Upload
trinhminh
View
215
Download
0
Embed Size (px)
Citation preview
UNIVERSIDADE FEDERAL DE GOIÁS
ESCOLA DE VETERINÁRIA
PROGRAMA DE PÓS-GRADUAÇÃO EM CIÊNCIA ANIMAL
CARACTERIZAÇÃO DA MACIEZ DA CARNE POR ANÁLISES
PROTEÔMICAS E MOLECULARES
Leonardo Guimarães de Oliveira
Orientador: Prof. Dr. João Teodoro Padua
GOIÂNIA
2016
ii
iii
LEONARDO GUIMARÃES DE OLIVEIRA
CARACTERIZAÇÃO DA MACIEZ DA CARNE POR ANÁLISES
PROTEÔMICAS E MOLECULARES
Tese apresentada para a obtenção do título de
Doutor em Ciência Animal junto à Escola de
Veterinária e Zootecnia da Universidade
Federal de Goiás
Área de Concentração:
Produção Animal
Linha de Pesquisa:
Metabolismo nutricional, alimentação e
forragicultura na produção animal
Orientador:
Prof. Dr. João Teodoro Padua - EVZ/UFG
Comitê de Orientação:
Prof. Dr. Reginaldo Nassar Ferreira - ICB/UFG
Prof. Dr. Cláudio Ulhôa Magnabosco – EMBRAPA
GOIÂNIA
2016
iv
v
vi
vii
Dedicatória
Dedico aos meus pais Orci e Ângela, meus irmãos
e à minha esposa Fabiana.
viii
Epígrafe
“Amanhã eu fico triste...
Amanhã!
Hoje não.
Hoje eu fico alegre!
E todos os dias,
por mais amargos que sejam,
eu digo:
Amanhã eu fico triste,
hoje não!”
(Poema encontrado na parede de um dos
quartos de crianças judias do campo de
extermínio nazista de Auschwitz).
ix
Agradecimentos
Agradeço a Deus por estar ao meu lado em todos os momentos da minha vida, que juntamente
aos meus, ajudou a superar todos os obstáculos que a vida apresenta.
Aos meus pais Orci e Ângela e aos meus irmãos Wellington, Cristiane e meus familiares pelo
apoio e sábios conselhos, nunca me deixando desistir dos meus sonhos.
À minha esposa Fabiana Barbosa por existir na minha vida e fazer meus dias mais felizes.
Ao professor Dr. João Teodoro Padua, pela orientação, conselho e apoio neste trabalho.
Ao professor Dr. Reginaldo Nassar Ferreira, pela amizade e por todos os passos da minha
caminhada científica, pela oportunidade da primeira pesquisa no meu primeiro ano da graduação, e
desde então sempre auxiliando nesta caminhada, nas horas certas e nas horas mais incertas, sempre
presente.
Aos professores Clayton Luiz e Alexandre Bailão por todos os ensinamentos e ajuda no
decorrer deste trabalho, sempre prontamente dispostos a conversas.
A professora Célia Maria por disponibilizar o laboratório de biologia molecular José Salum
para a condução das análises.
Ao professor Emmanuel Arnhold pelas valiosas conversas e ensinamentos.
Ao professor Aldi França pelas inúmeras oportunidades de aprendizado e ensinamentos
passados.
Ao professor José Henrique Stringhini por todas as oportunidades e amizade.
A todos os professores do Departamento de Zootecnia e da Escola de Veterinária e Zootecnia
da UFG.
Ao professor Dr. Cláudio Ulhoa Magnabosco, pela oportunidade e fundamental ajuda no
desenvolver da pesquisa.
Ao professor Dr. Pedro Veiga pela grande oportunidade, pela motivação e por toda ajuda.
Aos professores Steven Lonergan e Elisabeth Huff-Lonergan pela grande oportunidade e por
me acolher tão bem em seu laboratório.
Aos amigos da Iowa State University pelo companheirismo e acolhimento.
À família Portes pela grande amizade.
A todos da família Barbosa, Sr. Heriberto, Sra. Ivani, José Humberto, Erika Fukushima, Davi,
Lais, Emílio, Cláudia, Eduardo e Henrique.
Aos amigos Reginaldo Jacovetti e Sérgio Ferreira, pela amizade e pela ajuda nas horas boas e
principalmente nas horas de dificuldade.
Aos amigos da pós graduação, Marcondes Dias, Kíria Karolline, Tiago Pereira, Hugo Jayme,
Tayrone Prado, Gustavo Feliciano, Marcela Luzia, Barbara Lemos, Flavia Martins, Juliana Macedo,
x
Leticia Castro, Ludmilla Brunes, Ligia Moreira, Silvia, Adesvaldo, Leandro, Jean, Eduardo Rodolfo
e José Tiago por toda ajuda e todos os bons momentos de convivência.
Aos amigos da veterinária pela incrível amizade para todas as horas.
Aos amigos do laboratório de biologia molecular pela ajuda e companherismo, em especial ao
André Luiz pela grande ajuda neste processo.
À EMBRAPA por disponibilizar e viabilizar a participação nesta pesquisa.
À Guaporé Agropecuária e a Fazenda Barreiro pelas instalações e animais.
À Coordenação e todos os professores da Escola de Veterinária e Zootecnia, que contribuíram
para a minha formação.
Aos funcionários da secretaria de Pós Graduação em Ciência Animal, e do Departamento de
Zootecnia, pelo suporte nas nossas necessidades acadêmicas.
A todos aqueles que me apoiaram nesta caminhada.
xi
Sumário
CAPITULO 1 – CONSIDERAÇÕES INICIAIS ........................................................................ 18
1 INTRODUÇÃO ............................................................................................................................. 18
Objetivos gerais ................................................................................................................................. 19
Objetivos específicos ......................................................................................................................... 19
2 REVISÃO DE LITERATURA ...................................................................................................... 20
2.1 Estrutura muscular ....................................................................................................................... 20
2.2 Maciez da carne ........................................................................................................................... 21
2.2.1 Sistema calpaína ........................................................................................................................ 22
2.3 Técnicas utilizadas para o estudo de proteínas ............................................................................ 24
2.4 Aplicação da proteômica na ciencia animal ................................................................................. 25
2.5 Purificação de proteínas ............................................................................................................... 26
3 Referências ...................................................................................................................................... 26
CAPITULO 2 - CALPASTATIN VARIANTS ACTIVITIES DURING BEEF AGING AND
DIFFERENTIAL POSTMORTEM PROTEOLYSIS IN TWO MUSCLES ..................................... 31
1. Introduction .................................................................................................................................... 32
2. Matherials and methods ................................................................................................................. 33
3. Results and discussion ................................................................................................................... 39
4. Conclusions .................................................................................................................................... 47
5. References ...................................................................................................................................... 48
FIGURES ........................................................................................................................................... 52
TABLES ............................................................................................................................................. 60
CAPITULO 3 – PURIFICATION AND CHARACTERIZATION OF ACTIVE PEAKS OF
CALPASTATIN FROM SWINE LONGÍSSIMUS DORSI MUSCLE. .............................................. 63
Abstract: ............................................................................................................................................. 63
INTRODUCTION ............................................................................................................................. 64
MATHERIALS AND METHODS .................................................................................................... 65
Calpastatin extraction ......................................................................................................................... 65
Calpastatin Activity ........................................................................................................................... 66
Calpastatin peaks purification ............................................................................................................ 67
SDS-PAGE and immunoblotting ....................................................................................................... 68
Two-Dimensional Difference in Gel Electrophoresis. ....................................................................... 69
xii
RESULTS AND DISCUSSION ........................................................................................................ 71
CONCLUSIONS ................................................................................................................................ 74
LITERATURE CITED ...................................................................................................................... 74
Tables and Figures ............................................................................................................................. 76
CAPITULO 4 – ANÁLISE PROTEÔMICA DO MÚSCULO “LONGÍSSIMUS DORSI” DE
BOVINOS DA RAÇA NELORE MOCHO DE DIFERENTES GRUPOS DE MACIEZ. ............... 83
INTRODUÇÃO ................................................................................................................................. 83
MATERIAL E MÉTODOS ............................................................................................................... 84
Coleta e preparo das amostras ............................................................................................................ 84
Extração proteica ............................................................................................................................... 85
Análise proteômica ............................................................................................................................ 85
Determinação da atividade da enzima superóxido dismutase ............................................................ 87
RESULTADOS E DISCUSSÃO ....................................................................................................... 87
CONCLUSÕES ............................................................................................................................... 103
AGRADECIMENTOS .................................................................................................................... 103
REFERÊNCIAS ............................................................................................................................... 104
Anexos ............................................................................................................................................. 110
CAPITULO 5 – CONSIDERAÇÕES FINAIS ................................................................................ 115
xiii
LLISTA DE TABELAS
Figure 1– Estrutura do músculo estriado esquelético. ...................................................................... 20
Figure 2 Representative blot and immunodetection of calpastatin in sarcoplasmic fraction using
antibody anti Calpastatin (MA3-944). ............................................................................................... 53
Figure 3 Representative blot and immunodetection of calpain-1 in sarcoplasmic fraction using
antibody anti Calpain-1. ..................................................................................................................... 53
Figure 4 Representative blot and immunodetection of troponin-T in myofibrillar fraction using
antibody anti troponin. ....................................................................................................................... 54
Figure 5 Representative blot and immunodetection of desmin in myofibrillar fraction using antibody
anti desmin. ........................................................................................................................................ 55
Figure 6 A representative two-dimensional difference in gel electrophoresis showing different
expressed spots in Longissimus lumborum (LL) muscle.Circles represent total area of detected spot
and the different expressed spots are identified by numbers. ............................................................ 56
Figure 7 A) SyPro Ruby total protein stain and B) ProQ Diamond phosphoprotein stain to identify
phosphorylated proteins from: TB0- 40 µg of protein from sarcoplasmic fraction of Triceps brachii
day 0; TB1- 40 µg of protein from sarcoplasmic fraction of Triceps brachii day 1; ST0- 40 µg of
protein from sarcoplasmic fraction of Semitendinosus day 0; Pk1 - 30µL of calpastatin peak 1
extracted from Semitendinosus day 0; Pk2 - 30µL of calpastatin peak 2 extracted from
Semitendinosus day 0......................................................................................................................... 57
Figure 8 Western blot and immunodetection using antibody anti Calpastatin (MA3-944). TB0- 40 µg
of protein from sarcoplasmic fraction of Triceps brachii day 0; TB1- 40 µg of protein from
sarcoplasmic fraction of Triceps brachii day 1; ST0- 40 µg of protein from sarcoplasmic fraction of
Semitendinosus day 0; Pk1 - 30µL of calpastatin peak 1 extracted from Semitendinosus day 0; Pk2 -
30µL of calpastatin peak 2 extracted from Semitendinosus day 0. ................................................... 58
Figure 9 Two dimensional western blot and immunodetection using antibody anti Calpastatin (MA3-
944).of pooled fractions from the two peaks with calpastatin activity from Semitendinosus day 0. A)
Calpastatin peak 1. B) Calpastatin peak 2. ......................................................................................... 59
10 Figure 1 Calpastatin activity of eluted fractions (Arbitrary units) ............................................... 76
11 Figure 2 – Load check silver stained of initial and final step of calpastatin purification. Lane M)
Broad range molecular marker; 1) Pooled fractions of peak 1 activity of calpastatin from Q sepharose
column; 2) Pooled fractions of peak 2 activity of calpastatin from Q sepharose column; 3) Pooled
fractions of peak 1 activity of calpastatin from Phenil sepharose column; 4) Pooled fractions of peak
2 activity of calpastatin from DEAE CAPTO column. ...................................................................... 78
12 Figure 3 – Western blott stained by calpastatin antibody of purified calpastatin peak 1 (PK1) and
calpastatin peak 2 (PK2). ................................................................................................................... 79
13 Figure 4 – 2D DIGE of calpastatin peaks coomassie stained. A) Calpastatin peak 1; B) calpastatin
peak 2. Numbers of collected spots and sent to identification are presented in boxes. ..................... 80
14 Figure 5 – Representative calpastatin molecule aminoacid sequence from Sus scrofa gene: CAST;
713 Aminoacids; Mass (Da):77,124. Inhibitory domains are presented in closed boxes and peptides
identified are in uppercase and in yellow are from peak 1 and from peak 2 as identified by grey. .. 82
15 Figura 1 – Atividade da enzima SOD (% inibição da formação do íon super óxido) entre os grupos
baixo WBSF (Macio) e alto WBSF (Duro) ....................................................................................... 92
xiv
LISTA DE FIGURAS
Table 1 Activityᶲ of calpastatin peak 1 (CAST 1), calpastatin peak 2 (CAST 2), Total calpastatin
(CAST total), calpain-1 and calpain-2 extracted from muscles Longissimus lumborum (LL) and
Triceps brachii (TB) during aging days of beef meat. ....................................................................... 60
Table 2 Calpastatin peak 1 (CAST 1), calpastatin peak 2 (CAST 2), total calpastatin (CAST total)
to calpain-1 activity ratios from muscles Longissimus lumborum (LL) and Triceps brachii (TB) at
day 0 postmortem. .............................................................................................................................. 60
Table 3 Abundance of immunoreactive bands from western blot of calpastatin (CAST), myofibrilar
and sarcoplasmic calpain-1, desmin and troponin-T during aging days of muscles Longissimus
lumborum (LL) and Triceps brachii (TB). ......................................................................................... 61
Table 4 Proteins identified in the spots of 2D-DIGE analysis of Longissimus lumborum (LL) and
Triceps brachii (TB). .......................................................................................................................... 62
5 Table 1 – Steps of purification of calpastatin peaks. ..................................................................... 77
6 Table 2 - Identified spots from calpastatin peaks gels. ................................................................. 81
7 Tabela 1 – Médias de força de cisalhamento transversal (WBSF) do músculo Longíssimos dorsi
dos animais selecionados para compor o grupo macio (M) e grupo duro (D). .................................. 87
8 Tabela 2 – Proteínas relacionadas à defesa celular, diferentemente expressas entre os grupos macio
(M) e duro (D). ................................................................................................................................... 89
9 Tabela 3 - Proteínas relacionadas a estrutura celular diferentemente expressas entre os grupos
macio (M) e duro (D). ........................................................................................................................ 95
10 Tabela 4 - Proteínas relacionadas ao metabolismo de carboidratos, diferentemente expressas entre
os grupos macio (M) e duro (D). ........................................................................................................ 97
11 Tabela 5 - Proteínas relacionadas ao metabolismo de proteínas, diferentemente expressas entre os
grupos macio (M) e duro (D). .......................................................................................................... 100
12 Tabela 6 - Proteínas relacionadas ao metabolismo de lipídeos, ligadas ao transporte de íons,
diferentemente expressas entre os grupos macio (M) e duro (D). ................................................... 102
15
LISTA DE ABREVIATURAS
µM Mili mol
2D Segunda dimensão
2D-DIGE Diferença em gel de segunda dimensão
ADH Aldeido desidrogenase
ATBSα Sintetase de ATP alfa
ATP Trifosfato de adenosina
cAMP Monofosfato de adenosina cíclico
CAST Calpastatina
CAST1 Calpastatina eluída no primeiro pico da cromatografia
CAST2 Calpastatina eluída no segundo pico da cromatografia
Da Dalton
DNA Ácido desoxirribonucleico
EMBRAPA Empresa brasileira de pesquisa agropecuária
ERO Espécies reativas de oxigênio
HSP Proteína de choque térmico
ICB Instituto de Ciências Biológicas
IP Ponto isoelétrico
kDa Kilodaldon
LC-MS/MS Cromatografo líquido acoplado a dois espectrômetros
LL Longíssimus lumborum
M Mol
MALDI Disorção/ionização assistida por laser
MHC Miosina de cadeia pesada
MLC Miosina de cadeia leve
MW Peso molecular
MYOM Miomensina
NADPH Dinucleotídeo adenina nicotinamida fosfato
ONS Oxido nitroso sintase
PRX Peroxiredoxina
RNA Ácido Ribonucleico
RPM Rotações por minuto
SDS-PAGE Gel de poliacrilamida
SFGH Formilglutationa hidrolase
SIF Sistema de inspeção federal
SOD Enzima super óxido dismutase
ST Músculo semitendinoso
TB Triceps brachii
WBSF Força de cisalhamento Warner-Bratzler
αβCST Cristalinina alfa beta
16
RESUMO
O perfil protéico de animais da raça nelore mocho de uma população segregante para a maciez da
carne de extremos valores de força de cisalhamento, grupo extremo baixo (M) e grupo extremo alto
(D), apresentou proteínas diferentemente expressas as quais houve maior abundância relativa de
proteínas do processo glicolítico no grupo M e proteínas do metabolismo oxidativo evidenciadas mais
expressas no grupo D, fato que provavelmente está correlacionado à maciez final da carne. Apenas
identificada no grupo D, a proteína citocromo c indica indução do processo apoptótico neste grupo
de animais. Proteínas estruturais foram identificadas no grupo M, indicando uma possível maior
proteólise. A calpastatina foi somente identificada no grupo D, esta proteína está altamente
relacionada com a maciez final da carne por ser inibidora natural das calpaínas. A separação de
calpastatina por cromatografia em coluna de troca iônica de dois músculos diferentes descreveu dois
picos de actividade inibitória de calpaínas: pico 1 (CAST1) e pico 2 (CAST2). Atividade de CAST 1
aumentada durante o período post mortem no Triceps brachii e não apresentou diferença entre os dias
em Longissimus dorsi e por outro lado, a atividade total de calpastatina e CAST 2 diminuiu durante
o envelhecimento post mortem. A banda de 115 kDa da calpastatina diminuiu sua intensidade durante
o envelhecimento post mortem em ambos os músculos com mais de 70% da alteração ocorrendo no
primeiro dia. As proteínas mitocondriais da subunidade ATP sintase beta aumentaram e a Succinil-
CoA ligase diminuiu após o envelhecimento e a Adenilato quinase isoenzima diminuiu no dia 7. Os
picos de calpastatina apresentavam faixas fosforiladas fracas e apresentavam manchas em IP e MW
diferentes do que 2D-SDS-PAGE. Durante o processo de purificação dos picos de calpastatina a
actividade por mg de proteína aumentou mas perdeu metade da atividade total apresentada durante a
primeira etapa de purificação. Para o pico 2 de calpastatina a actividade específica aumentou 139,8
vezes e no final deste processo permaneceu 36% da atividade total. A calpastatina purificada foi
identificada no gel de segunda dimensão com um peso molecular semelhante ao western blot. Spots
do pico 1 da calpastatina e dois do pico 2 da calpastatina foram identificados como peptídeos
pertencentes à molécula da calpastatina. Sequêcia de peptídeos identificados em Spot a partir do pico
1 purificado como parte do domínio inibidor III e IV e do terminal C e do pico 2 purificado uma
sequêcia de peptideos identificados como parte do domínio inibidor I, II e III. Estes resultados levam-
nos a crer que ambos os picos, neste caso, são produtos de degradação da molécula intacta e,
provavelmente, os pequenos peptideos são quebrados durante o processo. Os resultados do presente
estudo mostram que é possível a purificação de formas distintas de calpastatina activa, contudo a
forma intacta de calpastatina não estava presente nesta purificação. A presença de peptídeos não foi
conclusiva para determinar a origem ea composição de cada pico ativo.
Palavras chave: Calpastatina; coluna de troca iônica; immunobloting; purificação; SDS-PAGE.
17
ABSTRACT
The protein profile of hornless Nellore cattle from a segregating population for meat tenderness of
extremes shear force, low extreme group (M) and extreme high (D) group, showed differentially
expressed proteins. They had greater relative abundance of proteins of the glycolytic process in group
M and proteins of the oxidative metabolism evidenced more expressed in group D, fact that probably
is correlated to the final tenderness of the meat. Only identified in group D, the cytochrome c protein
indicates induction of the apoptotic process in this group of animals. Structural proteins were
identified in group M, indicating a possible greater proteolysis. Calpastatin was only identified in
group D, this protein is highly related to the final meat tenderness because it is a natural inhibitor of
the calpain. Separation of calpastatin by ion exchange column chromatography of two different
muscles described two peaks of calpain inhibitory activity: peak 1 (CAST1) and peak 2 (CAST2).
CAST 1 activity increased during the post-mortem period in Triceps brachii and showed no
difference between days in Longissimus dorsi and on the other hand, total activity of calpastatin and
CAST 2 decreased during post-mortem aging. The 115 kDa band of calpastatin decreased its intensity
during post-mortem aging in both muscles with more than 70% of the change occurring on the first
day. The mitochondrial ATP synthase beta subunit proteins increased and Succinyl CoA ligase
decreased after aging and Adenylate kinase isoenzyme decreased on day 7. Calpastatin peaks had
weak phosphorylated bands and had different IP and MW patches than 2D-SDS -PAGE. During the
purification process of the calpastatin peaks the activity per mg of protein increased but lost half of
the total activity presented during the first purification step. For peak 2 of calpastatin the specific
activity increased 139.8 times and at the end of this process 36% of the total activity remained.
Purified calpastatin was identified on the second-size gel having a molecular weight similar to the
western blot. Spots from calpastatin peak 1 and two from calpastatin peak 2 were identified as
peptides belonging to the calpastatin molecule. Sequence of peptides identified in Spot from purified
peak 1 as part of the inhibitory domain III and IV and of the C-terminus and from the purified peak
2 a sequence of peptides identified as part of the inhibitory domain I, II and III. These results lead us
to believe that both peaks, in this case, are degradation products of the intact molecule, and probably
the small peptides are broken down during the process. The results of the present study show that
purification of distinct forms of active calpastatin is possible, however, the intact form of calpastatin
was not present in this purification. The presence of peptides was not conclusive to determine the
origin and composition of each active peak.
