners and intermediate printmakers, Todd will guide participants to develop their skills as they work to carve their image into a 12”x12” square of linoleum. Registration is required.

465 Victoria Street • 250.377.2400 • kag.bc.ca

Page 93: City of Kamloops Winter Activity Guide

91kamloops.ca/recreation 250.828.3500 91kamloops.ca/recreation 250.828.3500

We o� er an introductory program for youths. Beginners learn the fundamentals of diving in a fun and safe environment and

individual’s progress at their own rate. Classes are o� ered Monday through Thursday – Choose a one day or two day a week program.

FunDive is where the emphasis is on fun!

Wth

indthrou

Visit our website @www.riptech.caand register today!250-320-0436

ugughh ThThurursdsdayay – C Chohoososee aa ononononeee e dadayy y y y oror tt ttwowowowo d d dayay aa a ww wweeeeeeekk prprogograramm. eeee isisisis wwwwww wwwheheheherererere ttt thehehehe eee empmpmpmppphahhahahahahahahasisisisisisssss isisisiiis oo onnn ffufufun!n!n!

ththrorouuFuFuFuFunDnDnDnDiviviviveeee

Winter FunDive 2015Age Group Day Time First Class Last Class # Weeks Fee

5-16 years

Monday 6:00-7:30pm January 5 March 9 9 $167

Tuesday 6:00-7:30pm January 6 March 10 10 $185

Wednesday 6:00-7:30pm January 7 March 11 10 $185

Thursday 6:00-7:30pm January 8 March 12 10 $185

Pre-Competitive & Competitive – Invitation OnlyAge Group Day Time First Class Last Class # Weeks Fee

5 - 16 yearsTuesday

Wednesday & Thursday

5:30-7:30pm January 6 March 12 10

Varies based on the level of meets

Please note: All must pay a $25 registration fee

(valid from September 2014-August 2015) • Pool Closure: February 9thParticipants must be comfortable swimming alone in deep water.

Instructors will not be in water with class.

REGISTER BY DECEMBER 1ST AND RECEIVE

$10 OFF!

FREE DIVING LESSONS!

Nov. 25, Dec 2 & 9 6:00-7:30pm

Learn to dive!

Page 94: City of Kamloops Winter Activity Guide

9292

YEAR-ROUND TENNISBeginners Welcome!

We have 5 heated, well-lit indoor courts.PLAY NOW WITH REDUCED DROP-IN RATES!

Leagues ~ Lessons ~ Socials ~ Tournaments

Annual, seasonal, monthly memberships and pay-as-you-go punchcards available.

New memberships receive a 20% discount

www.kamloopstennis.com. a ooooooopppppppppppste

250-372-1783748 Front St

Page 95: City of Kamloops Winter Activity Guide

93kamloops.ca/recreation 250.828.3500 93kamloops.ca/recreation 250.828.3500

For more informationcall 250.376.3900

Royal Canadian Army Cadets2305 RCAC meets Mondays from 6:00 pm - 9:15 pm

at the Cadet Hall at 169 Briar Ave.Cadets Parade: 6:00pm

Boys & Girls 12 - 18 years old are welcome to enrollUniforms are loaned at no charge

• Map & Compass • Field Craft • Biathlon • Adventure Training • First Aid • Marksmanship • Drill • Band

The purpose of the Cadet Program is to develop the attributes of good citizenship and leadership, to promote physical tness and to stimulate an interest in the

activities of the Canadian Forces.

Our educators will provide:Freedom of choice • Independence

Love for learning • Practice of virtues Pre-Literacy • Science & culture • Concrete

& abstract math concepts • Music & art

3-6 Spaces Available in full day Montessori or Reggio programs

- Limited pre-school spaces available -

We would love to have you join us!

3 LOCATIONS

520 6th Avenue • 250-828-6675 1565 Summit Drive • 250-828-2533

Gingerbread House Daycare • 250-828-2045

Ages 12 months - 12 years Monday - Friday • 7:00 am - 5:30 pm

www.sixthavenuechildcare.com

6TH AVENUE MONTESSORI

Our Summit location has space available in our after school, and 3-5 daycare. Part time

spaces available in our infant and toddler area.

Accepting registration at our downtown location in our

infant/toddler area

KAMLOOPS

KK AA RR AA TT EE CC LL UU BB

1080 Kenora AveKamloops Judo Centre

For more info: 250.573.6063Traditional Karate practiced in Kamloops since 1972.

Tuesdays & Thursdays – 7:00-8:30pm

Take part in Adult Karate Classes (ages 13+), and let Karate bring

out the youth in you!

Page 96: City of Kamloops Winter Activity Guide

9494

Kamloops Healthy Weights for Children

Shapedown BCShapedown BC: A FREE program for children and teens

(aged 6-17) and their families

SHAPEDOWN BC is a family based group program that helps children and teens, and their families, achieve a healthier lifestyle.

HOW DOES IT WORK? Through aged based group programs and individualized support, the Kamloops Shapedown team of a Registered Dietitian, Fitness Instructor, Registered Social Worker and Pediatrician, helps families to make positive changes in eating habits, activity level, parenting skills and self-esteem.

HOW DO I JOIN? Ask your family Doctor, Pediatrician, or Nurse Practitioner to send us a referral. Or contact us for more information.