Key words: Calpastatin; immunoblotting; ionic change column; purification; SDS-PAGE.
18
CAPITULO 1 – CONSIDERAÇÕES INICIAIS
1 INTRODUÇÃO
A bovinocultura de corte apresenta uma participação muito significativa no PIB Brasileiro com
mais de R$ 185,40 bilhões no ano de 2015 e um rebanho bovino de mais de 212,3 milhões de
animais(1).
Dentre os bovinos destinados à produção de carne no Brasil, a grande maioria é composta por
animais da sub espécie Bos indicus, principalmente da raça Nelore, tendo como característica animais
mais rústicos, em relação a animais Bos taurus mas com características de carne com menor maciez
(2,3).
A maciez da carne é uma das características organolépticas de grande importância e está
relacionada diretamente com a satisfação do consumidor (4). Uma das formas de sua medida é a
estimativa mecânica da força necessária para o cisalhamento de uma seção transversal de carne (5) e
está estimativa está altamente correlacionada com testes diretos de percepção de maciez como a
avaliação por painel sensorial com equipe treinada. Consumidores estão dispostos a pagar um maior
preço por uma carne mais macia (6).
A maciez da carne é influenciada por vários fatores ante mortem como a raça, a idade ao abate,
tipo de alimentação, manejo pré abate e fatores post mortem como a atividade de enzimas proteolíticas
presentes no músculo, disponibilidade de energia pós mortem e velocidade de resfriamento da carcaça
(7,8).
Diferenças consideráveis na maciez da carne podem ser explicadas pela herança genética e
segundo Alves et al.(2) um programa de melhoramento genético com seleção para maciez é uma
alternativa promissora para a produção de carne zebuína naturalmente macia.
Trabalhos envolvendo o melhoramento genético de bovinos têm sido desenvolvidos visando
selecionar indivíduos por suas características de interesse avaliadas no próprio indivíduo ou com base
na herdabilidade destas características. Alta herdabilidade e alta correlação negativa entre maciez da
carne e atividade da enzima Calpastatina em bovinos são relatadas na literatura (9).
A calpastatina é o inibidor natural das proteinases Ca+2 dependentes denominadas Calpainas.
As calpaínas são proteases presentes em todos vertebrados e atuam em várias funções no organismo
como no remodelamento do citoesqueleto e “turn over” protéico e são fundamentais para o
amaciamento da carne no período post mortem (10–12).
Vários são os sistemas que atuam na regulação da atividade das enzimas do sistema calpaína,
entre eles a fosforilação, proteínas de choque térmico, sistema do monofosfato de adenosina cíclico
19
(cAMP), entre outros (13–16) e a regulação e interferência de cada sistema no processo metabólico
de amaciamento da carne necessita investigações científicas para ser elucidada.
A análise proteômica se apresenta como uma ferramenta para auxiliar na investigação dos
mecanismos metabólicos como os envolvidos na diferença fenotípica entre indivíduos. Ela se baseia
na identificação do perfil protéico da amostra analisada, permitindo analisar amostras de organismos
complexos quantificando a abundância de cada proteína identificada e assim permitindo a
comparação entre amostras (17,18).
Este trabalho traz informações sobre o perfil protéico do músculo Longíssimus dorsi de animais
da raça nelore mocho de uma população segregante para maciez da carne, particularidades da
atividade das enzimas do sistema calpaína e informações sobre o processo de purificação da
calpastatina.
Objetivos gerais
- Avaliar o perfil proteômico da carne e o sistema calpaína no período post mortem.
- Purificar e caracterizar a calpastatina.
- Avaliar o perfil proteômico dos extremos de força de cisalhamento do músculo
Longíssimus dorsi.
Objetivos específicos
- Determinar a atividade das enzimas m e µ-calpaína e de seu inibidor nos músculos
Longíssimus dorsi e Triceps brachii.
- Avaliar a diferença proteômica dos músculos Longíssimus dorsi e Triceps brachii ocorrida
entre o dia do abate e o sétimo dia após o abate.
- Purificar os picos do inibidor enzimático calpastatina por cromatografia de troca iônica
- Caracterizar os dois picos do inibidor enzimático calpastatina
- Avaliar a diferença proteômica do músculo Longíssimus dorsi de bovinos da raça Nelore
Mocho de extremos de força de cisalhamento.
20
2 Revisão de literatura
2.1 Estrutura muscular
A carne é formada apartir da conversão do músculo estriado esquelético e a estrutura do está
representada na Figura 1.
Figure 1– Estrutura do músculo estriado esquelético.
Fonte: Adaptado de CHOI et al. (19)
O músculo é composto de 16 a 22% de proteínas e a estrutura mucular é composta pelas fibras
musculares (19). As fibras musculares são agrupadas em feixes por uma membrana (epimísio) e cada
fibra é envolvida também por outra membrana (endomísio). A fibra muscular é composta por
citoplasma diferenciado (sarcoplasma), e pelas miofibrilas.
As proteínas presentes no sarcoplsmaas (sarcoplasmáticas) constituem aproximadamente de
30 a 35 % da proteína total do musculo esquelético. São proteínas solúveis em água na sua maioria,
sendo facilmente separadas das proteínas miofibrilares por centrifugação. Entre elas estão todas as
enzimas da glicólise e a maior parte das enzimas da síntese de carboidratos e de proteínas (20).
As proteínas miofibrilares em sua maioria são insolúveis e são compostas principalmente pela
miosina, actina, proteína C, proteína M, tropomiosina, α-actina e β-actina. São proteínas que formam
os miofilamentos grossos e finos que constituem a miofibrila, e representam 52% a 56% das proteínas
musculares (20).
21
A Tropomiosina, troponina T, M-proteínas, α-actina, β-actina e C-proteínas compõe as
proteínas miofibrilares e são também proteínas que atuam na regulação do processo de contração
muscular, apresentando função de controle direto e indireto no complexo adenosina-trifosfato-actina-
miosina (20).
De acordo com o tipo de metabolismo, as fibras musculares podem ser classificadas em fibras
com metabolismo oxidativo e fibras com metabolismo oxidativo e este tipo de metabolismo foi
relacionado com a maciez da carne. Ouali & Talmant (21) demonstraram que fibras musculares com
o metabolismo predominante glicolítico apresentam maior atividade post mortem da calpaína
favorecendo a proteólise e a maciez. Este tipo de fibra possui em média maior conteúdo de glicogênio,
o que favorece o declínio do pH no período post mortem e está relacionada com uma maior retenção
de água o que resulta em maior suculência a carne (22).
2.2 Maciez da carne
Altamente influenciável por fatores ante mortem e post mortem, tem grande variação entre
animais, raças, músculos e cortes (23,24).
Fatores como idade ao abate, gênero, temperamento, cobertura de gordura subcutânea na
carcaça, quantidade de tecido conectivo, manejo pré abate, velocidade de resfriamento da carcaça e
tempo de maturação influenciam na maciez final da carne (10,25).
Raças zebuínas produzem em média carne menos macia quando comparadas com animais de
raças taurinas (26,27). A variação também é grande entre animais zebuínos (28).
A herdabilidade da caracteristica maciez da carne, tem sido relatadas na literatura como
moderada a alta. Avaliando a maciez por medidas de compressão pelo método de Warner-Bratzler
shear force (WBSF), Gregory et al. (29) reportaram valores de 0,29 de herdabilidade para esta medida
sendo próximo do valor de 0,34 encontrado por Splan et al. (30) e inferiores ao valor de 0,53
encontrados por Shackelford et al.(31). Utilizando painel sensorial para determinar a maciez Gregory
et al. (29) encontraram valor de 0,12 para herdabilidade da maciez da carne sendo inferior aos valores
encontrados por medidas mecânicas. Devido ao fato da herdabilidade da característica em questão ser
moderada a alta, torna-se possível e viável a seleção de animais com característica de carne mais
macia.
A carne de bovinos de origem européia é mais macia comparada à carne de animais de origem
zebuína, o que em parte é explicado pela maior concentração do inibidor enzimático calpastatina
presente no músculo dos animais zebuínos (32) cuja herdabilidade em bovinos foi estimada em 0,65
(31).
22
2.2.1 Sistema calpaína
A maciez da carne está ligada principalmente à taxa e a extensão da proteólise miofibrilar de
proteínas chave na estrutura muscular, provocando o desarranjo e enfraquecimento desta estrutura. O
sistema enzimático das calpaínas é considerado o principal sistema envolvido no amaciamento da
carne no período post mortem e é composto por proteases de cisteína Ca2+ dependente (10,12,33–37).
Os principais membros deste sistema são a micro-calpaína (µ-calpaina) e a mili-calpaína (m-
calpaína), e seu inibidor calpastatina, inibidor natural e específico das referidas calpaínas (35).
Ocorrem em todas as células de vertebrados conservando 90% de homologia na sequência de
aminoácidos entre as espécies, localizadas exclusivamente no citoplasma celular associadas
primariamente, mas não sempre, às proteínas miofibrilares, membrana celular e outras proteínas
solúveis no citoplasma. Possuem o pH ótimo de 7,2 a 8,2 e receberam o nome de acordo com a
concentração molar de Ca2+ requerida para a sua atividade, sendo de 0,3 a 50,0 µM de cálcio para a
µ-calpaína e 0,4 a 0,8 M de cálcio para a m-calpaína (38).
A µ e m-calpaína são heterodímeros compostos por duas sub-unidades uma unidade maior com
peso molecular de aproximadamente 80 kDa e 28 kDa cada. A subunidade maior (sub-unidade de
80kDa), apresenta uma ligeira diferença entre a µ e a m- calpaína, sendo a sub-unidade grande da µ-
calpaína com aproximadamente 81.889 Da e da m-calpaína 79.900 Da (39,40). A sub-unidade menor
(sub-unidade de 28 kDa) é idêntica entre as duas calpaínas e codificada por um gene único,
desempenha um papel importante na regulação da atividade da molécula (41).
A sub-unidade de 28 kDa das calpaínas possui característica hidrofóbica por conter grande
quantidade de resíduos de glicina no domínio II. Dos 64 resíduos de aminoácidos, 40 são de glicina
e em uma sequência de 20 resíduos de glicina, sendo sugerido como provável local de ligação aos
fosfolipídeos juntamente ao domínio III da sub-unidade de 80 kDa, compõe a provável estrutura de
ligação às membranas (42).
Possuindo 4 domínios, a sub-unidade de 80 kDa é a unidade que apresenta a parte proteolítica
da molécula. No domínio II os resíduos de cisteína na posição 115 (µ-calpaína) ou 105 (m-calpaína),
histidina na posição 272 (µ-calpaína) ou 262 (m-calpaína) e asparagina na posição 296 (µ-calpaína)
ou 286 (m-calpaína), formam a tríade catalítica característica das proteases de cisteína (35). O
domínio IV está relacionado à dimerização da molécula, sendo o local da ligação com a sub-unidade
de 28kDa.
A ativação de ambas as enzimas pela ligação com o Ca2+ é predita pela cristalografia da m-
calpaína (até o presente momento, não se tem evidenciada a estrutura cristalográfica da µ-calpaína,
23
portanto a ativação é predita pela estrutura cristalográfica da m-calpaína), onde o Ca2+ se liga no
domínio IV da sub-unidade de 80kDa e no domínio II da sub-unidade de 28 kDa, provocando uma
pequena mudança conformacional aproximando os resíduos que compõe a tríade proteolítica de
cisteína tornando ativo o sítio catalítico da molécula (43).
A ativação da µ e m-calpaína também leva a uma autoproteólise e este evento diminui a
necessidade da quantidade de Ca2+ requerida para atingir a metade da atividade máxima da µ-calpaína
de 3 a 50 µM para 0,5 a 2,0 µM de Ca2+ e de 400 a 800 µM para 50 a 150 µM de Ca2+ para a m-
calpaína. Também reduz o requerimento de Ca2+ para ligar a calpastatina de 40 µM para 0.042 µM
de Ca2+ da µ-calpaína e de 250 a 500 µM para 25µM de Ca2+ da m-calpaína (35).
A autólise da sub-unidade de 80 kDa da µ-calpaína ocorre pela remoção de 14 resíduos de
aminoácidos da parte NH2-terminal, produzindo um produto intermediário de 78 kDa seguido pela
remoção de mais 12 resíduos de aminoácidos produzindo um fragmento de 76 Kda. A autólise da
sub-unidade de 80 kDa da m-calpaína se inicia com a retirada de 9 resíduos de aminoácidos seguidos
da remoção de 10 resíduos para a produção do fragmento de 78 kDa (44,45).
A taxa e a extensão da autólise da µ-calpaína está diretamente relacionada ao enfraquecimento
da estrutura miofibrilar, parte chave no processo de amaciamento da carne no período post mortem
(46). Algumas proteínas específicas são substratos para as calpaínas e entre elas estão a desmina,
distrofina, filanina, miosina, nebulina, talina, titina, tropomiosina, troponina-T, troponina-I, tubulina,
proteína C, vimetina e vinculina, sendo todas proteínas que compõe o citoesqueleto (35,47). A
produção de fragmentos das proteínas estruturais pela proteólise post mortem está positivamente
relacionada com a extensão da proteólise (10).
Inibidor exclusivo das calpaínas, a calpastatina foi descoberta nos anos 70 durante o processo
de purificação das calpaínas (48). Um único gene codifica a calpastatina em bovinos (gene CAST
presente no cromossomo 7) produzindo várias isoformas variando de 17,5 a 84 kDa (49) por
transcrições alternativas e diversos promotores presentes em vários tecidos.
A isoforma de calpastatina predominante identificada no músculo esquelético de bovinos
possui por volta de 74 kDa e migra para uma posição entre 115 a 125 kDa em gel de poliacrilamida
(50,51). Possui o primeiro domínio L mais quatro domínios com capacidade inibitória. Por esta
característica uma molécula de calpastatina pode inibir até quatro moléculas de calpaína (35).
Além de inibidora, a calpastatina se constitui substrato e é quebrada pela ação das calpaínas,
mas mesmo fragmentada possui atividade inibitória. A fragmentação da calpastatina presente no
músculo esquelético é relacionada à quebra pela ação das calpaínas e os fragmentos gerados são
semelhantes aos fragmentos gerados pela degradação in vitro da calpastatina purificada do músculo
Longíssimus dorsi (50).
24
A regulação desse sistema acontece por várias vias como através a via do AMPc, fosforilação,
acetilação e proteínas de shock térmico (13,33,52–54). Todos estes mecanismos e a possível interação
entre eles nos indicam que vários são os caminhos a serem pesquisados para melhor entender o
processo de proteólise post mortem. Uma das ferramentas que vem sendo utilizada para estudar estes
mecanismos é proteômica, utilizando tecnologia como a eletroforese em gel de poliacrilamida, a
cromatografia líquida e equipamentos de espectometria de massas de alta tecnologia e sensibilidade
(55).
2.3 Técnicas utilizadas para o estudo de proteínas
A proteômica é o estudo feito para avaliar e caracterizar o perfil protéico de uma dada amostra.
Algumas técnicas adotadas no estudo da proteômica utilizam princípios como a eletroforese em gel
unidimensional e bidimensional, baseada na separação das proteínas pelo seu ponto isoelétrico e peso
molecular ou utilizando técnicas de cromatografia. Ambos os métodos necessitam da espectometria
de massas para identificar o perfil protéico (56,57).
O termo “proteomica” surgiu para descrever o conjunto de proteínas expressas pelo genoma.
A aplicação da técnica de eletroforese bidimensional em gel de poliacrilamida aliado a espectrometria
de massas em conjunto a bioinformática, foi primeiramente utilizada por professores da Universidade
de New South Wales – Sidney, Austrália, e professores da Universidade de Genebra, Suíça em uma
conferência em Siena – Itália, pelos professores PhD e pesquisadores Marc Wilkins e Keith Williams
em 1994 (17).
O genoma é o conjunto de genes de uma espécie, ou seja, todo o conjunto do DNA que ele
carrega em suas células (58). A genômica é o estudo do tamanho, da estrutura física e da seqüência
de informações contidas no DNA de um organismo. A proteômica dedica-se a estudar a soma total
de proteínas de uma célula do ponto de vista de suas funções individuais e como a interação de
proteínas específicas com outros componentes celulares afeta o funcionamento destas proteínas (59).
Devido à natureza dinâmica da produção protéica celular, fez-se muito importante a análise das
sequências de nucleotídeos, mas nem sempre há uma relação direta com níveis de proteínas expressas
e de sua atividade biológica. Por exemplo, as mudanças pós transducionais do RNA como a
glicosilação, fosforilação, acilação, ubiquitilação, hidroxilação, carboxilação entre outras
consequentes de diversos estímulos e condições, alteram a atividade. A proteômica representa, pelos
motivos expostos, uma das formas mais eficientes de investigar as funções e os processos metabólicos
das proteínas produzidas pelas células e para o estudo funcional dos genes de organismos complexos
(60).
25
2.4 Aplicação da proteômica na ciencia animal
Alterações bioquímicas durante todo o processo de transformação do músculo em carne e
durante o período de maturação da carne vêm sido elucidadas com a aplicação das técnicas
proteômicas. Todo o período pré o pós abate com as diversas condições de armazenagem
influenciarão no processo de maturação da carne ou amaciamento, processo este importante para a
incrementação deste atributo organoléptico (61).
A comparação entre animais com genes homozigotos e heterozigotos para genes com deleção
da miostatina, proteína responsável pela limitação do crescimento muscular, e um grupo controle com
a presença do gene da miostatina demonstrou alta expressão de miostatina quando comparado o perfil
proteômico dos animais controle com os animais homozigotos e heterozigotos para a deleção da
miostatina (62).
Mecanismos de controle do metabolismo glicolítico e o metabolismo oxidativo foram
encontrados em ovinos, juntamente com proteínas responsáveis pelo gasto de energia como a
glutationa-S-transferase-Pi. Proteínas responsáveis pelo transporte do ferro como a transferina
também foram evidenciadas induzidas com esta condição (63).
Na comparação do perfil proteômico entre animais no início da fase de engorda foram
encontradas diferenças como a expressividade da miosina de cadeia leve e a zinc finger 323, no
estágio final de acabamento e a triosefosfato isomerase e a succinato desidrogenase envolvidas no
metabolismo energético (19).
Durante o processo de tranformação do músculo em carne, no período entre 0 a 24 horas post-
mortem a ação das proteínas cofilina, lactoilglutationa liase, e mais 15 proteínas foram evidenciadas
por Jia et al. (64) e estes autores atriburam proteínas ligadas a proteção celular contra a morte celular
como as principais mudanças neste período post mortem.
Diferença proteômica entre bovinos sadios de raças diferentes foram encontradas comparando
animais da raça Chianina com animais da raça Holandesa (65). São raças selecionadas para produção
de leite (Holandesa) e produção de carne (Chianina). Os animais da raça holandesa tiveram uma maior
expressividade da argininosuccinato-liase, envolvida no ciclo da uréia, a acetil-CoA-acil-transferase-
1, envolvida na cadeia da β-oxidação e degradação do dos ácidos graxos, que também foi encontrada
a expressividade desta enzima em vacas holandesas em lactação por Xu & Wang (66).
Também foi observada maior expressividade da anexina-IV, sendo esta uma proteína de
membrana Ca+ dependente com a sua função fisiológica não totalmente elucidada, mas com um papel
na ligação entre as membranas celular e das vesículas de exocitose, diminuição da permeabilidade a
íons H+ e regulação da condutância de íons. Nos animais da raça Chianina foram mais expressas as
26
proteínas de cadeia-C, uma forma do fibrinogênio bovino, a galactose mutarotase, uma enzima
envolvida no metabolismo dos carboidratos, convertendo açúcares em galactose. A
fumarilacetoacetato hidrolase também foi mais expressa, esta proteína envolvida na síntese de
aminoácidos. Na via da gliconeogênese a frutose-1,6-bifosfatase é fundamental e foi mais expressa
em animais da raça Chianina juntamente com as enzimas da família das sulfotransferase, que são
envolvidas na atividade hepática de detoxificação em várias situações (65).
2.5 Purificação de proteínas
Um dos passos para o estudo mais detalhado de uma determinada proteína é a sua purificação
ou semi-purificação. A partir daí podemos caracterizar a estrutura e obter mais informações químicas,
bioquímicas e funcionais (67). Uma das técnicas utilizadas para a purificação protéica é a
cromatografia utilizando vários princípios como a cromatografia imunoafinidade. Esta técnica é
empregada para purificação das enzimas do sistema calpaína com sucesso (68), possibilitando o
estudo mais minucioso e detalhado das enzimas e sua atividade em várias situações in vivo e in vitro.
A técnica de eletroforese pode nos fornecer informações detalhadas sobre a estrutura e
modificações post mortem ocorridas (47,69). Informações interessantes podem ser retiradas
utilizando a técnica de western blotting e o uso de anti-corpos específicos para cada proteína desejada.
O uso destas técnicas conjugadas traz informações importantes, auxiliando na pesquisa com
proteínas.
3 Referências
1. IBGE. Sistema IBGE de recuperação automática (SIDRA) - Censo Agropecuário. Inst Bras Geogr e Estatística [Internet]. 2014;1–10. Available from: http//www.ibge.sidra.gov.br/
2. Alves DD, Goes RH de T e B de, Mancio AB. Maciez da carne bovina. Ciência Anim Bras. 2005;6(3):135–49.
3. MAGNABOSCO CU, SAINZ RD, FARIA CU, YOKOO MJ, MANICARDI F, BARBOSA V, et al. Avaliação genética e critérios de seleção para características de carcaça em zebuínos: relevância econômica para mercados globalizados. In: V Simpósio de Produção de Gado de Corte, Anais [Internet]. Viçosa; 2006. Available from: http://simcorte.com/index/Palestras/5_simcorte/simcorte9.pdf
4. Watson R, Gee A, Polkinghorne R, Porter M. Consumer assessment of eating quality - Development of protocols for Meat Standards Australia (MSA) testing. Aust J Exp Agric. 2008;48(11):1360–7.
5. BOUTON PE, HARRIS P V., SHORTHOSE WR. EFFECT OF ULTIMATE pH UPON THE WATER???HOLDING CAPACITY AND TENDERNESS OF MUTTON. J Food Sci. 1971;36(3):435–9.
27
6. Boleman SJ, Boleman SL, Miller RK, Taylor JF, Cross HR, Wheeler TL, et al. Consumer Evaluation of Beef of Known Categories of Tenderness. J Anim Sci. 1997;75(6):1521–4.
7. Kim YH, Lonergan SM, Huff-Lonergan E. Protein denaturing conditions in beef deep semimembranosus muscle results in limited ??-calpain activation and protein degradation. Meat Sci. 2010;86(3):883–7.
8. Anderson MJ, Lonergan SM, Huff-Lonergan E. Myosin light chain 1 release from myofibrillar fraction during postmortem aging is a potential indicator of proteolysis and tenderness of beef. Meat Sci [Internet]. 2012 Feb [cited 2012 Jul 13];90(2):345–51. Available from: http://www.ncbi.nlm.nih.gov/pubmed/21889269
9. Shackelford SD, Koohmaraie M, Miller MF, Crouse JD, Reagan JO. An evaluation of tenderness of the longissimus muscle of Angus by Hereford versus Brahman crossbred heifers. J Anim Sci. 1991;
10. Huff-Lonergan E, Mitsuhashi T, Beekman DD, Parrish FC, Olson DG, Robson RM. Proteolysis of Specific Muscle Structural Proteins by ??-Calpain at Low pH and Temperature is Similar to Degradation in Postmortem Bovine Muscle. J Anim Sci. 1996;74(5):993–1008.
11. Geesink GH, Nonneman D, Koohmaraie M. An improved purification protocol for heart and skeletal muscle calpastatin reveals two isoforms resulting from alternative splicing. Arch Biochem Biophys [Internet]. 1998;356(1):19–24. Available from: http://www.ncbi.nlm.nih.gov/pubmed/9681986
12. Koohmaraie M, Geesink GH. Contribution of postmortem muscle biochemistry to the delivery of consistent meat quality with particular focus on the calpain system. Meat Sci. 2006;74(1):34–43.
13. Salamino F, De Tullio R, Michetti M, Mengotti P, Melloni E, Pontremoli S. Modulation of calpastatin specificity in rat tissues by reversible phosphorylation and dephosphorylation. Biochem Biophys Res Commun. 1994;199:1326–32.
14. Cong M, Goll DE, Antin PB. cAMP responsiveness of the bovine calpastatin gene promoter. Biochim Biophys Acta - Gene Struct Expr. 1998;
15. Hood JL, Logan BB, Sinai AP, Brooks WH, Roszman TL. Association of the calpain/calpastatin network with subcellular organelles. Biochem Biophys Res Commun. 2003;
16. Averna M, De Tullio R, Pedrazzi M, Bavestrello M, Pellegrini M, Salamino F, et al. Interaction between calpain-1 and HSP90: New insights into the regulation of localization and activity of the protease. PLoS One. 2015;
17. Wilkins MR, Appel RD, Williams KL, Hochstrasser DF. Proteome research: concepts, technology and application. Springer Science & Business Media; 2008.
18. Borges CL, Parente JA, Barbosa MS, Santana JM, Báo SN, de Sousa MV, et al. Detection of a homotetrameric structure and protein-protein interactions of Paracoccidioides brasiliensis formamidase lead to new functional insights. FEMS Yeast Res [Internet]. 2010 Feb;10(1):104–13. Available from: http://femsyr.oxfordjournals.org/cgi/doi/10.1111/j.1567-1364.2009.00594.x
19. Choi Y.M. KBC. Muscle fiber characteristics, myofibrillar protein isoforms, and meat quality. Livest Sci [Internet]. 2009;122(2–3):105–18. Available from: http://www.scopus.com/inward/record.url?eid=2-s2.0-64749096528&partnerID=40&md5=e5da785274426d4487e679818c0e3809
20. Sgarbieri VC. Proteínas em alimentos protéicos: propriedades-degradações-modificações. Livraria Varela; 1996. 517 p.
21. Ouali A, Talmant A. Calpains and calpastatin distribution in bovine, porcine and ovine skeletal muscles. Meat Sci. 1990;28(4):331–48.
22. Bernard C, Cassar-Malek I, Le Cunff M, Dubroeucq H, Renand G, Hocquette JF. New indicators of beef sensory quality revealed by expression of specific genes. J
28
Agric Food Chem. 2007; 23. Morgan JB, Savell JW, Hale DS, Miller RK, Griffin DB, Cross HR, et al. National beef
tenderness survey. J Anim Sci. 1991;69(8):3274–83. 24. Reuter BJ, Wulf DM, Maddock RJ. Mapping intramuscular tenderness variation in
four major muscles of the beef round. J Anim Sci. 2002;80(10):2594–9. 25. Hopkins DL, Thompson JM. The relationship between tenderness, proteolysis,
muscle contraction and dissociation of actomyosin. Meat Sci. 2001; 26. Burrow HM, Moore SS, Johnston DJ, Barendse W, Bindon BM. Quantitative and
molecular genetic influences on properties of beef: A review. Vol. 41, Australian Journal of Experimental Agriculture. 2001. p. 893–919.
27. Bianchini W, Silveira AC, Jorge AM, Arrigoni MDB, Martins CL, Rodrigues É, et al. Efeito do grupo genético sobre as características de carcaça e maciez da carne fresca e maturada de bovinos superprecoces. Rev Bras Zootec. 2007;36(6 SUPPL.):2109–17.
28. O’Connor SF, Tatum JD, Wulf DM, Green RD, Smith GC. Genetic Effects on Beef Tenderness in Bos indicus Composite and Bos taurus Cattle. J Anim Sci. 1997;75(7):1822–30.
29. Gregory KE, Cundiff L V., Koch RM, Dikeman ME, Koohmaraie M. Breed effects, retained heterosis, and estimates of genetic and phenotypic parameters for carcass and meat traits of beef cattle. J Anim Sci. 1994;72(5):1174–83.
30. Splan RK, Cundiff L V., Dikeman ME, Van Vleck LD. Estimates of parameters between direct and maternal genetic effects for weaning weight and direct genetic effects for carcass traits in crossbred cattle. J Anim Sci. 2002;80(12):3107–11.
31. Shackelford SD, Wheeler TL, Koohmaraie M. Relationship between shear force and trained sensory panel tenderness ratings of 10 major muscles from Bos indicus and Bos taurus cattle. J Anim Sci. 1995;73(11):3333–40.
32. Wheeler TL, Savell JW, Cross HR, Lunt DK, Smith SB. Mechanisms associated with the variation in tenderness of meat from Brahman and Hereford cattle. J Anim Sci. 1990;68(12):4206–20.
33. Pontremoli S, Viotti PL, Michetti M, Salamino F, Sparatore B, Melloni E. Modulation of inhibitory efficiency of rat skeletal muscle calpastatin by phosphorylation. Biochem Biophys Res Commun. 1992;
34. Thompson VF, Goll DE. Purification of µ-calpain, m-calpain, and calpastatin from animal tissues. In: Methods in Molecular Biology. Totowa; 2000. p. 3–16.
35. Goll DE, Thompson VF, Li H, Wei W, Cong J. The calpain system. Physiol Rev [Internet]. 2003;83(3):731–801. Available from: http://www.ncbi.nlm.nih.gov/pubmed/12843408
36. Geesink GH, Kuchay S, Chishti AH, Koohmaraie M. ??-calpain is essential for postmortem proteolysis of muscle proteins. J Anim Sci. 2006;84(10):2834–40.
37. Ono Y, Sorimachi H. Calpains - An elaborate proteolytic system. Biochimica et Biophysica Acta - Proteins and Proteomics. 2012.
38. Cong J, Goll DE, Peterson AM, Kapprell H-P. The role of autolysis in activity of the Ca2+-dependent proteinases (μ-calpain and m-calpain). J Biol Chem. 1989;264(17):10096–103.
39. Aoki K, Imajoh S, Ohno S, Emori Y, Koike M, Kosaki G, et al. Complete amino acid sequence of the large subunit of the low-Ca2+-requiring form of human Ca2+-activated neutral protease (muCANP) deduced from its cDNA sequence. FEBS Lett. 1986;205:313–7.
40. Imajoh S, Aoki K, Ohno S, Emori Y, Kawasaki H, Sugihara H, et al. Molecular cloning of the cDNA for the large subunit of the high-calcium-requiring form of human calcium-activated neutral protease. Biochemistry [Internet]. 1988 Oct;27(21):8122–8. Available from: http://pubs.acs.org/doi/abs/10.1021/bi00421a022
29
41. Ohno S, Minoshima S, Kudoh J, Fukuyama R, Shimizu Y, Ohmi-Imajoh S, et al. Four genes for the calpain family locate on four distinct human chromosomes. Cytogenet Genome Res. 1990;53(4):225–9.
42. Imajoh S, Kawasaki H, Suzuki K. The Amino-Terminal Hydrophobic Region of the Small Subunit of Calcium-Activated Neutral Protease (CANP) Is Essential for Its Activation by Phosphatidylinositol. 1986;99(4):1281–4.
43. Yount RG. Subfragment 1: the first crystalline motor. J Muscle Res Cell Motil. 1993;14(6):547–51.
44. Zimmerman UJ, Schlaepfer WW. Two-stage autolysis of the catalytic subunit initiates activation of calpain I. Biochim Biophys Acta [Internet]. 1991;1078(2):192–8. Available from: http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=2065086
45. Brown N, Crawford C. Structural modifications associated with the change in Ca2+ sensitivity on activation of m-calpain. FEBS Lett. 1993;322(1):65–8.
46. Rowe LJ, Maddock KR, Lonergan SM, Huff-Lonergan E. Oxidative environments decrease tenderization of beef steaks through inactivation of ??-calpain. J Anim Sci. 2004;82(11):3254–66.
47. Lametsch R, Roepstorff P, Møller HS, Bendixen E. Identification of myofibrillar substrates for μ-calpain. Meat Sci. 2004;68(4):515–21.
48. Dayton WR, Goll DE, Zeece MG, Robson RM, Reville WJ. A Ca2+-activated protease possibly involved in myofibrillar protein turnover. Purification from porcine muscle. Biochemistry. 1976;15(10):2150–8.
49. Bishop MD, Kappes SM, Keele JW, Stone RT, Sunden SLF, Hawkins GA, et al. A genetic linkage map for cattle. Genetics. 1994;136(2):619–39.
50. Doumit ME, Koohmaraie M. Immunoblot analysis of calpastatin degradation: Evidence for cleavage by calpain in postmortem muscle. J Anim Sci. 1999;77(6):1467–73.
51. Cruzen SM, Paulino PVR, Lonergan SM, Huff-Lonergan E. Postmortem proteolysis in three muscles from growing and mature beef cattle. Meat Sci. 2014;96(1):854–61.
52. Pontremoli S, Melloni E, Viotti PL, Michetti M, Salamino F, Horecker BL. Identification of two calpastatin forms in rat skeletal muscle and their susceptibility to digestion by homologous calpains. Arch Biochem Biophys. 1991;288(2):646–52.
53. Hovland R, Eikhom TS, Proud CG, Cressey LI, Lanotte M, Døskeland SO, et al. cAMP inhibits translation by inducing Ca2+/calmodulin-independent elongation factor 2 kinase activity in IPC-81 cells. FEBS Lett. 1999;
54. Lomiwes D, Farouk MM, Frost DA, Dobbie PM, Young OA. Small heat shock proteins and toughness in intermediate pHu beef. Meat Sci. 2013;
55. Grubbs JK, Huff-Lonergan E, Gabler NK, Dekkers JCM, Lonergan SM. Liver and skeletal muscle mitochondria proteomes are altered in pigs divergently selected for residual feed intake. J Anim Sci. 2014;92(5):1995–2007.
56. Hollung K, Veiseth E, Jia X, Færgestad EM, Hildrum KI. Application of proteomics to understand the molecular mechanisms behind meat quality. Meat Sci. 2007;77(1 SPEC. ISS.):97–104.
57. Lippolis JD, Reinhardt TA. Centennial paper: Proteomics in animal science. J Anim Sci. 2008;86(9):2430–41.
58. Deloukas P. A Physical Map of 30,000 Human Genes. Science (80- ) [Internet]. 1998 Oct 23 [cited 2012 Sep 4];282(5389):744–6. Available from: http://www.sciencemag.org/cgi/doi/10.1126/science.282.5389.744
59. Malacinski GM. Fundamento de biologia molecular [Internet]. Guanabara Koogan; 2005. Available from: https://books.google.com.br/books?id=KjCHAAAACAAJ
60. Silva AM da S e, Corrêa GC, Reis EM. PROTEOMICA - ABORDAGEM
30
FUNCIONAL DO ESTUDO DO GENOMA. Saude e Ambient em Rev. 2007;2(2):01–10.
61. Mullen AM, Stapleton PC, Corcoran D, Hamill RM, White A. Understanding meat quality through the application of genomic and proteomic approaches. Meat Sci. 2006;74(1):3–16.
62. Bouley J, Meunier B, Chambon C, De Smet S, Hocquette JF, Picard B. Proteomic analysis of bovine skeletal muscle hypertrophy. Proteomics [Internet]. 2005 Feb [cited 2012 Sep 4];5(2):490–500. Available from: http://www.ncbi.nlm.nih.gov/pubmed/15627970
63. Hamelin M, Sayd T, Chambon C, Bouix J, Bibé B, Milenkovic D, et al. Proteomic analysis of ovine muscle hypertrophy. J Anim Sci [Internet]. 2006 Dec [cited 2012 Sep 4];84(12):3266–76. Available from: http://www.ncbi.nlm.nih.gov/pubmed/17093219
64. Jia X, Hollung K, Therkildsen M, Hildrum KI, Bendixen E. Proteome analysis of early post-mortem changes in two bovine muscle types: M. longissimus dorsi and M. semitendinosis. Proteomics [Internet]. 2006 Feb [cited 2012 Jul 13];6(3):936–44. Available from: http://www.ncbi.nlm.nih.gov/pubmed/16372268
65. Miarelli M, Signorelli F. Differential expression of liver proteins in Chianina and Holstein young bulls. J Anim Sci. 2010;88(2):593–8.
66. Xu C, Wang Z. Comparative proteomic analysis of livers from ketotic cows. Vet Res Commun. 2008;32(3):263–73.
67. Mellgren RL. On the mechanism of binding of calpastatin, the protein inhibitor of calpains, to biologic membranes. Biochem Biophys Res Commun. 1988;150(1):170–6.
68. Murachi T. Calpain and calpastatin. Vol. 8, Trends in Biochemical Sciences. 1983. p. 167–9.
69. Lametsch R, Lonergan S, Huff-Lonergan E. Disulfide bond within μ-calpain active site inhibits activity and autolysis. Biochim Biophys Acta - Proteins Proteomics. 2008;1784(9):1215–21.
31
1. (Trabalho submetido à revista Meat Science)
CAPITULO 2 - Calpastatin variants activities during beef aging and differential postmortem
proteolysis in two muscles
Authors:
Leonardo Guimaraes de Oliveira
Department of Animal Production, Universidade Federal de Goias, Goiania, Brazil
Eduardo Francisquine Delgado
Department of Animal Science, ESALQ/Universidade de São Paulo, Piracicaba, Brazil
Edward M Steadham
Animal Science Department, Iowa State University, Ames, IA, United States of America
Elisabeth Huff-Lonergan
Animal Science Department, Iowa State University, Ames, IA, United States of America
Steven M Lonergan
Animal Science Department, Iowa State University, Ames, IA, United States of America
ABSTRACT:
The relative role played by the two peaks of calpastatin (CAST 1 and CAST 2) eluted during
chromatography has not been elucidated. The aim of this study was to verify the calpastatin variants
during meat ageing and possible relationship to calpain-1 autolysis as well as protein degradation.
The Longissimus lumborum (LL) and Triceps brachii (TB) muscles were obtained from six
crossbred steers and samples prepared from day 0, 1 and 7 postmortem.The drop of CAST total
during ageing was due to decrease of CAST 2 in both muscles. For CASTs and calpain-1 activities,
there were interactions between muscle and day PM. The CAST 2 to calpain-1 ratio at day 0 was
higher for TB, which presented lower calpain autolysis and myofibrillar protein degradation. Heat
shock 70 protein family were associated to tenderization during ageing, with greater differences in
LL. The calpastatin peaks protein profile and its function in the postmortem proteolytic process still
unclear and more investigation is necessary.
Key words: Triceps brachii, Longissimus lumborum, Calpain, proteome, chromatography,
proteolysis.
Highlights.
Calpastatin activity decrease during aging due decrease of peak 2 of calpastatin.
115 kDa calpastatin isoform is present in both calpastatin peaks.
Heat shock protein 70 probably is involved in meat ageing period.
32
1. Introduction
Meat tenderization during postmortem aging is a result of weakening of the organized structure of
the myofibrils through enzymatic action largely governed by the calpain system (Koohmaraie,
1994; Huff-lonergan et al., 1996; Geesink et al., 2006; Ono and Sorimachi, 2012). Calpains are
calcium-dependent cysteine proteases with two ubiqitious isoforms, calpain-1 and calpain-2. Both
are composed of an 80 kDa subunit that contains the catalytic site. The 28 kDa subunit works as a
regulatory and stabilizing component of the heterodimer (Goll et al., 2003).
Meat from steaks with high calpastatin activity generally exhibit less postmortem proteolysis of
myofibrillar protein (Koohmaraie, 1994; S. M. Lonergan et al., 2001). Calpastatin is an endogenous
inhibitor of the ubiquitous calpains and acts as a suicide substrate for those proteinases (Doumit and
Koohmaraie, 1999). The degradation of calpastatin by calpain 1 and calpain-2 results in some
fragments that differ in their elution during liquid chromatography in the calpastatin purification
process (Mohan and Nixon, 1995). Experiments conducting calpastatin separation by anion
exchange column chromatography have reported two peaks of calpain inhibitory activity in rat
skeletal muscle (Pontremoli et al., 1992), bovine skeletal muscle (Geesink, Nonneman and
Koohmaraie, 1998; Monica Averna et al., 2001; Camou et al., 2007; Samanta et al., 2010; Cruzen
et al., 2015), porcine skeletal muscle (Cruzen et al., 2013) and salmon skeletal muscle (Gaarder,
Thomassen and Veiseth-Kent, 2011a). In addition, it has been reported that, there are differences in
observed postmortem proteolysis between the Triceps and Longissimus muscles that appear to be
related to calpastatin activity measured in the so-called peak 2 calpastatin (Cruzen et al., 2014).
Determining the exact origin, composition and the role of those calpastatin peaks during post
mortem aging is a challenge. Some possible explanations for the origin and composition of those
peaks could include: degradation products (Doumit and Koohmaraie, 1999), several transcripts
variants of calpastatin gene (Parr et al., 2004) and posttranslational modifications, including
phosphorylation (Pontremoli et al., 1992).
33
Because of previous research by our lab and others, this study was designed to evaluate the activity
of calpain-1, calpain-2 and calpastatin peaks during post mortem aging of two beef muscles using
ion exchange chromatography, and to examine the changes of protein profile using proteomic tools.
2. Matherials and methods
2.1. Experiment 1
Six crossbred steers were slaughtered in pairs at the Iowa State University Meat Laboratory on 3
different days following standard humane procedures. The carcasses were not electrically
stimulated. Animals weighed 604.4 ± 44.7kg at the time of slaughter. Samples from each carcass
(approximately 0.3 kg center cut sections) from the Longissimus lumborum (LL), and Triceps
brachii (TB) were collected within 90 min post-exsanguination (day 1). Immediately after
collection, the samples were briefly placed on ice and immediately taken to the laboratory for
extraction, chromatographic separation and activity assays. The carcasses were held in a 1° C cooler
for 24 hours after slaughter. Muscle (LL and TB) samples were collected (approximately 1.0 kg)
from the chilled carcasses at 24 h postmortem. These samples were placed on ice and immediately
processed in the laboratory. Those samples were divided in two, one used for extraction, separation
and activity assays (day 1). The remainder of each muscle was vacuum packaged and stored for 6
days at 4 °C to complete 7 days post mortem (day 7) aging. The aged samples were then extracted
and analyzed after this period.
2.1.1.Extraction and calpain system activities
A transverse cut of muscle was taken and visible fat and connective tissue were removed. The
muscle was then finely minced using a knife. Two, samples, 5 grams each, were homogenized
immediately using a Polytron PT 3100 (Lucerne, Switzerland) in three 30 s bursts (with 30 s of
34
interval between bursts) in 3 volumes (w/v) of ice-cold extraction buffer (100 mM Tris–HCl, 10
mM EDTA, pH 8.3, 4 °C). Immediately before use, 0.1% 2-mercaptoethanol (2-MCE), 2 μM of E-
64, and 100 mg/L trypsin inhibitor were added to the buffer. The homogenate was centrifuged at
40,000 × g for 30 min at 4 °C, and the supernatant was filtered through cheesecloth and dialyzed in
40 volumes of TEM (40 mM Tris–HCl, 1 mM EDTA, pH 7.4, 0.1% MCE).