Kamloops Healthy Weights for Children

Shapedown BCPublic Health519 Columbia Street, Kamloops, BC V2C 2T8PH: 250.851.7300 | FAX: 250.851.7301www.interiorhealth.ca/Shapedown

Sha

Kafoo

en and teens

Station Plaza 5-510 Lorne Street

[email protected]

Music programs for students of all ages that include preparation for:> recitals> festival performances> conservatory exams> post-secondary entrance auditions

GROUP CLASSESSunrise Program for ages 2-3Music for Young Children Program for ages 3-8Chamber MusicYouth String Orchestra

PRIVATE LESSONSPianoTh eoryVoice

Strings Bass Cello Violin

Woodwinds & Brass Bassoon Clarinet Flute French Horn

Oboe Saxophone Trombone Trumpet

Page 97: City of Kamloops Winter Activity Guide

95kamloops.ca/recreation 250.828.3500 95kamloops.ca/recreation 250.828.3500

Winter CanSkate Sessions

Starting week of January 5, 2015

Registration days: Wednesday, December 3rd from 5-7pm

Monday, December 8th from 5-7pm at Valleyview Arena , or register anytime by mail

Registration for those skaters currently registered in the Fall CanSkate sessions will be available at the CanSkate Table during the last two weeks of Fall CanSkate sessions.

for more information, including Winter CanSkate sessions, other programs offered by VVSC, and

registration forms please visit

www.vvsc.caor email: [email protected]

Page 98: City of Kamloops Winter Activity Guide

96

Let our caring sta� and §

volunteers help you achieve

SUCCESS!

An unbeatable package of §

programs and services at an

a� ordable price.

Over 70 � tness classes a §

week included FREE in your

membership. *(Does not apply to fee-based classes.)

NEW § state of the art

equipment

kamloopsy.org §

New John Tod Centre Y now open!Building healthy communities

TRY THE Y FOR A WEEK

Downtown Y400 Battle StreetTel: 250-372-7725

John Tod Centre Y150 Wood StreetTel: 250-554-9622

Valid for ONE WEEK PASS ENTRY to the Downtown or John Tod Centre Y for an adult, youth or child.**Children and youth under 13 must be accompanied by a parent/guardian to redeem pass in fitness area. Age restrictions also apply to pool admissions. No cash value. One coupon per person per calendar year.

kamloopsy.org

STAY FIT.GET CONNECTED.FEEL SUPPORTED.BELONG.

Page 99: City of Kamloops Winter Activity Guide

BU

ILDIN

G STR

ON

G CO

MM

UN

ITIES

Village of Lytton

CUPE fi ghts for these CUPE fi ghts for these issues that aff ect workers - issues that aff ect workers -

Locally, Provincially, Locally, Provincially, Nationally & GloballyNationally & Globally

Aboriginal IssuesAboriginal Issues

Child CareChild Care

Collective BargainingCollective Bargaining

Disability rightsDisability rights

EnvironmentEnvironment

Global JusticeGlobal Justice

Health & SafetyHealth & Safety

Health CareHealth Care

LGBTTILGBTTI

LiteracyLiteracy

MunicipalitiesMunicipalities

Pay EquityPay Equity

PensionsPensions

TradeTrade

Racial EqualityRacial Equality

Post Secondary Education Post Secondary Education

WaterWater

WomenWomen

CUPE members are CUPE members are proudproud to to work, live and pay taxes in work, live and pay taxes in

the communities they serve.the communities they serve.

Page 100: City of Kamloops Winter Activity Guide

. . . always putting children fi rst & always going several steps beyond!

25O.319.9O44 • www.kamloopskidz.com

“A lifetime of learning begins here”Valleyview Campus1764 Valleyview DrivePreschoolChildcare - Ages 1 to 12

Sahali Campus1585 Summit Drive PreschoolChildcare - Ages 5 to 12

Pineview Campus 1711 Copperhead DrivePreschoolChildcare - Ages 1 to 12

PROGRAMS WE OFFER ARE:• Infant/Toddler: 7:30 am to 5:30 pm• Preschool: 8:45 am to 11:15 am OR 11:45 am to 2:15 pm • 3-5 Preschool / Childcare: 7:30 am to 5:30 pm• School Age Care: Before and after school care (including kindergarten children) 7:30 am to 5:30 pm.

Pick up from Juniper, Marion Schilling, Lloyd George, Beattie, South Sahali, Summit, McGowan, Pacifi c Way, Aberdeen, Dufferin.

Our Montessori Enhanced program includes: Montessori prepared environment• Practical Life - activities to aid in developing independence for the child• Sensorial - physical development of the senses• Language - speaking, listening, reading and writing• Mathematics - concepts of number, shape and space• Cultural Studies - enrich the child’s understanding of the world through the study of zoology, botany,

geography, history, art and music

Enhanced environment• Block area and dramatic play area - helps children learn socially, physically, intellectually and creatively• Extensive theme, phonics, art and music program

REGISTER NOW FOR PRESCHOOLCHILDCARE REGISTRATION ONGOING

REGISTERING NOW!

OPEN HOUSE FOR SEPTEMBER 2015 PRESCHOOL REGISTRATIONFEBRUARY 7TH – Visit our website for times...

Mark your calendar, don’t miss out!