After dialysis, samples were centrifuged at 40,000 ×g for 30 min at 4 °C and the supernatant filtered
through cheesecloth. The filtered supernatant was loaded onto a 20 mL Q-Sepharose Fast Flow (GE
Healthcare Biosciences, Pittsburgh, PA) anion exchange column. Columns had been previously
equilibrated with TEM. After the sample was loaded, the column was washed with 250 mL TEM.
Calpastatin, μ-calpain, and calpain-2 were eluted using a linear gradient of 60 to 400 mM KCl in
TEM with a flow rate of 2.0 mL/min, fraction volume of 2.5 mL on an ÄKTA™ prime automated
liquid chromatography system (Amersham Pharmacia Biotech Inc., Piscataway, NJ). The first peak
of calpastatin activity (CAST 1) was eluted between 60 to 90 mM KCl. The second peak of
calpastatin (CAST 2) was eluted between 120 to 180 mM KCl, followed by μ-calpain activity (180
to 240 mM KCl) and calpain-2 activity (300 to 400 mM KCl). An example of the elution peaks is
shown in Figure 1.
The caseinolytic method (Koohmaraie, 1990) with some modifications was used to determine the
identity of fractions containing CAST 1, CAST 2, calpain-1, and calpain-2 activity. The same assay
was used to quantify activity. One unit of μ-or calpain-2 activity was defined as the amount
required to catalyze an increase of 1 absorbance unit of the supernatant at 278 nm. One unit of
calpastatin activity was defined as the amount required to inhibit 1 unit of porcine lung calpain-2.
2.1.2 SDS-PAGE and immunoblotting
The same extraction protocol that was used to prepare samples for calpain/calpastatin extraction
(see Section 2.1.1) was used to extract samples for SDS-PAGE and immunoblotting. After
35
centrifugation of the sarcoplasmic fraction, the protein concentrations were determined using the
method described by Lowry, Rosebrough, Farr, & Randall, (1951) technique using premixed
reagents (Bio-Rad Laboratories, Hercules, CA). The protein concentration of each sample was
adjusted to 6.4 mg/mL and one mL was mixed with 0.5 mL of SDS sample buffer (30 mM Tris-
HC1, 3 mM EDTA, 3% [w/v] SDS, 30% [vol/vol] glycerol, and 30 pg of pyronin Y /mL, pH 8.0)
(Wang, 1982), 0.1 mL MCE and stored at -80 oC until analysis. The myofibrilar fraction was
obtained using the pellet following the protocol as described by Huff-Lonergan, Mitsuhashi,
Parrish, & Robson (1996). Protein concentrations were determined using the method described by
Lowry, Rosebrough, Farr, & Randall, (1951) technique using premixed reagents (Bio-Rad
Laboratories, Hercules, CA). Samples were adjusted to 6.4 mg/mL and one mL was mixed with 0.5
mL of SDS sample buffer (Wang, 1982), 0.1 mL MCE and stored at -80 oC until analysis. The
sarcoplasmic fraction was used to determine presence of calpastatin and calpain-1 autolysis. For
desmin and troponin-T degradation and calpain-1 autolysis the myofibril fraction was used.
An 8% polyacrylamide separating gel (acrylamide:N,N′-bis-methylene acrylamide = 100:1 [w/w],
0.1% [w/v] SDS, 0.05% [v/v] TEMED, 0.05% [w/v] ammonium persulfate, and 0.5 M Tris–HCl,
pH 8.8) was used to detect calpain-1 autolysis. Ten percent polyacrylamide separating gels were
used to determine calpastatin, desmin and troponin-T degradation. A 5% polyacrylamide gel
(acrylamide:N,N′-bis-ethylene acrylamide = 100:1 [w/w], 0.1% [w/v] SDS, 0.125% [v/v] TEMED,
0.075% [w/v] ammonium persulfate, and 0.125 M Tris–HCl, pH 6.8) was used for the stacking gel.
Gels (10 cm wide ×8 cm tall ×1.5 cm thick) were loaded with 40 μg protein per lane and run at a
constant 20 V on SE 260 Hoefer Mighty Small II (Hoefer, Inc., Holliston, MA) electrophoresis
units overnight.
Transfer of protein from SDS-PAGE gels to a PVDF membrane was performed as described by
Melody et al. (2004). Membranes were blocked for 1 h at room temperature in PBS with 0.1%
Tween-20 and 5% nonfat dry milk and were then incubated in primary antibody over-night at 4 °C.
Primary antibodies and dilutions were as follows: calpain-1, 1:10,000 (MA3-940, ThermoScientific,
36
Rockford, IL); calpastatin, 1:5,000 (MA3-944, Thermo Scientific, Rockford, IL); desmin 1:30,000
(Policlonal antibody anti desmin created in house by immunizing a rabbit with purified desmin in
1978 at Iowa State University and kindly provided by Dr. Ted Huiatt); and troponin-T, 1:40,000
(JLT-12; Sigma, St Louis, MO). Membranes were washed 3 times in PBS–Tween for 10 min each
at room temperature. The membranes incubated with anti-calpain-1, anti-calpastatin and anti-
troponin-T were then incubated in a goat anti-mouse horseradish peroxidase (No 2554, Sigma, St.
Louis, MO) secondary antibody at 1:10,000 dilution. Membranes incubated with anti-desmin were
incubated in a goat anti-rabbit horseradish peroxidase (No 31460, Sigma, St. Louis, MO) secondary
antibody at 1:60,000 dilution for 1 h at room temperature. After 3 additional 10 min washes in
PBS–Tween, blots were developed using Super Signal West Femto Maximum Sensitivity Substrate
(ThermoScientific, Rockford, IL) and imaged using a ChemiImager 5500 (Alpha Innotech, San
Leandro, CA) and Alpha Ease FC software (v 3.03 Alpha Innotech). Bands were quantified by
densitometry; the abundance of the bands were compared to a reference sample loaded on each gel.
2.1.3. Two-Dimensional Difference in Gel Electrophoresis.
Two-dimensional DIGE was used to determine the difference in a protein profile between day 0 and
7 in Longissimus and Triceps muscles from sarcoplasmic fraction as described by Anderson et al.
(2012) with some modifications. References used for each muscle was a specific pooled sample
obtained from samples of each animal in this experiment from day 0 and day 7 at equal amounts of
total protein. Preparation of the reference in this manner ensures that every protein in the
experiment is in the reference sample.
To label proteins of each individual sample, CyDyes 3 or 5 (GE Healthcare, Piscataway, NJ) were
used according manufacturer’s directions. The different dyes were alternated among day 0 and 7
samples. Reference samples were labeled using CyDye 2. Each gel was loaded using 15 μg of
labeled protein from the same animal and muscle at day 0 and 7, plus reference sample for a total of
37
45 μg of protein per gel. DeStreak Rehydration Solution (GE Healthcare, Piscataway, NJ)
containing 20 mM DTT was added to the labeled samples. An 11 cm immobilized pH gradient strip
(pH 4 to 7; GE Healthcare, Piscataway, NJ) placed on top of rehydration mix and the samples were
loaded on it passively during rehydration of the strip. The strip was left to rehydrate overnight at
room temperature in a sealed chamber. Isoelectric focusing was performed on an Ettan IPGphor
isoelectric focusing system (GE Healthcare) for a total of 14,500 V h.
After isoelectric focusing, strips were equilibrated using two sequential 15 min washes with
equilibration buffer (50 mMTris-HCl pH 8.8, 6 M urea, 30% glycerol, 2% SDS) containing 65 mM
DTT and 135 mM iodoacetamide. The equilibrated strips were loaded onto 12.5% SDS-PAGE gels,
using agarose as an overlay and run over-night at 80 V at 4 oC on Ettan DALT SIX system (GE
Healthcare) using 24 cm wide gels. Two 11 cm strips per gel were used. Gels were imaged using an
Ettan Imager (GE Healthcare) and images processed and analyzed using DeCyder 2D software (GE
Healthcare, version 6.5).
To identify the proteins in the spots that were differentially abundant (selected spots) between days
post mortem according to the DeCyder 2D software analyzer, unlabeled proteins were used. One
extract from each day of aging was selected and resolved in the first dimension using 13 cm
immobilized pH gradient strip (pH 4 to 7; GE Healthcare) and a 12,5 % SDS-PAGE in the second
dimension following the described previously protocol. Gels were stained with Colloidal Comassie
Blue Stain (1.7% ammonium sulfate, 30% methanol, 3% phosphoric acid, and 0.1% Coomassie G-
250) for 24 hours. Gels were destained in distilled and deionized water. All buffers and water used
in this process was filtered using Stericup Filter Unit, poresize 0.22 μm (Millipore Corp., Billireca,
MA) to minimize potential contamination.
Each selected spot identified in the gel was excised and sent to the Iowa State University Protein
Facility for identification. In-gel digestion (via trypsin) using Genomics Solution ProGest
(Chelmsford, MA) was done. Peptides were analyzed using Q Exactive Hybrid Quadrupole-
38
Orbitrap Mass Spectometer (LC-MS/MS) (Thermo Fisher Scientific, Waltham, MA). Spectra were
processed by MASCOT data-base search version 2.2.07 (MatrixScience, London, UK).
2.2 Experiment 2
2.2.1. Characterization of calpastatin peaks
For calpastatin purification, 45 minutes after exsanguination one sample of approximately 150
grams was taken of the Semitendinosus (ST) muscle from one commercial market steer at the Iowa
State University Meat laboratory. The animal was slaughtered following standard procedures and
not electrically stimulated. The sample was briefly placed on ice and immediately taken to the
laboratory for extraction of approximately 80 grams of muscle as described previously (Maddock et
al., 2005; Cruzen et al., 2014). A one mL sample (6.4 µg/µl) of the clarified dialysate was mixed
with 0.5 mL of SDS sample buffer (Wang, 1982), and 0.1 mL MCE. Fractionation on anion
exchange columns as described previously (Cruzen et al., 2014). Samples identified containing
calpastatin activity in peak 1 and peak 2 were not as concentrated as the dialysate, so the final
protein concentration in those samples varied, but the gel samples contained the same proportion of
sample buffer and MCE. Protein samples were stored at -80 oC until further analysis. The protocol
for SDS-PAGE and immunoblotting to characterize calpastatin peaks followed the protocol
described previously. The primary antibody anti calpastatin (MA3-944, Thermo Scientific,
Rockford, IL) was used in the dilution 1:5,000, and a goat anti-mouse horseradish peroxidase (No
2554, Sigma, St. Louis, MO) was used of a secondary antibody at 1:10,000 dilution.
2.2.2. Phosphoprotein and Total Protein Staining
Staining for phosphoproteins and total protein was conducted following resolution of protein on
12.5% SDS-PAGE gels. Loading was standardized based on protein content or calpastatin activity.
39
Gels were run at 20 V overnight, then stained using ProQ Diamond Phosphoprotein Stain
(Molecular Probes Inc., Eugene, OR), following the manufacturer’s protocol. Following imaging
for phosphoproteins gels were stained with SyPro Ruby Total Protein Stain (Molecular Probes Inc.,
Eugene, OR) following the manufacturer’s protocol. Gels were then imaged using a ChemiImager
5500 (Alpha Innotech, San Leandro, CA).
Immunoblotting of 2D gels was done to characterize calpastatin peaks from Semitendinosus muscle
using 80 µg of protein per strip and were, resolved using 7 cm immobilized pH gradient strip (pH 4
to 7; GE Healthcare) following protocol for rehydration as previously described. The isoelectric
focusing was performed on an Ettan IPGphor isoelectric focusing system (GE Healthcare) for a
total of 7,000 V h. Strips were loaded onto a 12.5 % SDS-PAGE gels, transferred to PVDF
membrane and imaged following the previously described protocol. The primary antibody anti
calpastatin (MA3-944, Thermo Scientific, Rockford, IL) was used in the dilution 1:5,000, and a
goat anti-mouse horseradish peroxidase (No 2554, Sigma, St. Louis, MO) was used of a secondary
antibody at 1:10,000 dilution.
2.3. Statistical analysis
Data from calpastatin peaks, calpain-1 and calpain-2 activity and abundance of bands from Western
blot were analysed using split plot design in a repeated measures arrangement. Animal as the whole
plot, muscle as the split plot and days post mortem were used as repeated measures. Statistical
analysis was performed using statistical software R (R Development Core Team, Vienna, AU). Gel
images from 2D-DIGE experiments were analyzed using Decider (version 6.5, GE Healthcare,
Piscataway, NJ). A P-value < 0.10 was considered statistically significant. Significant spots present
in more than 83% of the images were initially selected for identification.
3. Results and discussion
40
3.1. Experiment 1
3.1.1. Activity of CAST peak 1 and 2, calpain-1 and calpain-2.
In all extractions, the elution pattern of both peaks of calpastatin, calpain-1 and calpain-2 was
similar (Figure 1). The first peak of calpastatin was eluted in a range of 60 to 90 mM KCl followed
by second peak of calpastatin eluted in a range of 120 to 180 mM KCl, calpain-1 eluted in a range
of 185 to 260 mM KCl and calpain-2 eluted in a range of 330 to 400 mM KCl. This pattern of
elution that shows two peaks of calpastatin has been reported before (Pontremoli et al., 1992;
Salamino et al., 1994; Geesink, Nonneman and Koohmaraie, 1998; M Averna et al., 2001; Cruzen
et al., 2013). However, the exact characteristics of the calpain inhibitory species of those peaks are
not known.
Possible reasons for these two peaks include post translational modifications (potentially
phosphorylation) of calpastatin (Pontremoli et al., 1992; M Averna et al., 2001) that could change
the ionic charge of the molecule and modify its affinity for the column and thus its elution time.
Another possibility could be an alternative splicing of the gene (Geesink, Nonneman and
Koohmaraie, 1998; Gaarder, Thomassen and Veiseth-Kent, 2011b). Degradation of the calpastatin
molecule is another possibility for the separation of two peaks and could be an explaination for
some reports of lost activity during the purification process (Geesink, Nonneman and Koohmaraie,
1998).
Aging time post mortem resulted in an increase in CAST 1 from the Triceps brachii (TB) (P<0.05),
but had no significant influence on the CAST 1 from Longissimus lumborum (LL) (Table 1). On
the other hand, total CAST and CAST 2 activity decreased during post mortem aging in both
muscles. The drop in total CAST activity was mostly accounted for the CAST 2 decrease in activity
during aging. This could indicate that CAST 2 is the predominant form of CAST that is measured
during traditional assays.. This activity loss has been attributed to CAST degradation by calpain-1
and/or calpain-2 or other proteases (Doumit and Koohmaraie, 1999; De Tullio et al., 2000). The
41
hypothesis that post mortem CAST 2 degradation would result in CAST 1 was not corroborated by
activity level, unless it could be considered that CAST 1 inhibitory efficiency would be lower than
CAST 2 for calpain-2 (which was used as the positive control in the assays). It could also depend on
the phosphorylation status of the two fractions (Pontremoli et al., 1992; Salamino et al., 1994).
Calpain-1 activity was greater in LL than TB at day 0 and decreased more rapidly during post
mortem aging in LL (P<0.05). Calpain-2 activity had no change (P>0.05) during post mortem aging
or among muscles. This is consistent with previous observations (Koohmaraie et al., 1987). The
ratio of CAST 2 and CAST total to calpain-1 activity was greater in TB than in LL (Table 2). That
result may provide a partial explanation for the more rapid decline of calpain-1 activity in LL, since
greater CAST activity seems to spare calpain-1 from post mortem autolysis and activity loss
(Delgado et al., 2001), enabling the possibility of LL to exhibit more proteolysis and tenderness
than TB. Interaction between calpain and calpastatin is the most relevant mechanism involved in the
tenderization process during post mortem period mediated by cellular structural proteins (Melloni et
al., 2006). A similar difference between LL and TB in calpain-1 / calpastatin ratio was found by
(Cruzen et al., 2014).
3.1.2. SDS-PAGE and immunoblotting
In western blots for CAST bands between 115 kDa and 36 kDa were detected (Figure 2). Only the
bands presenting strong signal were analyzed. There was no detectable difference between muscles
for the 115 kDa band of CAST (Table 3), the size reported for intact calpastatin (Takano et al.,
1986; Nakamura et al., 1989; Cruzen et al., 2014). The 115 kDa band of CAST decreased in
intensity during post mortem aging in both muscles (P<0.05), with more than 70% of the change
occurring in the first day. At this same time, the abundance of 90 kDa band of CAST increased,
while there were no differences between day 0 and 7 for both muscles. At day 1, the 90 kDa band of
CAST was more abundant in the LL than in the TB. Although the 70 kDa band of CAST also
42
increased at day 1 for TB, differences in it were not detected for the LL between day 0 and 1.
Moreover, the abundance of the 90 kDa band of CAST was greater in TB than LL. Another
difference between muscles was observed for the 45 kDa band of CAST. The 45 kDa band of
CAST was more abundant in LL than TB over all days and did not change in abundance in the same
muscle over the aging period. Overall, the appearance of the two more intense bands of CAST
probably are result of degradation of the intact calpastatin, even though there was some differences
between muscles. A similar pattern of bands was found using the products of purified calpastatin
incubated with calpain-1 and calpain-2 (Doumit and Koohmaraie, 1999).
The autolysis of the 80 kDa band of calpain-1 in the sarcoplasmic fraction increased in both
muscles during post mortem aging. Autolysis decreases the requirement of free Ca2+ for calpain
activity from 3-50 µM to 0.5-2 µM Ca2+ (Goll et al., 2003) even though it also decreases its
stability at the higher ionic strengths found in post mortem muscle (Geesink and Koohmaraie,
1999b). Nonetheless, the autolysis is associated with activation of calpain and could provide
information about the proteolysis process in the muscle. The appearance of the 78 kDa autolyzed
calpain at day 1 was more pronounced in the LL compared to the TB, with a decrease at day 7 of
this band compared to day 1. In the TB, a decrease in the 78 kDa autolysis product of the catalytic
subunit was not detected between days 1 and 7 postmortem (Figure 3). The proportion of the
catalytic subunit present as the 76 kDa autolysis product increased at day 7 for both muscles with
greater amount in the LL. These changes in the sarcoplasmic fraction point to a slower rate of
autolysis in the TB, which might be associated to the greater calpastatin / calpain-1 ratio in that
muscle and perhaps a slower rate of protein degradation.
The calpain-1 is present in soluble in the sarcoplasmic fraction and during meat aging start to be
associated to myofibrils at the Z-line and A-band (Melody et al., 2004). The reason for appearance
of myofibril-bound calpain-1is not clear, and remains certain proteolytic activity during post
mortem aging period (Delgado et al., 2001). In the myofibrillar fraction, the decrease of the 80
kDa band of intact calpain-1 happened after 24 hours post mortem and in day 7 post mortem this
43
band was not abundant. The 78 kDa band of calpain-1 was increased in both TB and LL at day 1,
but it decreased at day 7 in LL; the 78 kDa band of autolyzed calpain-1 product was greater at day
7 compared to day 0 in TB. The abundance of 76 kDa band of autolyzed calpain-1 was increased at
day 7 in the myofibrillar fraction for both muscles. Therefore, autolysis of calpain-1 presents the
same pattern between sarcoplasmic and myofibrillar fractions. Similar autolysis progression in both
sarcoplasmic and myofibrillar fractions has been reported before (Melody et al., 2004; Rowe et al.,
2004).
Autolyzed bands of calpain-1across aging appear be more abundant in the myofibrillar fraction than
in sarcoplasmic fraction, suggesting that myofibril bound calpain-1 is less prone to continued
autolysis compared to the soluble enzyme present in sarcoplasmic fraction. Proteolysis in LL seems
to be more rapid than in the TB because at day 1 the 78 kDa band of calpain-1 is more abundant
than day 0 in the LL, which could mean more activity in LL early post mortem.
The 30 kDa band in myofibrillar fraction, a troponin T degradation product, is increased at day 7
compared to day 0 for LL, and was more abundant at day 7 in the TB than LL (P<0.05). In this
muscle there was no difference between days 1 and 7 (Figure 4). Those results suggest that
proteolysis occurred at a more rapid rate in the LL. The connection of postmortem tenderization of
LL to the appearance of 30 kDa band of troponin-T has been reported (Geesink and Koohmaraie,
1999a; S M Lonergan, Rowe, et al., 2001), and it probably could be related to proteolytic activity of
calpain-1. The current results together with the current literature suggests that variation in
calpastatin activity explains a portion of the differences in calpain activity and postmortem protein
degradation.
The degradation of intact band of desmin starts after 24 hours of aging in LL and this band is more
degraded in LL than TB at day 7 (Table 3). For the TB, no difference in the abundance of intact
desmin was detected (P<0.05) across days of aging. However, there was more abundance of bands
of degraded products of desmin (38 kDa and 35 kDa) at day 7 (Figure 5).
44
Similar degradation pattern of desmins and troponin-T degradation have been reported in aged beef
and purified myofibrils incubated with calpain-1 (Olson and Parrish, 1977; Huff-lonergan et al.,
1996). This degradation of desmin and troponin-T is highly related to beef tenderization (Huff-
Lonergan, Parrish and Robson, 1995; Geesink et al., 2006).
3.1.3. Two-Dimensional Difference in Gel Electrophoresis
A two-dimensional difference in gel electrophoresis gel (2D-DIGE) experiment showing spots that
were differentially abundant in Longissimus lumborum (LL) and Triceps brachii (TB) muscles in
sarcoplasmic fraction is summarized in figure 6. Coverage percentage of identified peptides from
intact protein and identification of proteins present in each picked spot is presented in table 4.
An interesting finding in this analysis is the greater amount of 70 kDa heat shock proteins (HSP) in
the sarcoplasmic fraction of aged beef. The HSP protein family is described as having an important
role in post mortem meat aging (Ouali et al., 2006; Carvalho et al., 2014). This protein family is
related to meat toughness and has been suggested to be a toughness marker due their cellular
protective function against apoptosis. During meat aging, the HSP 70 protein family acts in an anti
apoptotic function in the stress response, acting on the caspase-independent pathway and caspase
dependent pathway at both ways, upstream and downstream of caspase activation (Creagh,
Carmody and Cotter, 2000; Mayer and Bukau, 2005). A signal like cell damage for example,
induces the HSP 70 prevent the oligomerization of an apoptotic protease activating factor-1 (Apaf-
1), reventing maturation of caspase-9, this process could help the sarcomere maintenance and
organization (Beere, 2004; Ouali et al., 2006; Picard et al., 2010).
HSP 70 is normally located aggregated in cytoplasm in non stressed live tissue and after slaughter
attached to actin and α-actinin (Margulis and Welsh, 1991; Tupling et al., 2004). The presence of
more HSP 70 in day 7 sarcoplasmic fraction could be related to release of this protein from
myofibrillar fraction during post mortem aging probably due the proteolytic action. Under electrical
45
stimulation the relative abundance of HSP 70 bound to myofibrils is lower than non electrical
stimulated one and 24 hours after the slaughter, suggesting eletrical stimulation influences solubility
and fractionation of this protein (Bjarnadóttir et al., 2011).
Structural proteins decreased the relative abundance in day 7 compared to day 0 in both muscles in
sarcoplasmic fraction. This effect could occur by protease activity upon proteins like alpha4A chain
tubulin, desmin and alpha actin that are soluble in sarcoplasmic fraction and being degraded even in
the soluble fraction and the fragments are not detectable by the current used techinique.
Myosin light chain (MLC) could be released to sarcoplasmic fraction because of degradation of
proteins associated with MLC during post mortem aging (Anderson, Lonergan and Huff-Lonergan,
2012). In fact, Anderson et al. (2012) also demonstrated that incubation of myofibrils with calpain-
1 resulted in release of MLC from the myofibris. This could be related to the weakening of the
actomyosin and may be an important contributor to tenderization during aging time. The appearance
of MLC in the soluble fraction was related to the tenderization process and was negatively related to
tender meat 72 hours after slaughter but positively related at 14 days post mortem (Zapata, Zerby
and Wick, 2009).
The mitochondrial protein ATP synthase (subunit beta) was increased and Succinyl-CoA ligase
decreased in both muscles at day 7 compared to day 0. Adenylate kinase isoenzyme also decreased in
the LL at day 7 compared to day 0. The conversion of ADP to ATP is mediated to ATP synthase
present in the mitochondria and was found to be more abundant in aged pork meat (Bernevic et al.,
2011). Mitochondrial proteins found in the soluble fraction are related to the beginning of the
apoptotic process in early post mortem stages and those proteins may be related to the tenderization
process (Laville et al., 2009). Apoptosis has been suggested to be an early event related to the
tenderization process after slaughter, starting the cell protection machinery (Longo et al., 2015) and
ultimately affecting the tenderization process. Another interesting protein that was increased at day
7 in both muscles compared to day 0 is Prostaglandin reductase 2 (Table 4). This enzyme catalyzes
the NADPH dependent reduction of 15-keto-prostaglandin E2. Recently, 15-keto-prostaglandin E2
46
was proposed to trigger the translocation of the pro apoptotic protein Bax to mitochondria, thereby
inducing apoptosis (Yun-Chia Chang et al., 2012). This finding points to another protein in the
apoptotic pathway that changes during proteolysis post mortem.
3.2. Experiment 2
3.2.1. Phosphoprotein and Total Protein Staining
In the total protein stain assay, the Semitendinosus muscle (ST) showed the same pattern of bands
as the TB and proteins from pooled fractions that have active calpastatin from the ST ,CAST 1 and
CAST 2, are stained (Figure 7 A). CAST 1 had two bands a 115 kDa band and one upper band that
was approximately 125 kDa, while CAST 2 had only an approximately 125 kDa band. Both bands
are poorly phosphorylated (Figure 7 B). Although the CAST 1 pool had more total protein than
CAST 2 pool, they had a similar pattern of bands, with also the same phosphorylation pattern.
Obviously, CAST1 showed more phosphorylated bands which may be explained by greater amount
of total protein. Those differences are due to application of the same amount of eluted volume from
each pooled fractions from each calpastatin peak. This approach was taken because CAST 1 is
extremely unstable, and it was decided to minimize the manipulation of the samples, with methods
such as those for protein concentration.
Calpastatin immunoblots show CAST 2 had a band that migrated with an apparent molecular
weight greater than 115kDa and CAST 1 showed a 115kDa band (Figure 8). CAST 2 had a more
abundant 70 kDa band than CAST 1. This seems to be important considering the observation that
band was present in greater amount in TB at day 1 in experiment 1. This could corroborate that
calpastatin variants present in CAST 2 are more relevant to slowing down post mortem degradation.
In Semitendinous muscle from cattle, domain IV, 1xb exon and XL domain was found in a band
that was approximately 70 kDa and was attributed to a cleavage in the inhibitory domain II of the
47
calpastatin molecule. This cleavage generates two degradation products that migrate to similar
location in a polyacrylamide gel (Raynaud et al., 2005). Therefore the cleavage could form two
distinct products with different affinity for an anion exchange column thus generating the two
peaks.
The western blot results from Semitendinosus to detect CAST peaks fractions (Figure 8) were not
consistent with the explanation of the conversion of CAST 2 to CAST 1 occurring since some
fragments of the CAST 1 fraction may be even larger than what was found in CAST 2. Nonetheless,
a partial conversion should not be dismissed.
The two dimensional western blot of calpastatin peaks are presented in figure 9. The sample for the
first peak, CAST 1, showed more spots at different isoelectric points and molecular weight than
CAST 2 in a 2D immunoblot for calpastatin. Those blots make it difficult to consider that CAST 1
would be only a product of degradation of CAST 2, since there are high molecular weight spots at
acidic isoeletric regions in CAST 1 immunoblots. The reason for not identifying high molecular
weight spots in CAST 2 needs to be studied. Nonetheless, it could be more plausible to understand
those peaks as result of different transcripts variants associated with post-translation modifications,
which both may change the CAST proteolytic products that compose those peaks.
4. Conclusions
During the beef aging the decrease of total calpastatin activity is attributed to the decrease of
calpastatin peak 2 activity. Greater CAST2 to calpain-1 ratio at slaughter are related to lower
proteolytic rate and extension. The abundance proteins of heat shock 70 family in the sarcoplasmic
fraction of meat changes with post mortem aging process. There is consistent fractionation of two
forms of calpastatin in postmortem muscle and the changes in these forms could provide new clues
to shed light on the involvement of calpains in postmortem improvement of beef tenderness. The
48
exact composition of calpastatin peaks is still unclear and more investigation is necessary to
discover the composition and the function of each peak in the tenderization process.
5. References
1. Anderson, M. J., Lonergan, S. M. and Huff-Lonergan, E. (2012) ‘Myosin light chain 1
release from myofibrillar fraction during postmortem aging is a potential indicator of
proteolysis and tenderness of beef.’, Meat science. Elsevier Ltd, 90(2), pp. 345–51. doi:
10.1016/j.meatsci.2011.07.021.
2. Averna, M., de Tullio, R., Passalacqua, M., Salamino, F., Pontremoli, S. and Melloni, E.
(2001) ‘Changes in intracellular calpastatin localization are mediated by reversible
phosphorylation.’, The Biochemical journal, 354(Pt 1), pp. 25–30. doi: 10.1042/0264-
6021:3540025.
3. Averna, M., De Tullio, R., Salamino, F., Minafra, R., Pontremoli, S. and Melloni, E. (2001)
‘Age-dependent Degradation of Calpastatin in Kidney of Hypertensive Rats’, Journal of
Biological Chemistry, 276(42), pp. 38426–38432. doi: 10.1074/jbc.M101936200.
4. Beere, H. M. (2004) ‘“The stress of dying”: the role of heat shock proteins in the regulation
of apoptosis’, Journal Of Cell Science, 117(13), pp. 2641–2651. doi: 10.1242/jcs.01284
[doi]\r117/13/2641 [pii].
5. Bernevic, B., Petre, B. A., Galetskiy, D., Werner, C., Wicke, M., Schellander, K. and
Przybylski, M. (2011) ‘Degradation and oxidation postmortem of myofibrillar proteins in
porcine skeleton muscle revealed by high resolution mass spectrometric proteome analysis’,
International Journal of Mass Spectrometry. doi: 10.1016/j.ijms.2010.11.010.
6. Bjarnadóttir, S. G. G., Hollung, K., Høy, M. and Veiseth-Kent, E. (2011) ‘Proteome changes
in the insoluble protein fraction of bovine Longissimus dorsi muscle as a result of low-
voltage electrical stimulation.’, Meat science. Elsevier Ltd, 89(2), pp. 143–9. doi:
10.1016/j.meatsci.2011.04.002.
7. Camou, J. P., Mares, S. W., Marchello, J. A., Vazquez, R., Taylor, M., Thompson, V. F. and
Goll, D. E. (2007) ‘Isolation and characterization of ??-calpain, m-calpain, and calpastatin
from postmortem muscle. I. Initial steps’, Journal of Animal Science, 85(12), pp. 3400–3414.
doi: 10.2527/jas.2007-0356.
8. Carvalho, M. E., Gasparin, G., Poleti, M. D., Rosa, A. F., Balieiro, J. C. C., Labate, C. A.,
Nassu, R. T., Tullio, R. R., Regitano, L. C. de A., Mour??o, G. B. and Coutinho, L. L. (2014)
‘Heat shock and structural proteins associated with meat tenderness in Nellore beef cattle, a
Bos indicus breed’, Meat Science. doi: 10.1016/j.meatsci.2013.11.014.
9. Creagh, E. M., Carmody, R. J. and Cotter, T. G. (2000) ‘Heat shock protein 70 inhibits
caspase-dependent and -independent apoptosis in Jurkat T cells.’, Experimental cell
research, 257(1), pp. 58–66. doi: 10.1006/excr.2000.4856.
10. Cruzen, S. M., Harris, A. J., Hollinger, K., Punt, R. M., Grubbs, J. K., Selsby, J. T., Dekkers,
J. C. M., Gabler, N. K., Lonergan, S. M. and Huff-Lonergan, E. (2013) ‘Evidence of
decreased muscle protein turnover in gilts selected for low residual feed intake’, Journal of
Animal Science, 91(8), pp. 4007–4016. doi: 10.2527/jas.2013-6413.
11. Cruzen, S. M., Kim, Y. H. B., Lonergan, S. M., Grubbs, J. K., Fritchen, A. N. and Huff-
Lonergan, E. (2015) ‘Effect of early postmortem enhancement of calcium lactate/phosphate
on quality attributes of beef round muscles under different packaging systems’, Meat
49
Science, 101, pp. 63–72. doi: 10.1016/j.meatsci.2014.11.004.
12. Cruzen, S. M., Paulino, P. V. R., Lonergan, S. M. and Huff-Lonergan, E. (2014)
‘Postmortem proteolysis in three muscles from growing and mature beef cattle’, Meat
Science, 96(1), pp. 854–861. doi: 10.1016/j.meatsci.2013.09.021.
13. Delgado, E. F., Geesink, G. H., Marchello, J. A., Goll, D. E. and Koohmaraie, M. (2001)
‘Properties of myofibril-bound calpain activity in longissimus muscle of callipyge and
normal sheep’, Journal of Animal Science, 79(8), pp. 2097–2107. doi: /2001.7982097x.
14. Doumit, M. E. and Koohmaraie, M. (1999) ‘Immunoblot analysis of calpastatin degradation:
Evidence for cleavage by calpain in postmortem muscle’, Journal of Animal Science, 77(6),
pp. 1467–1473.
15. Gaarder, M., Thomassen, M. S. and Veiseth-Kent, E. (2011a) ‘Identification of
calpastatin, ??-calpain and m-calpain in Atlantic salmon (Salmo salar L.) muscle’, Food
Chemistry, 125(3), pp. 1091–1096. doi: 10.1016/j.foodchem.2010.09.095.
16. Gaarder, M., Thomassen, M. S. and Veiseth-Kent, E. (2011b) ‘Identification of
calpastatin, ??-calpain and m-calpain in Atlantic salmon (Salmo salar L.) muscle’, Food
Chemistry. doi: 10.1016/j.foodchem.2010.09.095.
17. Geesink, G. H. and Koohmaraie, M. (1999a) ‘Effect of calpastatin on degradation of
myofibrillar proteins by ??-calpain under postmortem conditions’, Journal of Animal
Science. doi: /1999.77102685x.
18. Geesink, G. H. and Koohmaraie, M. (1999b) ‘Postmortem proteolysis and
calpain/calpastatin activity in callipyge and normal lamb biceps femoris during extended
postmortem storage’, Journal of Animal Science.
19. Geesink, G. H., Kuchay, S., Chishti, A. H. and Koohmaraie, M. (2006) ‘??-calpain is
essential for postmortem proteolysis of muscle proteins’, Journal of Animal Science. doi:
10.2527/jas.2006-122.
20. Geesink, G. H., Nonneman, D. and Koohmaraie, M. (1998) ‘An improved purification
protocol for heart and skeletal muscle calpastatin reveals two isoforms resulting from
alternative splicing.’, Archives of biochemistry and biophysics, 356(1), pp. 19–24. doi:
10.1006/abbi.1998.0747.
21. Goll, D. E., Thompson, V. F., Li, H., Wei, W. and Cong, J. (2003) ‘The calpain system.’,
Physiological reviews, 83(3), pp. 731–801. doi: 10.1152/physrev.00029.2002.
22. Huff-lonergan, E., Mitsuhashi, T., Beekman, D. D., Parrish, F. C., Olson, D. G. and Robson,
R. M. (1996) ‘Proteolysis of specific muscle structural proteins by mu-calpain at low pH and
temperature is similar to degradation in postmortem bovine muscle . The online version of
this article , along with updated information and services , is located on the World W’,
Journal of Animal Science, pp. 993–1008.
23. Huff-Lonergan, E., Mitsuhashi, T., Parrish, F. C. and Robson, R. M. (1996) ‘Sodium
Dodecyl Sulfate-Polyacrylamide Gel Electrophoresis and Western Blotting Comparisons of
Purified Myofibrils and Whole Muscle Preparations for Evaluating Titin and Nebulin in
Postmortem Bovine Muscle’, Journal of Animal Science.
24. Huff-Lonergan, E., Parrish, F. C. and Robson, R. M. (1995) ‘Effects of postmortem aging
time, animal age, and sex on degradation of titin and nebulin in bovine longissimus muscle.’,
Journal of animal science, 73(4), pp. 1064–73. Available at:
http://www.ncbi.nlm.nih.gov/pubmed/7628949.
25. Koohmaraie, M. (1990) ‘Quantification of Ca2(+)-dependent protease activities by
hydrophobic and ion-exchange chromatography.’, Journal of animal science, 68(3), pp.
659–665. doi: 68:659-665.
26. Koohmaraie, M. (1994) ‘Muscle proteinases and meat aging’, Meat Science. doi:
10.1016/0309-1740(94)90036-1.
27. Koohmaraie, M., Seidemann, S. C., Schollmeyer, J. E., Dutson, T. R. and Crouse, J. D.
(1987) ‘Effect of post-mortem storage on Ca++-dependent proteases, their inhibitor and
myofibril fragmentation’, Meat Science, 19(3), pp. 187–196. doi: 10.1016/0309-
50
1740(87)90056-8.
28. Laville, E., Sayd, T., Morzel, M., Blinet, S., Chambon, C., Lepetit, J., Renand, G. and
Hocquette, J. F. (2009) ‘Proteome changes during meat aging in tough and tender beef
suggest the importance of apoptosis and protein solubility for beef aging and tenderization’,
Journal of Agricultural and Food Chemistry, 57(22), pp. 10755–10764. doi:
10.1021/jf901949r.
29. Lonergan, S. M., Huff-Lonergan, E., Rowe, L. J., Kuhlers, D. L. and Jungst, S. B. (2001)
‘Selection for lean growth efficiency in Duroc pigs influences pork quality’, Journal of
Animal Science, 79(8), pp. 2075–2085. doi: /2001.7982075x.
30. Lonergan, S. M., Huff-Lonergan, E., Wiegand, B. R. and Kriese-Anderson, L. A. (2001)
‘Postmortem Proteolysis and Tenderization of Top Loin Steaks From Brangus Cattle ’’,
Journal of Muscle Foods, 12(5), pp. 121–136. doi: 10.1111/j.1745-4573.2001.tb00304.x.
31. Lonergan, S. M., Rowe, L. J., Kuhlers, D. L. and Jungst, S. B. (2001) ‘Selection for lean
growth efficiency in Duroc pigs influences pork quality . The online version of this article ,
along with updated information and services , is located on the World Wide Web at :
Selection for lean growth efficiency in Duroc pigs influe’, pp. 2075–2085.
32. Longo, V., Lana, A., Bottero, M. T. and Zolla, L. (2015) ‘Apoptosis in muscle-to-meat aging
process: The omic witness.’, Journal of proteomics. doi: 10.1016/j.jprot.2015.04.023.
33. LOWRY, O. H., ROSEBROUGH, N. J., FARR, A. L. and RANDALL, R. J. (1951) ‘Protein
measurement with the Folin phenol reagent.’, The Journal of biological chemistry, 193(1),
pp. 265–275.
34. Maddock, K. R., Huff-Lonergan, E., Rowe, L. J. and Lonergan, S. M. (2005) ‘Effect of pH
and ionic strength on mu- and m-calpain inhibition by calpastatin.’, Journal of animal
science, 83(6), pp. 1370–1376.
35. Margulis, B. A. and Welsh, M. (1991) ‘Isolation of hsp70-binding proteins from bovine
muscle’, Biochemical and Biophysical Research Communications, 178(1), pp. 1–7. doi:
10.1016/0006-291X(91)91771-4.
36. Mayer, M. P. and Bukau, B. (2005) ‘Hsp70 chaperones: Cellular functions and molecular
mechanism’, Cell. Mol. Life Sci., 62(6), pp. 670–684. doi: 10.1007/s00018-004-4464-6.
37. Melloni, E., Averna, M., Stifanese, R., De Tullio, R., Defranchi, E., Salamino, F. and
Pontremoli, S. (2006) ‘Association of calpastatin with inactive calpain: A novel mechanism
to control the activation of the protease?’, Journal of Biological Chemistry, 281(34), pp.
24945–24954. doi: 10.1074/jbc.M601449200.
38. Melody, J. L., Lonergan, S. M., Rowe, L. J., Huiatt, T. W., Mayes, M. S. and Huff-Lonergan,
E. (2004) ‘Early postmortem biochemical factors influence tenderness and water-holding
capacity of three porcine muscles’, Journal of Animal Science, 82(4), pp. 1195–1205.
39. Mohan, P. S. and Nixon, R. a (1995) ‘Purification and properties of high molecular weight
calpastatin from bovine brain.’, Journal of neurochemistry, 64(2), pp. 859–66. Available at:
http://www.ncbi.nlm.nih.gov/pubmed/7830080.
40. Nakamura, M., Inomata, M., Imajoh, S., Suzuki, K. and Kawashima, S. (1989)
‘Fragmentation of an endogenous inhibitor upon complex formation with high- and low-
Ca2+-requiring forms of calcium-activated neutral proteases.’, Biochemistry, 28(2), pp.
449–55. Available at:
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citatio
n&list_uids=2540798%5Cnhttp://www.ncbi.nlm.nih.gov/pubmed/2540798.
41. Olson, D. G. and Parrish, F. C. (1977) ‘Relationship of Myofibril Fragmentation Index to
Measures of Beefsteak Tenderness’, Journal of Food Science, 42(2), pp. 506–509. doi:
10.1111/j.1365-2621.1977.tb01533.x.
42. Ono, Y. and Sorimachi, H. (2012) ‘Calpains - An elaborate proteolytic system’, Biochimica
et Biophysica Acta - Proteins and Proteomics. doi: 10.1016/j.bbapap.2011.08.005.
43. Ouali, A., Herrera-Mendez, C. H., Coulis, G., Becila, S., Boudjellal, A., Aubry, L. and
Sentandreu, M. A. (2006) ‘Revisiting the conversion of muscle into meat and the underlying
51
mechanisms’, Meat Science. doi: 10.1016/j.meatsci.2006.05.010.
44. Parr, T., Jewell, K. K., Sensky, P. L., Brameld, J. M., Bardsley, R. G. and Buttery, P. J.
(2004) ‘Expression of calpastatin isoforms in muscle and functionality of multiple
calpastatin promoters’, Archives of Biochemistry and Biophysics, 427(1), pp. 8–15. doi:
10.1016/j.abb.2004.04.001.
45. Picard, B., Berri, C., Lefaucheur, L., Molette, C., Sayd, T. and Terlouw, C. (2010) ‘Skeletal
muscle proteomics in livestock production.’, Briefings in functional genomics, 9(3), pp. 259–
78. doi: 10.1093/bfgp/elq005.
46. Pontremoli, S., Viotti, P. L., Michetti, M., Salamino, F., Sparatore, B. and Melloni, E. (1992)
‘Modulation of inhibitory efficiency of rat skeletal muscle calpastatin by phosphorylation’,
Biochemical and Biophysical Research Communications. doi: 10.1016/0006-
291X(92)91259-S.
47. Raynaud, P., Jayat-Vignoles, C., Laforêt, M. P., Levéziel, H. and Amarger, V. (2005) ‘Four
promoters direct expression of the calpastatin gene’, Archives of Biochemistry and
Biophysics. doi: 10.1016/j.abb.2005.02.026.
48. Rowe, L. J., Maddock, K. R., Lonergan, S. M. and Huff-Lonergan, E. (2004) ‘Influence of
early postmortem protein oxidation on beef quality’, Journal of Animal Science, 82(3), pp.
785–793. doi: /2004.823785x.
49. Salamino, F., De Tullio, R., Michetti, M., Mengotti, P., Melloni, E. and Pontremoli, S.
(1994) ‘Modulation of calpastatin specificity in rat tissues by reversible phosphorylation and
dephosphorylation.’, Biochemical and biophysical research communications, 199, pp.
1326–1332. doi: 10.1006/bbrc.1994.1376.
50. Samanta, K., Kar, P., Chakraborti, T., Shaikh, S. and Chakraborti, S. (2010) ‘Characteristic
properties of endoplasmic reticulum membrane m-calpain, calpastatin and lumen m-calpain:
A comparative study between membrane and lumen m-calpains’, Journal of Biochemistry,
147(5), pp. 765–779. doi: 10.1093/jb/mvq009.
51. Takano, E., Maki, M., Hatanaka, M., Mori, H., Zenita, K., Sakihama, T., Kannagi, R., Marti,
T., Titani, K. and Murachi, T. (1986) ‘Evidence for the repetitive domain structure of pig
calpastatin as demonstrated by cloning of complementary DNA’, FEBS Letters, 208(2), pp.
199–202. doi: 10.1016/0014-5793(86)81017-1.
52. De Tullio, R., Averna, M., Salamino, F., Pontremoli, S. and Melloni, E. (2000) ‘Differential
degradation of calpastatin by ??- and m-calpain in Ca2+-enriched human neuroblastoma
LAN-5 cells’, FEBS Letters, 475(1), pp. 17–21. doi: 10.1016/S0014-5793(00)01613-6.
53. Tupling, A. R., Gramolini, A. O., Duhamel, T. A., Kondo, H., Asahi, M., Tsuchiya, S. C.,
Borrelli, M. J., Lepock, J. R., Otsu, K., Hori, M., MacLennan, D. H. and Green, H. J. (2004)
‘HSP70 binds to the fast-twitch skeletal muscle sarco(endo)plasmic reticulum Ca2+-ATPase
(SERCA1a) and prevents thermal inactivation’, Journal of Biological Chemistry, 279(50),
pp. 52382–52389. doi: 10.1074/jbc.M409336200.
54. Wang, K. (1982) ‘[23] Purification of titin and nebulin’, Methods in Enzymology, 85, pp.
264–274. doi: 10.1016/0076-6879(82)85025-8.
55. Yun-Chia Chang, E., Tsai, S. H., Shun, C. T., Hee, S. W., Chang, Y. C., Tsai, Y. C., Tsai, J.
S., Chen, H. J., Chou, J. W., Lin, S. Y. and Chuang, L. M. (2012) ‘Prostaglandin reductase
2 modulates ros-mediated cell death and tumor transformation of gastric cancer cells and is
associated with higher mortality in gastric cancer patients’, American Journal of Pathology.
doi: 10.1016/j.ajpath.2012.07.006.
56. Zapata, I., Zerby, H. N. and Wick, M. (2009) ‘Functional proteomic analysis predicts beef
tenderness and the tenderness differential’, Journal of Agricultural and Food Chemistry. doi:
10.1021/jf900041j.
52
FIGURES
Figure 1 - Example of elution of calpastatin peaks and calpain-1 and of calpain-2 during elution
using a Q-sepharose Fast Flow ion exchange column. The solid line represents inhibition of porcine
lung calpain-2 for calpastatin peak 1 (CAST 1), calpastatin peak 2 (CAST 2) and the caseinolitic
activity for calpain-1 and calpain-2. The dashed line represents the predicted concentration of KCl
(mM) at time of elution.
53
Figure 2 Representative blot and immunodetection of calpastatin in sarcoplasmic fraction using
antibody anti Calpastatin (MA3-944).
*Estimated molecular weight of bands.
#Molecular weight marker.
Figure 3 Representative blot and immunodetection of calpain-1 in sarcoplasmic fraction using
antibody anti Calpain-1.
*Estimated molecular weight of bands.
54
Figure 4 Representative blot and immunodetection of troponin-T in myofibrillar fraction using
antibody anti troponin.
*Estimated molecular weight of bands.
55
Figure 5 Representative blot and immunodetection of desmin in myofibrillar fraction using
antibody anti desmin.
*Estimated molecular weight of bands.
56
Figure 6 A representative two-dimensional difference in gel electrophoresis showing different
expressed spots in Longissimus lumborum (LL) muscle.Circles represent total area of detected
spot and the different expressed spots are identified by numbers.
57
Figure 7 A) SyPro Ruby total protein stain and B) ProQ Diamond phosphoprotein stain to identify
phosphorylated proteins from: TB0- 40 µg of protein from sarcoplasmic fraction of Triceps brachii
day 0; TB1- 40 µg of protein from sarcoplasmic fraction of Triceps brachii day 1; ST0- 40 µg of
protein from sarcoplasmic fraction of Semitendinosus day 0; Pk1 - 30µL of calpastatin peak 1
extracted from Semitendinosus day 0; Pk2 - 30µL of calpastatin peak 2 extracted from
Semitendinosus day 0.
58
Figure 8 Western blot and immunodetection using antibody anti Calpastatin (MA3-944). TB0- 40
µg of protein from sarcoplasmic fraction of Triceps brachii day 0; TB1- 40 µg of protein from
sarcoplasmic fraction of Triceps brachii day 1; ST0- 40 µg of protein from sarcoplasmic fraction of
Semitendinosus day 0; Pk1 - 30µL of calpastatin peak 1 extracted from Semitendinosus day 0; Pk2
- 30µL of calpastatin peak 2 extracted from Semitendinosus day 0.
59
Figure 9 Two dimensional western blot and immunodetection using antibody anti Calpastatin
(MA3-944).of pooled fractions from the two peaks with calpastatin activity from Semitendinosus
day 0. A) Calpastatin peak 1. B) Calpastatin peak 2.
* Isoelectrical point # Molecular weigth
60
TABLES
Table 1 Activityᶲ of calpastatin peak 1 (CAST 1), calpastatin peak 2 (CAST 2), Total calpastatin
(CAST total), calpain-1 and calpain-2 extracted from muscles Longissimus lumborum (LL) and
Triceps brachii (TB) during aging days of beef meat.
Itemᶲ
Day 0 Day 1 Day 7
SEM
P-values
LL TB LL TB LL TB Muscle
(M) Day (D) M x D
CAST 1 0.93A* 0.82Y 0.96A 1.09XY 1.03A 1.30X 0.10 0.25 0.038 0.007
CAST 2 2.43A 2.98X 1.17B 1.31Y 0.07C 0.31Z 0.18 0.063 <0.001 <0.001
CAST total 3.22A 3.80X 2.12B 2.40Y 1.10C 1.61Y 0.23 0.065 <0.001 <0.001
calpain-1 1.06Aa 0.91Xb 0.13B 0.16Y 0.02B 0.03Z 0.04 0.312 <0.001 <0.001
calpain-2 1.27 1.30 1.13 1.11 1.21 1.16 0.07 0.821 0.092 0.195
* Means with different capital letters (within the muscle, (A and B to compare LL; X,Y and Z to
compare TB) and small letters (within the day) in the same row are significantly different.
ᶲActivity is reported as units per gram of tissue (Lonergan, Huff-Lonergan, Wiegand, & Kriese-
Anderson, 2001b)
Table 2 Calpastatin peak 1 (CAST 1), calpastatin peak 2 (CAST 2), total calpastatin (CAST total)
to calpain-1 activity ratios from muscles Longissimus lumborum (LL) and Triceps brachii (TB) at
day 0 postmortem.
Ratio LL TB SEM P-value
CAST1 : calpain-1 0.76a* 0.90a 0.103 0.363
CAST2 : calpain-1 2.35b 3.32a 0.295 0.042
CAST total : calpain-1 3.12b 4.23a 0.344 0.045 *Means with different superscripts within the same row indicate a significant difference (P<0.05).
61
Table 3 Abundance of immunoreactive bands from western blot of calpastatin (CAST), myofibrilar
and sarcoplasmic calpain-1, desmin and troponin-T during aging days of muscles Longissimus
lumborum (LL) and Triceps brachii (TB).
Item
Band
( MW1
kDa)
Day 0 Day 1 Day 7 SEM P-value
LL TB LL TB LL TB Muscle
(M) Day (D) M x D
CAST
115 0.75A* 0.78X 0.19B 0.26Y 0.02C 0.02Z 0.05 0.340 <0.001 0.711 90 1.00B 1.04Y 2.11Aa 1.67Xb 0.74B 0.64Y 0.13 0.039 <0.001 0.123 70 1.11AB 0.97Y 1.96Ab 3.19Xa 0.74B 1.20Y 0.34 0.030 <0.001 0.008 58 0.91 0.83 1.21 1.00 0.96 0.78 0.12 0.241 0.207 0.809
45 0.97a 0.72b 1.01a 0.76b 1.08a 0.80b 0.07 0.023 0.545 0.944 36 0.93 0.93 1.07 0.76 1.30 0.97 0.15 0.140 0.194 0.328
calpain-1
sarcoplasmic
80 0.95A* 0.90X 0.56B 0.59Y 0.02C 0.03Z 0.05 0.972 <0.001 0.515 78 0.05B 0.04Y 0.19Aa 0.12Xb 0.06B 0.09XY 0.02 0.403 <0.001 0.043 76 0.01B 0.01Y 0.06B 0.04Y 0.32Aa 0.24Xb 0.11 0.096 <0.001 <0.001
calpain-1
myofibrilar
80 1.08A 1.05X 0.86A 1.09X 0.09B 0.24Y 0.14 0.392 <0.001 0.277 78 0.21B 0.20Y 1.00A 0.82X 0.42B 0.75X 0.11 0.617 <0.001 <0.001 76 0.09B 0.08Y 0.50B 0.33Y 2.17A 1.82X 0.14 0.085 <0.001 <0.001
Desmin
Intact 1.61A 1.53X 1.44A 1.46X 0.65Bb 1.15Xa 0.13 0.345 <0.001 <0.001
38 0.10C 0.13Y 0.45B 0.28Y 0.83Ab 1.25Xa 0.09 0.093 0.006 <0.001
35 0.10B 0.12Y 0.34B 0.18Y 1.38A 1.11X 0.16 0.304 <0.001 <0.001
Troponin-T
Upper
intact 0.94 0.72 0.95 0.76 0.76 0.73 0.09 0.115 0.280 0.155
Lower
intact 0.86 0.82 1.04 0.86 1.15 0.96 0.12 0.271 0.191 0.485
30 0.13B 0.10Y 0.28B 0.16XY 1.49Aa 0.61Xb 0.14 0.062 <0.001 <0.001
* Means with different capital letters (within the muscle, (A and B was used to compare between
LL; X,Y and Z was used to compare betwwen TB) and small letters (within the day) in the same
row are significantly different.
Values represent the relative density of each band related to the same band in the reference sample.
Reference samples are a mix of same amount of protein from all samples of TB and LL of day 0
and another of day 7. To CAST each band of sample reference from day 0 was considered the
abundance 1 and each band of each sample was compared to the correspondent band. To desmin,
troponin-T, sarcoplasmic and myofibrillar calpain-1, intact bands of reference sample of each
protein form day 0 was considered the abundance 1 and the intact bands of each sample was
compared to. For degraded bands of reference sample of each protein form day 7 was considered
the abundance 1 and the degraded bands of each sample was compared to.
62
Table 4 Proteins identified in the spots of 2D-DIGE analysis of Longissimus lumborum (LL) and Triceps brachii (TB).
Muscle Spot
ID1 Identification
Accession
number Species
(%) Σ
Coverage2
MW3
[kDa]
calc.
pI4
Av.
Ratio5 P-value
LL
1 Tubulin alpha-4A chain P81948 Bos taurus 22.99 49.9 5.06 -7 <0.001
2 ATP synthase subunit beta, mitochondrial P00829 Bos taurus 69.70 56.2 5.27 2.24 <0.001
3 Heat shock cognate 71 kDa protein A2Q0Z1 Equus caballus 38.39 70.9 5.52 3.95 <0.001
4 Succinyl-CoA ligase [ADP-forming] subunit beta,
mitochondrial Q148D5 Bos taurus 33.69 50.1 7.18 -1.28 0.019
5 Prostaglandin reductase 2 Q32L99 Bos taurus 7.69 38.4 5.53 1.77 0.002
6 Desmin O62654 Bos taurus 42.34 53.5 5.27 -3.1 <0.001
7 Heat shock cognate 71 kDa protein A2Q0Z1 Equus caballus 44.58 70.9 5.52 1.33 <0.001
8 Heat shock cognate 71 kDa protein A2Q0Z1 Equus caballus 55.88 70.9 5.52 1.24 0.004
9 Heat shock 70 kDa protein 1B Q27965 Bos taurus 34.63 70.2 5.92 1.45 0.002
10 Heat shock 70 kDa protein 1B Q27965 Bos taurus 41.81 70.2 5.92 1.27 0.019
11 Heat shock 70 kDa protein 1 Q28222 C. aethiops 7.84 69.9 6.11 1.29 0.015
12 Actin, alpha skeletal muscle P68138 Bos taurus 27.32 42.0 5.39 -1.89 <0.001
13 Adenylate kinase isoenzyme P00570 Bos taurus 58.76 21.7 8.32 -1.7 0.003
14 Myosin regulatory light chain 2, skeletal muscle isoform Q0P571 Bos taurus 56.47 19.0 5.01 -1.51 0.024
TB
1 Tubulin alpha-4A chain P81948 Bos taurus 39.96 49.9 5.06 -7.47 <0.001
2 ATP synthase subunit beta, mitochondrial P00829 Bos taurus 71.21 56.2 5.27 2.87 <0.001
3 Heat shock cognate 71 kDa protein A2Q0Z1 Equus caballus 47.52 70.9 5.52 2.14 0.004
4 Succinyl-CoA ligase [ADP-forming] subunit beta,
mitochondrial Q148D5 Bos taurus 47.95 50.1 7.18 -2.57 0.036
5 Prostaglandin reductase 2 Q32L99 Bos taurus 12.25 38.4 5.53 1.35 0.067
6 Desmin O62654 Bos taurus 47.87 53.5 5.27 -3.38 <0.001 1 Identification of spots different expressed among day 0 and 7 of LL and TB represented in figure 6.
2 Percentage of peptides identified of intact protein. 3 Calculated Molecular weight
4 Isoelectrical point
5 Ratio of relative abundance of day 7 to day 0. Positive values represent more relative abundance in day 7 and negative values represent more relative abundance in day 0
63
(Trabalho redigido e normatizado de acordo com as normas da revista Journal of Animal Science)
CAPITULO 3 – Purification and characterization of active peaks of calpastatin from swine
Longíssimus dorsi muscle.
Authors: Leonardo G. Oliveira #, Edward Steadham*, Steven M. Lonergan*, Elisabeth Huff-
Lonergan*
# EVZ, Universidade Federal de Goiás, Goiânia, GO, Brazil.
* Muscle Biology Group, Department of Animal Science, Iowa State University, Ames, IA 50011,
United States
Acknowledgements: Appreciation is extended to the Iowa Muscle Biology group for funding this
research and to CAPES-Brazil to provide the scholarship for the first author.
Abstract: Calapastatin is a specific inhibitor of the calcium dependent proteinases m- and µ-
calpain and is related to various metabolic process in the live animal and during post mortem
tenderization of meat. Composed of four repetitive regions with inhibitory activity (domains1– 4), and
an unique domain L located at N-terminal region. Using an anion exchange chromatography to
separate calpastatin and sequencial chromatography steps to purify each peak was found in each peak.
During the process to purify the calpastatin peak 1 the activity per mg of protein is greatly increased
but lose half activity, for calpastatin peak 2 the purification process, specific activity was increased
139.8 fold and at the end of this process remains 36% of the initial total activity. Bands of
approximately 70 kDa are identified of both peaks and the band from peak 2 was a little higher than
peak 1. The calpastatin was identified in the second dimension gel in a similar molecular weight to
SDS-PAGE gel and western blot and one spots from calpastatin peak 1 and two from calpastatin peak
2 were identified as calpastatin. Sequence of peptides identified in Spot from purified peak 1 as part
of the inhibitory domain III and IV and C terminus and from purified peak 2 a sequence of peptides
identified as part of the inhibitory domain I, II and III. This results lead us to believe that both peaks,
in this case, are products of degradation of the intact molecule and probably the small peptides are
loosed during the process. The results of present study shows that is possible the purification of distinct
forms of active calpastatin, however the intact form of calpastatin was not present in this purification.
Presence of peptides was not conclusive to determine the origin and composition of each active peak.
Keywords: Calpain system, Ion exchange chromatography, Proteomics
64
INTRODUCTION
Specific inhibitor of the ubiquitous calcium dependent proteinases m- and µ-calpain, calpastatin,
is related to various metabolic process in the live animal and during post mortem tenderization of meat
(Geesink et al. 1995; Goll et al., 1998; Geesink 1999, Huff-Lonergan et al., 1995; Huff-Lonergan et
al., 1996). Composed of four repetitive regions (inhibitory domains1– 4), each of this have a possibility
to inhibit calpain activity, and an unique N-terminal region: domain L(Takano et al., 1986; Maki et al.,
1988).
With a widely varying molecular weights have been purified from a number of tissues and
different molecular weights are related. Confusion regarding the molecular weight of calpastatin was
due to factors like a proteolytic degradation, and some of this fragments of calpastatin retain inhibitory
activity (Melgren et al. 1983; Imajoh et al., 1984; Nakamura et al., 1985), because of its unusual amino
acid composition, the molecular weight is overestimated using SDS–PAGE (Maki et al., 1988) and
due to the asymmetry estimation using gel filtration leading to an overestimation of its molecular
weight (2).
Calpastatins from different species, using cDNAs analysis, has shown that the most prominent
form found in all tissues has a predicted molecular weight of 72–77 kDa but anomalously migrates on
SDS–PAGE with an apparent molecular weight of 115–130 kDa (Killifer & Koohmaraie, 1994).
However, chromatography of the muscle extracts to separate calpains and calpastatin led to extensive
fragmentation of calpastatin (Arnold et al. 1995; Geesink et al., 1998) and this fragmentation could
difficult to determine the composition of extracted calpastatin from chromatograph column and purify
the intact molecule. During the extraction of calpastatin using anion exchange column, calpastatin
could be eluted in two distinct peaks (Pontremoli et al., 1992; Cruzem et al., 2013) and the significance
still unclear.
The objective of this work is purify each calpastatin peak to characterize it composition using
two dimensional gel electrophoresis and mass spectrometry.
65
MATHERIALS AND METHODS
A commercial animal was slaughtered following standard humane procedures at the Iowa State
University Meat Laboratory and a sample (approximately 1.5 kg center cut) of the Longissimus dorsi
(LD) from each animal (animal was weighted approximately 100kg at the time of slaughter) was
collected within 10 min post-exsanguination, briefly placed on ice and immediately taken to the
laboratory for extraction procedures, chromatographic separation of calpastatin peaks. All process was
executed at 4 oC in a cold room.
Calpastatin extraction
Was used a methodology proposed by Thompson et al. (2000) to extract calpastatin from muscle
and purify. Using a knife to remove visible fat and connective tissue, 900 grams of muscle Longissimus
dorsi was finely minced and 100 g of muscle per time was immediately homogenized using with a
Polytron PT 3100 (Lucerne, Switzerland) in 6 volumes (w/v) of cold extraction buffer (100 mM Tris–
HCl, 10 mM EDTA, pH 8.3, 4 °C). Before use were added to the buffer 0.1% 2-mercaptoethanol (2-
MCE), 2 μM of E-64, and 100 mg/L trypsin inhibitor. The homogenate was centrifuged at 40,000 ×g
for 30 min at 4 °C, and the supernatant was filtered through cheesecloth and dialyzed in 40 volumes
of TEM (40 mM Tris–HCl, 1 mM EDTA, pH 7.4, 0.1% MCE).
Was added 277 g/L os Ammonium sulfate slowly and stirring during 12 hours. After stirring, the
homogenate was divided in centrifuge tubes, centrifuged at 4 oC at 10000 RPM during 30 minutes.
Was discarded the supernatant after centrifugation and the pellet was ressuspended in 4 volumes of
TEM buffer (40 mM TRIS, 1 mM EDTA, 0,1% 2 mercaptoetanol, pH 7.4). This solution was dialyzed
12 hours with TE (40mM TRIS, 1mM EDTA, pH 7.4) using 20 times the amount of final volume of
ressuspended solution, and repeated 4 times until complete 100 times the volume of ressuspended
solution.
66
After dialysis, were centrifuged at 40,000 ×g for 30 min at 4 °C and the supernatant filtered
through cheesecloth. The filtered was loaded onto a 800 mL Q-Sepharose (GE Healthcare Biosciences,
Pittsburgh, PA) anion exchange column. The column was previously equilibrated with TEM and after
loaded the sample was washed with 1200 mL TEM. Calpastatin was eluted using a flow rate of 2.0
mL/min, fraction volume of 2.5 mL with a linear gradient of 50 to 225 mM KCl in TEM using an
ÄKTA™ prime automated liquid chromatography system (Amersham Pharmacia Biotech Inc.,
Piscataway, NJ).
Calpastatin Activity
To determine calpastatin activity of the fractions were used the caseinolytic method
(Koohmaraie,1990) with some modifications. Was used 50 µL of each fraction, brought to 1 mL with
TE (40 mM Tris–HCl, 1 mM EDTA, pH 7.4) in a glass tube. One milliliter of casein buffer (100 mM
Tris–acetate 7 mg/mL casein, and 1 mM sodium azide, pH 7.5, with 0.2% MCE added just before use)
was added, followed by 100 μl of calcium buffer (200 mM CaCl2). For activity determination, was
added in each sample approximately 0.40 units of m-calpain previously purified from porcine lung.
For positive control, was used 1 mL of TE (without sample), casein buffer and added approximately
0.40 units of m-calpain from porcine lung, made in triplicate. For blank tubes was used 1 mL of TE
(without sample), casein buffer, and made in triplicate. Tubes were briefly vortexed and incubated in
a water bath at 25 °C for 1 h.
To stop the reaction were added 2 mL of 5% trichloroacetic acid in each tube and after vortexed.
Samples were centrifuged at 1500 × g for 20 min at 25 °C and determined the absorbance of the
supernatant at 278 nm. The reading was compared to blank and positive control samples (Koohmaraie
et al., 1995). The first peak of calpastatin activity was eluted between 60 to 90 mM KCl. The second
peak of calpastatin was eluted between 120 to 220 mM KCl. An example of elution peaks is in Figure
1.
67
Fractions that had calpastatin activity for peak 1 was pooled and the same was proceed for peak
2 to follow the purification and determine the total activity of pooled fractions. To determine the total
activity of each pool was used crescent amounts of sample starting with 20 µL until 400µL. To
calculate the total activity of pooled calpastatin I and II, was used the value of 50% inhibition of lung
m-calpain. To discount the amount of protein contained in the pooled fraction of calpastatin fractions,
was used in each tube 1 mL of pooled sample, 100 μl of EDTA buffer (200mM EDTA), one milliliter
of casein buffer and approximately 0.40 units of m-calpain previously purified from porcine lung and
incubated, briefly vortexed and incubated in a water bath at 25 °C for 1 h. One unit of calpastatin
activity was defined as the amount required to inhibit 1 unit of porcine lung m-calpain (Koohmaraie,
1990). Protein concentration of polled Calpastatin peaks was determined using Biuret methodology
(Lowry et al., 1951).
Calpastatin peaks purification
To purify the pooled calpastatin peak 1, was dialyzed against 40 volumes of TE at 4 oC during
12 hours. After dialysis was added of ammonium sulfate (Sigma, St Louis, MO) until reach
concentration 1 mol/L. The solution containing calpastatin peak 1 was loaded onto a Phenyl Sepharose
(GE Healthcare Biosciences, Pittsburgh, PA) anion exchange column. The column was previously
equilibrated with 3 times the volume of column of TEM with 1 Mol of ammonium sulfate (Sigma, St
Louis, MO) and after loaded the sample was washed with the same solution. Calpastatin was eluted
using with a flow rate of 1.5 mL/min, fraction volume of 8.0 mL in a linear gradient of 1.0 to 0 M of
ammonium sulfate in TEM using an ÄKTA™ prime automated liquid chromatography system
(Amersham Pharmacia Biotech Inc., Piscataway, NJ).
Was determined calpastatin activity of fractions from peak 1 eluted of Phenyl Sepharose column
(GE Healthcare Biosciences, Pittsburgh, PA) as described protocol, pooled fractions that had activity
and protein concentration was determinate . The same process was made with peak 2 and protein
concentration of pooled fraction was determined. Calpastatin peak 1 was eluted between 710 to 560
68
mM of ammonium sulfate. Was proceeded the same process to purify the peak 2 and was eluted
between 620 do 460 mM of ammonium sulfate.
Pooled fractions were dialyzed against 40 times the volume of pooled fractions on TEM during
12 hours at 4 oC. Peak 1 was stored at this point and peak 2 follow the purification. Calpastatin peak 2
was loaded onto a Blue Sepharose (GE Healthcare Biosciences, Pittsburgh, PA) column. The column
was previously equilibrated with 3 times the volume of column of TEM and after loaded the sample
was washed with tree times the column volume with the same solution and eluted using a flow rate of
1.5 mL/min, fraction volume of 10.0 mL in a linear gradient 0 to 500 mM of potassium chloride in
TEM using an ÄKTA™ prime automated liquid chromatography system (Amersham Pharmacia
Biotech Inc., Piscataway, NJ). Calpastatin activity was determined in each eluted fraction as described
previously and active fractions were pooled and dialyzed against 40 times the volume of pooled
fractions on TEM during 12 hours at 4 oC. Calpastatin was eluted between 60 to 300 mM of potassium
cloride.
Dialyzed pooled fractions from Calpastatin peak 2 was loaded onto a DEAE CAPTO (GE
Healthcare Biosciences, Pittsburgh, PA) ion exchange column. The column was previously
equilibrated with 3 times the volume of column of TEM and after loaded the sample was washed with
tree times the column volume with the same solution and eluted using a flow rate of 1.5 mL/min,
fraction volume of 10.0 mL in a linear gradient 0 to 250 mM of potassium chloride in TEM using an
ÄKTA™ prime automated liquid chromatography system (Amersham Pharmacia Biotech Inc.,
Piscataway, NJ). Calpastatin activity was determined in each eluted fraction as described previously
and active fractions were pooled and dialyzed against 40 times the volume of pooled fractions on TEM
during 12 hours at 4 oC. Calpastatin was eluted between 100 to 1500 mM of potassium cloride. Protein
concentration were determined after all dialyze steps to determine the fold of purification.
SDS-PAGE and immunoblotting
69
For SDS-PAGE and immunoblotting was used samples taken from end of purification. One mL
of each purified calpastatin peak was mixed with 0.5 mL of SDS sample buffer (30 mM Tris-HC1, 3
mM EDTA, 3% [w/v] SDS, 30% [vol/vol] glycerol, and 30 pg of pyronin Y /mL, pH 8.0) (Wang,
1982), 0.1 mL MCE and stored at -80 oC until analyse.
An 12.5% polyacrylamide separating gel (acrylamide:N,N′-bis-methylene acrylamide = 100:1
[w/w], 0.1% [w/v] SDS, 0.05% [v/v] TEMED, 0.05% [w/v] ammonium persulfate, and 0.5 M Tris–
HCl, pH 8.8). A 5% polyacrylamide gel (acrylamide:N,N′-bis-ethylene acrylamide = 100:1 [w/w],
0.1% [w/v] SDS, 0.125% [v/v] TEMED, 0.075% [w/v] ammonium persulfate, and 0.125 MTris–HCl,
pH 6.8) was used for the stacking gel. Gels (10 cm wide ×8 cm tall ×1.5 cm thick) were loaded with
10 μg protein per lane and run at a constant 20 V in SE 260 Hoefer Mighty Small II (Hoefer, Inc.,
Holliston, MA) electrophoresis units overnight.
Transfer of protein from SDS-PAGE gels to a PVDF membrane was performed as described by
Melody et al. (2004). Membranes were blocked for 1 h at room temperature in PBS with 0.1% Tween-
20 and 5% nonfat dry milk and were then incubated in primary antibody over-night at 4 °C. Primary
antibody dilution was for calpastatin, 1:5000 dilution (MA3-945, Thermo Scientific, Rockford, IL).
Membrane was washed 3 times in PBS–Tween for 10 min each at room temperature. The membrane
was then incubated in a goat anti-mouse horseradish peroxidase (No 2554, Sigma, St. Louis, MO)
secondary antibody at 1:10,000 dilution for 1 h at room temperature. After 3 additional 10 min washes
in PBS–Tween, blots were developed using SuperSignal West Femto Maximum Sensitivity Substrate
(ThermoScientific, Rockford, IL) and imaged using a ChemiImager 5500 (Alpha Innotech, San
Leandro, CA) and Alpha Ease FC software (v 3.03 Alpha Innotech).
Two-Dimensional Difference in Gel Electrophoresis.
To determine a protein profile of calpastatin peaks was used two dimensional DIGE technique
described by Anderson et al. (2012) with some modifications.
70
Preparative gels were loaded with 80μg of protein from either a peak. To first dimension proteins
are separated on the basis of isoelectric point (pI) was carried out on Immobiline DryStrips (13 cm,
pH 4–7, GE Healthcare, Piscataway, NJ) rehydrated with DeStreak Rehydration Solution (GE
Healthcare, Piscataway, NJ) containing 2.5 mM DL-dithiothreitol (DTT). Samples are dispersed in a
tray, which soaked immobilized pH gradient strip, placed on top of rehydration mix and was left to
rehydrate overnight at room temperature in a humidifier chamber. Isoelectric focusing was performed
on an Ettan IPGphor isoelectric focusing system (GE Healthcare) for a total of 14,500 V h.
After isoelectric focusing, strips were equilibrated using two sequential 15 min washes with
equilibration buffer (50 mMTris-HCl pH 8.8, 6 M urea, 30% glycerol, 2% SDS and a trace of
Bromophenol Blue) containing 65 mM DTT first and after in a 135 mM iodoacetamida (Rozanas &
Loyland, 2008).
The equilibrated strips were loaded onto 12.5% SDS-PAGE gels(acrylamide: N,N′-bis-
methylene acrylamide=100:1 [wt/wt], 0.1% SDS [wt/vol], 0.05%N,N,N′N-
tetramethylethylenediamine(TEMED), 0.05%ammonium persulfate [wt/vol], and 0.5 M Tris–HCl, pH
8.8), using agarose as an overlay and run over-night at 80 V at 4 oC on Ettan DALT SIX system (GE
Healthcare).
After second dimension electrophoresis, preparative gels were stained with Colloidal Coomassie
Blue solution (1.7% ammoniumsulfate [wt/vol], 30%methanol [vol/vol], 3% phosphoric acid [vol/vol],
and 0.1% Coomassie G-250 [wt/vol]). To destain was used distilled and deionized water. All buffers
and water used in this process was filtered using Stericup Filter Unit, poresize 0.22 μm (Millipore
Corp., Billireca, MA) to minimize potential contamination.
To identify the proteins showed in each gel the selected spot in the gel was excised and sent to
the Iowa State University Protein Facility for identification. It was performed the in-gel digestion (via
trypsin) using Genomics Solution ProGest (Chelmsford, MA). To dissolve the peptides were used
alpha-cyano-4-hydroxycinnamic acid (5 mg/mL in 50% CH3CN/0.1% Trifluoroacetic acid) and
deposited to a matrix-assisted laser desorption/ionization (MALDI) plate. Matrix-assisted laser
71
desorption/ionization mass spectrometry was performed using a QSTAR XL Quadrupole time-of-
flight mass spectrometer equipped with an orthogonal MALDI ion source (AB/MDS Sciex, Toronto,
Canada). Spectra were processed by MASCOT data-base search version 2.2.07 (MatrixScience,
London, UK).
RESULTS AND DISCUSSION
In the protocol for extraction of calpastatin from muscle using anion exchange chromatography,
calpastatin is eluted in two distinct peaks (Figure 1) and this pattern was reported before in (Pontremoli
et al., 1992; Salamino et al., 1994; Geesink et al., 1998; Averna et al., 2001; Samanta et al., 2010;
Cruzen et al., 2013), even though there are no consensus about the origin of those peaks.
Phosphorylation of calpastatin molecule by protein kinase C was demonstrated in vitro (Pontremoli et
al., 1992; Averna et al. 1999; Averna et al., 2001) that could change the ionic charge of the molecule
and modify the affinity to the column and could be involved in the regulation of . Other possibility
could be an alternative splicing of the gene (Geesink et al 1998; Gaarder et al., 2011). Degradation of
calpastatin molecule is another possibility to this separation in two peaks and the possible reason for
losing activity during the purification process (Geesink et al., 1998). The range of elution this first
calpastatin peak, shows that this peak has less affinity to the column compared to the second peak,
therefore it shows difference in ionic charge between them.
To determine the composition of each peak was proceeded the purification of each calpastatin
peak and the result are presented in Table 1. The process to purify the calpastatin peak 1 goes until
Phenil sepharose anion exchange column and among Q sepharose and Phenil sepharose calpastatin
peak 1 lose half activity but the activity per mg of protein is greatly increased. This fact was attributed
to a possible degradation during the purification process (Geesink et al,. 1998). Without heat treatment,
72
some protease is elute with calpastatin and this could cleave the molecule to small peptides tha could
not bind to column and loose activity (Geesink et al., 1998).
For calpastatin peak 2, the purification process was extended, passing through Bluesepharose
Cibacron Blue 3G Affinity column and DEAE CAPTO anion exchange column (Thompson et al.,
2000). Specific activity was increased 139.8 fold from the separation step and at the end of this process
remains only 36% of the initial total activity of this peak. Result of a peak eluted in the similar range
of KCl was found using similar anion exchange column, even though was used heat treatment before
load into the column and the specific activity was 952 units per mg of tissue (Geesink et al., 1998).
In purification of calpastatin from bovine heart Melgren et al. (1983) obtained a specific activity of
4340 units per mg of protein and 13.9% of recovery from the first column.
Same calpastatin separation in two peaks from rat skeletal muscle was described and was
reported and verified the having different specificities for each of the m and µ-calpain (Pontremoli
et al, 1991). They found that both forms of calpastatin are influenced by postranslation modification.
In another study involving phosphorilation of calpastatin peaks shows an interchangeable efficiency
against both calpains. Calpastatin peak 1 was verified more effective against µ-calpain and peak 2
more effective against m-calpain, after phosphorilation peak 1 turn more effective against m-calpain
and a dephosphorilation of peak 2 turn this peak more effective against µ-calpain (Pontremoli et al.,
1992). This findings and an increase in calpastatin degradation by proteases, suggesting the
existence of a different regulatory mechanism for calpastatin forms (Averna et al., 1999).
The protein profile in SDS-PAGE gel of the pooled fractions of calpastatin of Q sepharose
column and at the end of purification are presented in Figure 2 and shows that only weak bands are
stained. This result agree with specific activity and the fold of each peak purification and the bands
stained by calpastatin antibody (Figure 3). The results shows bands of approximately 70 kDa and the
peak 2 was a little higher than peak. Those molecular weight are similar to a fragment of intact
calpastatin degraded by endogenous proteases (Doumit et al., 1999).
73
The intact calpastatin molecule are present in range of 125 to 145 kDa in SDS PAGE. Estimated
molecular weight based on amino acid sequence of skeletal calpastatin is between 77 to 80 kDa. In
SDS-PAGE calpastatin migrates anomalously, and it is difficult to relate a band migrating at a
particular molecular weight in SDS-PAGE to a known calpastatin isoform, this anomalously slow
migration of calpastatin in SDS-PAGE is a property of the calpastatin polypeptide itself and probably
not due to posttranslational modifications (Maki et al., 1988; Goll et al. 2003).
Intact calpastatin molecule has no found in this study, and a possible reason is because the
calpastatin molecule is labile to degradation by endogenous proteases producing peptides that could
remain inhibitory activity (Emori et al., 1988; Goll et al.; 2003). This peptides coud not bind to the
columns during the process being eluted in early fractions or still bounded to column substrate, and
this is a possible reason to found that single band in this study.
The 70kDa molecular weight is similar to a calpastatin constructed in a non-fusing porcine
skeletal muscle using 1xa promoter and the authors attribute this band to a large proteolitic fragment
product of degradation of intact calpastatin containing the N-terminal epitope intact allowing the anti-
1xa peptide antibody to detect this large peptide fragment (Parr et al., 2004).
The calpastatin was identified in the second dimension gel in a similar molecular weight to
western blot (Figure 4). In the figure 4-A shows all 6 spots from calpastatin peak 1 and figure 4-B five
spots sent to identification and the identified spots are the spot number 2, 7 and 8. The peptide
sequences are presented in Table 2.
Sequence of peptides identified as part of the inhibitory domain III and IV and C terminus and
from purified peak 2 a sequence of peptides identified as part of the inhibitory domain I, II and III
(Figure 5). This results lead us to believe that both peaks, in this case, are products of degradation of
the intact molecule and probably the small peptides are loosed during the process. This result help us
to identify the composition of the peaks during the calpastatin extraction but is not conclusive about
the composition, the origin of peaks and the influence in the tenderness development.
74
CONCLUSIONS
The results of present study shows that is possible the purification of distinct forms of active
calpastatin separated using anion exchange column and purifying by sequential chromatography steps,
however the intact form of calpastatin was not present in this purification. Presence of peptides was
not conclusive to determine the origin and composition of each active peak. More studies are necessary
to improve the characterization and the influence in the tenderization process.
LITERATURE CITED
Anderson, M. J., Lonergan, S. M., Fedler, C. A., Prusa, K. J., Binning, J. M., Huff-Lonergan, E.
2012. Profile of biochemical traits influencing tenderness of muscles from the beef round.
Meat Sci., 91(3):247–254. doi:10.1016/j.meatsci.2011.07.021
Arnold M. K.; Parr T.; Sensky P. L.; Bardsley R. G.; Buttery P. J. 1995. Differential calpastatin
expression in cardiac and skeletal muscle. Biochem. Soc.Trans., 23:454S.
Averna M.; de Tullio R.; Salamino F.; Melloni E.; Pontremoli S.1999. Phosphorylation of rat brain
calpastatins by protein kinase C. FEBS Lett. 450: 13–16.
Averna, M., R. de Tullio, M. Passalacqua, F. Salamino, S. Pontremoli, E. Melloni. 2001. Changes in
intracellular calpastatin localization are mediated by reversible phosphorylation. Biochem. J.
354:25–30.
Cruzen, S. M., Harris, A. J., Hollinger, K., Punt, R. M., Grubbs, K. J., Selsby, J. T., Dekkers, J. C.
M., Gabler, N. K., Lonergan, S. M., Huff-Lonergan, E. 2013. Evidence of decreased muscle
protein turnover in gilts selected for low residual feed intake. J. Anim. Sci. 91:4007-4016.
http://dx.doi.org/10.2527/jas.2013-6413.
Doumit, M. E., & Koohmaraie, M. 1999. Immunoblot analysis of calpastatin degradation: Evidence
for cleavage by calpain in postmortem muscle. J. Anim. Sci. 77(6):1467–1473.
Emori, Y, Kawasaki H., Imajoh, S., Minami, Y., Suzuki K. 1988. All four repeating domains of the
endogenous inhibitor for calcium-dependent protease independently retain inhibitory activity. J
Biol Chem, 263: 2364–2370.
Gaarder, M., Thomassen, M. S., Veiseth-Kent, E. 2011. Identification of calpastatin, mu-calpain and
m-calpain in Atlantic salmon (Salmo salar L.) muscle. Food Chem., 125(3):1091–1096.
doi:10.1016/j.foodchem.2010.09.095.
Geesink, G. H., Koolmees, P. A., van Laack, H. L. J. M., Smulders, F. J. M. 1995. Determinants of
tenderisation in beef longissimus dorsi and triceps brachii muscles. Meat Sci. 41(1):7–17.
Geesink, G. H., Nonneman, D., Koohmaraie, M. 1998. An improved purification protocol for heart
and skeletal muscle calpastatin reveals two isoforms resulting from alternative splicing. Arch.
Bioch. Bioph. 356(1), 19–24.
Goll, D. E., Thompson, V. F., Taylor, R. G. and Ouali, A. 1998. The calpain system and skeletal
muscle growth. Can. J. Anim. Sci. 78: 503–512.
Goll, D. E., V. F. Thompson, H. Li, W. Wei, and J. Cong. 2003. The calpain system. Phys. Rev.
83:731–801.
Huff-Lonergan, E., Parrish, F. C., Robson, R. M. 1995. Effects of postmortem aging time, animal
age, and sex on degradation of titin and nebulin in bovine longissimus muscle. J. Ani. Sci.,
73(4):1064–1073.
75
Huff-Lonergan, E., T. Mitsuhashi, D. D. Beekman, F. C. Parrish Jr., D. G. Olson, and R. M. Robson.
1996. Proteolysis of specific muscle structural proteins by mu-calpain at low pH and
temperature is similar to degradation in postmortem bovine muscle. J. Anim. Sci. 74:993–
1008.
Imajoh S.; Kawasaki H.; Kisaragi M.; Mukai M.; Sugita H.; Suzuki K. 1984. A 107-kDa inhibitor for
calcium-activated neutral protease (CANP): purification from the human liver.Biomed Res 5:
481–488, 1984.
Killefer, J. and Koohmaraie, M. 1994. Bovine skeletal muscle calpastatin: cloning, sequence analysis
and steady-state mRNA expression. J. Anim. Sci. 72: 606–614.
Koohmaraie, M. 1990. Quantification of Ca2(+)-dependent protease activities by hydrophobic and
ion-exchange chromatography. J. Anim. Sci. 68:659–665.
Lowry O. H.; Rosenbrough N. J.; Farr A. L.; Randall R. J. 1951. Protein measurement with the folin
phenol reagent. J. Biol. Chem. 193: 265-275.
Maki M.; Takano E.; Osawa T.; Ooi T.; Murachi T.; Hatanaka M. 1988. Analysis of structure-
function relationship of pig calpastatin by expression of mutated cDNAs in Escherichia coli. J.
Biol. Chem. 263(21): 10254–10261.
Melody, J. L., Lonergan, S. M., Rowe, L. J., Huiatt, T. W., Mayes, M. S., Huff-Lonergan, E. 2004.
Early postmortem biochemical factors influence tenderness and water-holding capacity of three
porcine muscles. J. Anim. Sci. 82(4):1195–1205.
Mellgren R. L. & Carr T. C. 1983. The protein inhibitor of calcium-depen-dent proteases:
purification from bovine heart and possible mechanisms of regulation. Arch Biochem Biophys
225(2): 779–786.
Nakamura M.; Inomata M.; Hayashi M.; Imahori K.; Kawashima S. 1985 Purification and
Characterization of 210,000-Dalton Inhibitor of Calcium-Activated Neutral Protease from
Rabbit Skeletal Muscle and Its Relation to 50,000-Dalton Inhibitor. J. Biochem. 98(3): 757-
765.
Parr T.; Jewell K. K.; Sensky P. L.; Brameld J. M.; Bardsley R. G.; Buttery P. J. 2004. Expression of
calpastatin isoforms in muscle and functionality of multiple calpastatin promoters. Arch.
Biochem. Biophis. 427: 8-15.
Pontremoli, S., Melloni, E., Viotti, P. L., Michetti, M., Salamino, F., Horecker, B.L. 1991.
Identification of two calpastatin forms in rat skeletal muscle and their susceptibility to
digestion by homologous calpains. Arch. Biochem. Biophis. 288(2):646–652.
Pontremoli, S., Viotti, P. L., Michetti, M., Salamino, F., Sparatore, B., Melloni, E. 1992. Modulation
of inhibitory efficiency of rat skeletal muscle calpastatin by phosphoryla-tion. Bioch. Bioph.
Res. Com., 187(2), 751–759.
Rozanas, C. R., & Loyland, S. M. (2008). Capabilities using 2-D DIGE in proteomics research. In B.
C. -S. Liu, & J. R. Ehrlich (Eds.),Tissue proteomics (pp. 1–18). Totowa, NJ: Humana Press.
Salamino, F., De Tullio, R., Michetti, M., Mengotti, P., Melloni, E., Pontremoli, S. 1994. Modulation
of calpastatin specificity in rat tissues by reversible phosphorylation and dephosphorylation.
Bioch. and Bioph. Res. Comm. 199(3):1326–1332.
Samanta, K., P. Kar, T. Chakraborti, S. Shaikh, and S. Chakraborti. 2010. Characteristic properties of
endoplasmic reticulum membrane m-calpain, calpastatin and lumen m-calpain: A comparative
study between membrane and lumen m-calpains. J. Biochem. 147:765–779. doi:
10.1093/jb/mvq009.
Thompson, V. F., & Goll, D. E. 2000. Purification ofl-Calpain, m-Calpain, and Calpastatin from
animal tissues. In J. S. Elce (Ed.).Calpain methods and protocols . 144: 1–16. Humana Press,
Totowa, NJ.
Takano, E., Maki, M., Hatanaka, M., Mori, H., Zenita, K., Sakihama, T., Kannagi, R., Marti,
T., Titani, K., and Murachi, T. 1986. Evidence for the repetitive domain structure of pig
calpastatin as demonstrated by cloning of complementary DNA. FEBS L&t. 208(2):199-202
Wang, K. 1982. Purification of titin and nebulin. Methods Enzymol. 85:264.
76
Tables and Figures
10 Figure 1 Calpastatin activity of eluted fractions (Arbitrary units)
77
5Table 1 – Steps of purification of calpastatin peaks.
Column Calpastatin peak 1
Activity/mL Activity/mg protein Total Activity Lose activity (%)
Q sepharose 1.48 0.69 344.84 -
Phenilsepharose 0.99 164.50 171.738 50.2%
Column Calpastatin peak 2
Activity/mL Activity/mg protein Total Activity Lose activity (%)
Q sepharose 3.89 5.29 1981.86 -
Phenilsepharose 8.84 368.33 1343.68 32.2%
Bluesepharose 6.49 721.11 1298 34.5%
DEAE CAPTO* 34 739.13 714 64.0%
78
11 Figure 2 – Load check silver stained of initial and final step of calpastatin purification. Lane M)
Broad range molecular marker; 1) Pooled fractions of peak 1 activity of calpastatin from Q sepharose
column; 2) Pooled fractions of peak 2 activity of calpastatin from Q sepharose column; 3) Pooled
fractions of peak 1 activity of calpastatin from Phenil sepharose column; 4) Pooled fractions of peak
2 activity of calpastatin from DEAE CAPTO column.
79
12 Figure 3 – Western blott stained by calpastatin antibody of purified calpastatin peak 1 (PK1) and
calpastatin peak 2 (PK2).
80
13 Figure 4 – 2D DIGE of calpastatin peaks coomassie stained. A) Calpastatin peak 1; B) calpastatin
peak 2. Numbers of collected spots and sent to identification are presented in boxes.
81
6 Table 2 - Identified spots from calpastatin peaks gels.
Spot
ID Protein Specie Gene Acession pI
Mass
kDa Coverage Identified Peptides
2 Calpastatin Sus
scrofa CAST P12675 5.33 77.1 9.68 KPEAAQDPIDALSGDFDR
KLDDALDQLSDSLGQR LDDALDQLSDSLGQR DDTIPPEYR QPDPDENKPIEDK LGEKEETIPPDYR
7 Calpastatin Sus
scrofa CAST P12675 5.33 77.1 8.7 STGEVLK
SLTSSVPAESK SEPELDLSSIK ESQATAPTPVGEAVSR LSVTGVSAASGKPAETK
8 Calpastatin Sus
scrofa CAST P12675 5.33 77.1 8.84 ESQATAPTPVGEAVSR
LSVTGVSAASGKPAETK KSEPELDLSSIK SLTSSVPAESK
STGEVLK
82
MNPTETKAIPVSKQLEGPHSPNKKRHKKQAVKTEPEKKSQSTKPSVVHEKKTQEVKP
KEHPEPKSLPTHSADAGSKRAHKEKAVSRSNEQPTSEKSTKPKAKPQDP TPSDGKLS
VTGVSAASGKPAETKKDDKSLTSSVPAESKSSKPSGKSDMDAALDDLIDTLGGPEE
TEEDNTTYTGPEVLDPMSSTYIEELGKREVTLPPKYRELLDKKEGIPVPPPD TSKPLGP
DDA IDALSLDLTCSSPTADGKKTEKEKSTGEVLKAQSVGVIKSAAAPPHEKKRRVEE
DTMSDQALEALSASLGSRKSEPELDLSSIKEIDEAKAKEEKLKKCGEDDETVPPEYRL
KPAMDKDGKPLLPEAEEKPKPLSESEL IDELSEDFDQSKRKEKQSKPTEKTKESQAT
APTPVGEAVSRTSLCCVQSAPPKPATGMVPDDAVEALAGSLGKKEADPEDGKPVED
KVKEKAKEEDREKLGEKEETIPPDYRLEEVKDKDGKTLPHKDPKEPVLPLSEDFV L
DALSQDFAGPPAASSLFEDAKLSAAVSEVVSQTSAPTTHSAGPPPDTVSDDKKLDDA
LDQLSDSLGQRQPDPDENKPIEDKVKEKAEAEHRDKLGERDDTIPPEYRHLLDKD
EEGKSTKPPTKKPEAPKKPEAAQDPIDALSGDFDRCPSTTETSENTTKDKDKKTASK
SKAPKNGGKAKDSTKAKEETSKQKSDGKSTS
14 Figure 5 – Representative calpastatin molecule aminoacid sequence from Sus scrofa gene: CAST;
713 Aminoacids; Mass (Da):77,124. Inhibitory domains are presented in closed boxes and peptides
identified are in uppercase and in yellow are from peak 1 and from peak 2 as identified by grey.
83
CAPITULO 4 – Análise proteômica do músculo “Longíssimus dorsi” de bovinos da raça nelore
mocho de diferentes grupos de maciez.
Autores: OLIVEIRA, Leonardo G.; FERREIRA, Reginaldo N.; MAGNABOSCO, Claudio U.;
BORGES Clayton L.; PERON, Hugo J.M.C.; MOREIRA André; PÁDUA João T.
RESUMO – Foi avaliado o perfil protéico de animais de extremos valores de força de cisalhamento
com sete dias de maturação da carne, extremo baixo (Macio) e extremo alto (Duro), da raça nelore
mocho de uma população segregante para a maciez da carne. Proteínas relacionadas com a defesa
celular com função anti apoptótica foram encontradas nos dois grupos de animais. Apenas identificada
no grupo D, a proteína citocromo c indica indução do processo apoptótico. Proteínas estruturais foram
identificadas no grupo M, indicando uma possível maior proteólise devido fato destas proteínas quando
intactas não estarem solúveis no tampão de extração utilizado. Maior abundância relativa de proteínas
do processo glicolítico foi evidenciado no grupo M e proteínas do metabolismo oxidativo foram
evidenciadas mais expressas no grupo D, fato que provavelmente está correlacionado à maciez final
da carne. A calpastatina foi somente identificada no grupo D, esta proteína está relacionada com a
maciez final da carne por ser inibidora natural das calpaínas. A maciez da carne está relacionada a
expressão de algumas proteínas ligadas ao estresse, ao tipo de metabolismo energético e a Calpastatina.
Palavras chave: Bos indicus; Força de cisalhamento; LC-MS; Metabolismo; Seleção genética.
ABSTRACT – Proteomic analysis was used to evaluate the protein profile of extreme WBSF values
of 7 days aged meat animals, extreme low values (Tender) and extreme High (Tough), of Nellore owl
breed from a segregating population of meat tenderness. Cell defense proteins related with apoptotic
process were founded in both groups. Only identified in Tough group, the protein citochrome c
indicates induction of apoptotic process. Structural proteins were identified in tender group indicating
possibly more proteolysis due of these intact proteins are not soluble in this used buffer. Higher protein
relative abundance of proteins related to glycolytic metabolic process as evidenced on tender group
and proteins from oxidative process are more expressed in tough group, this fact is probably are
correlated to final meat tenderness. Calpastatin was only founded present in tough group, and are
related to final tenderness due to be a natural inhibitor of calpains. Final tenderness are related to the
expression of some stress proteins, energy metabolism type and to the calpastatin.
Keywords: Bos Indicus; Genetic selection; LC-MS; Metabolism; Shear Force.
INTRODUÇÃO
Dentre os bovinos destinados à produção de carne no Brasil, a grande maioria é composta por
animais da sub espécie Bos indicus, principalmente da raça Nelore, tendo como característica
inportante a rusticidade comparados a animais Bos taurus, porém com carne com menor maciez (1).
A maciez da carne é uma das características organolépticas de grande importância e está
relacionada diretamente à satisfação do consumidor (2,3) e é influenciada por vários fatores ante
mortem e post mortem como a atividade de enzimas proteolíticas presentes no músculo,
disponibilidade de energia pós mortem e velocidade de resfriamento da carcaça (4,5).
84
Diferenças consideráveis na maciez da carne podem ser explicadas pela herança genética e
segundo (6) um programa de melhoramento genético com seleção para maciez é uma alternativa
promissora para a produção de carne zebuína naturalmente macia. Trabalhos envolvendo o
melhoramento genético de bovinos vêm sendo desenvolvidos visando selecionar indivíduos por suas
características de interesse (7,8).
A expressão protéica nas células musculares destes animais pode apresentar diferenças devido
às características herdadas dos seus genitores, influenciando todo o metabolismo celular e expressão
das características fenotípicas. Para a investigação destes mecanismos metabólicos a análise
proteômica se apresenta como uma ferramenta útil com grande aplicabilidade (9–11).
Este trabalho tem como propósito a caracterização das diferenças de expressão protéica do
músculo Longissimus dorsi entre animais da raça Nelore Mocho de uma população segregante para
maciez da carne.
MATERIAL E MÉTODOS
Coleta e preparo das amostras
Um grupo de 83 animais contemporâneos, de uma mesma propriedade, oriundos de um programa
de melhoramento genético da EMPRAPA denominado “Macro Programa 2”, fruto de acasalamentos
com o propósito de selecionar animais com característica de carne macia, foram terminados em sistema
de confinamento e abatidos quando atingiram peso médio de 510 kg de peso vivo. Estes animais foram
abatidos em frigorífico inspecionado pelo sistema de inspeção federal (SIF) e sob condições
humanitárias de abate. Uma amostra do músculo Longíssimus dorsi de cada animal foi coletada 30
minutos após a exanguinação, entre a 12ª e 13ª costela, na meia carcaça direita de 1,5cm de espessura
abrangendo toda seção do músculo.
O tecido adiposo e conjuntivo visível de cada amostra foi retirado para após ser cortada em cubos
de aproximadamente 1cm3, imergidas em nitrogênio líquido para congelamento e transporte até o
Laboratório de Fisiologia da Digestão do Instituto de Ciências Biológicas II da Universidade Federal
de Goiás. As amostras foram processadas em triturador com mini container (Waring® SN-04241-11)
durante 3 minutos e armazenadas em freezer a -80ºC para posteriores análises.
Outra amostra com 2,54 cm de espessura foi retirada da meia carcaça direita dos respectivos
animais 24 horas após o abate seguindo o mesmo protocolo. Estas amostras foram embaladas à vácuo
e mantidas sob refrigeração durante 6 dias para a determinação da força de cisalhamento pelo método
Warner-Bratzler Shear Force (WBSF) (12) no dia 7 post mortem.
85
Os animais foram ranqueados de acordo com os resultados da força de cisalhamento (WBSF) e
foram selecionados para as analises os 10 animais dos extremos de alto WBSF (Grupo D) e baixo
WBSF (Grupo M).
Extração proteica
A extração proteica e análise proteômica foram realizadas no laboratório de Biologia Molecular
“José Salum” – Instituto de Ciências Biológicas – Universidade Federal de Goiás. A fração solúvel
das proteínas musculares foi extraída conforme (13). Cada amostra dos grupos baixo WBSF (Macio)
e alto WBSF (Duro) foi solubilizadas em três vezes o volume de solução tampão fria de extração
composto por 50mM de Tris, 1mM de EDTA com o pH ajustado para 8,5 com solução de HCl 6N em
tubo, em equipamento BeadBeater (BioSpec, Bartlesville, USA) em tubos contendo 1/3 do volume da
amostra em esferas de vidro ácido lavadas de 200–500 μm (Sigma Aldrich). Após a solubilização a
amostra foi centrifugada por 20 minutos a uma temperatura de 4ºC a 40.000 x g. As proteínas
solubilizadas na porção sobrenadante foram transferidas para outro tubo e quantificada a concentração
de proteínas pelo método de Bradford et al. (14) em triplicata, utilizando curva padrão previamente
construída com soroalbumina bovina. Três alíquotas foram feitas e armazenadas em freezer -80ºC.
Após a quantificação, foi procedida a eletroforese unidimensional em gel de poliacrilamida para
verificação do perfil de bandas para confirmação da quantificação protéica. Para preparação de cada
amostra, 20 µg de proteína foi colocado em tubo e 15 µL de tampão de amostra (TRIS/HCl pH 6,8
100mM, 4,0% de dodecil sulfato de sódio, 0,2% de azul de bromofenol; 20,0% de glicerol) e aquecido
a 100ºC por 10 minutos. As amostras preparadas foram aplicadas em gel eletroforético de 12,5% de
poliacrilamida com medidas de 10 x 10 cm (N,N’-bis-metileno acrilamida,1% de dodecil sulfato de
sódio, 0,05% de N,N,N’-N tetrametiletiletilenodiamina (TEMED), 0,01% de persulfato de amônia;
0,5M de Tris com pH ajustado para 8.8 com uma solução de HCl) e corridas com voltagem constante
de 120V. Após a corrida eletroforética os géis foram corados pela imersão durante 12 horas em solução
azul brilhante de coomassie (1,7% de sulfato de amônio; 30% de metanol; 3% de ácido fosfórico; 0,1%
de Coomassie G-250). Os géis foram fotografados e estão apresentados no Anexo 1.
Análise proteômica
Uma alíquota de 200µg de proteína de cada animal do grupo D foi utilizada para compor uma
amostra representativa do grupo e feito o mesmo procedimento com as amostras do grupo M para
compor uma amostra representativa do grupo. A quantidade relativa a 200µg de proteínas foi retirada
86
de cada amostra representativa de cada grupo, lavadas com quatro volumes de água ultrapura
utilizando filtros Amicon ultra 0,5mL (Merck Milipore, Darmstadt, Alemanha) de 3000 Da, em
seguida com três volumes de solução aquosa de formiato de amônio 20mM. Após as amostras foram
preparadas para a digestão de acordo com protocolo proposto por Borges et al. (11).
Para a digestão das amostras foram adicionados 2µg de Tripsina (Promega, Madison, WI, USA)
diluída em solução de Bicarbonato de amônio (50mM de NH4HCO3) homogeneizada e incubada por
16 horas à 37ºC. Terminada a digestão, foram adicionados 40µL da solução aquosa de Ácido
Trifluoroacético a 5%, homogeneizado e incubado a 37ºC por 90 minutos para a digestão do
RapiGEST e após centrifugadas a 14000RPM a 4ºC por 30 minutos. O sobrenadante foi transferido
para novo tubo e desidratado à temperatura ambiente em centrífuga Speed Vacuum (Eppendorf,
Hamburg, Alemanha) a 3000PRM durante 5 horas. As amostras foram resuspendidas com 120µL de
solução aquosa de bicarbonato de amônio (50mM) e transferidas para frasco ultra limpo (Waters®,
preslit PTFE/silicone caps). Para o ajuste do pH, 5µL da solução aquosa de formiato de amônio e em
seguida 120 fempto Mol de enolase (Waters, Milford, MA, USA) como padrão interno. Em seguida a
separação dos peptídeos digeridos foi procedida utilizando equipamento LC-MS 2D nano ACQUITY
system (Waters, USA) equipado com duas colunas de fase reversa trabalhando em condição ácida e
básica. A primeira coluna foi nanoEase BEH130 C18 (1.7 μm, 100 μm x 100 mm; Waters, USA) e a
segunda coluna NanoAcquity UPLC BEH 130 C18 (1.7 μm, 100 μm × 100 mm; Waters, USA). Para
a espectrometria de massas foi utilizado o Synapt G1 MS (Waters, USA) equipado com uma fonte de
nanoeletrospray e dois analisadores de massas: um quadrupolo e um time-of-flight (TOF) operando
em modo TOF-V. Os dados foram obtidos utilizando o equipamento em modo MSE em alternância de
baixa energia (6 V) e alta energia (20-40 V) com modos de aquisição a cada 0,4 segundos.
Os dados obtidos usando o protocolo em modo MSE foram processados utilizando-se software
ProteinLynx Global Server (PLGS) versão 2.4 (Waters, USA). Os dados foram submetidos a uma
análise para a retirada de interferências, deisotopização e deconvolução de carga. O resultado foi
comparado com banco de dados mundial de sequência de proteínas de Bos taurus UniProt (Universal
Protein Source, http://www.uniprot.org/proteomes/UP000009136) para a identificação proteica.
Modificações como oxidação da metionina e serina e fosforilação da treonina e tirosina foram
consideradas.
A comparação da abundância relativa das proteínas foi feita baseada na intensidade média da
proteína padrão interno (enolase fúngica) e foi usada para converter a intensidade média dos peptídeos
analisados para a quantificação absoluta da amostra injetada no equipamento. O software ExpressionE
informatics v.2.5.2 foi utilizado para a comparação quantitativa. As proteínas identificadas foram
organizadas pela expressão das proteínas do grupo M em relação ao grupo D e selecionadas as
87
proteínas induzidas ou suprimidas no mínimo de 50%. O modelo matemático utilizado para calcular
as relações entre os grupos é parte do software PLGS (Wathers corporation, USA).
Determinação da atividade da enzima superóxido dismutase
Foi determinada a atividade da enzima superoxido dismutease nas amostras dos quatro animais
dos extremos de cada grupo. As proteínas foram extraídas, dosada concentração protéica de cada
amostra extraída e uma alíquota correspondente a 200 fempto Mol foi utilizada para a dosagem da
atividade enzimática utilizado o Kit comercial SOD Assay Kit-WST (Sigma-Aldrich, St. Louis, MO,
USA), seguindo o protocolo descrito pelo fabricante.
Análise estatística
As médias dos valores de WBSF e de atividade da enzima Superóxido dismutase dos animais
selecionados foram submetidas a analise de variância e (P<0,05) com o auxílio do pacote “easyanova”
do software R (R Core Team, 2013).
A comparação da abundância relativa das proteínas foi feita baseada na intensidade média da
proteína padrão interno (enolase) e foi usado para converter a intensidade média dos peptídeos
analisados para a quantificação absoluta da amostra injetada no equipamento. O software ExpressionE
informatics v.2.5.2 foi utilizado para a comparação quantitativa. As proteínas identificadas foram
organizadas pela expressão das proteínas do grupo M em relação ao grupo D e selecionadas as
proteínas induzidas ou suprimidas no mínimo de 50%. O modelo matemático utilizado para calcular
as relações entre os grupos é parte do software PLGS (Wathers corporation, USA).
A força de cisalhamento é a força necessária para cisalhar uma secção transversal de carne, em
kg/cm2, e é uma medida direta na avaliação da maciez da carne (15).
RESULTADOS E DISCUSSÃO
Houve diferença entre as médias de força de cisalhamento entre os grupos de animais (Tabela
1).
7 Tabela 1 – Médias de força de cisalhamento transversal (WBSF) do músculo Longíssimos dorsi
dos animais selecionados para compor o grupo macio (M) e grupo duro (D).
Grupos EPM# P valor*
88
Grupo D Grupo M
WBSF* (Kgf/cm2)
5,75 1,24 0,1254 <0,001
#Erro padrão da média
*Valor de probabilidade do teste F da análise de variância.
De acordo com a média de WBSF, a carne dos animais do grupo M pode ser considerada macia
de acordo com Shackelford et al.(16), que definiram valores de WBSF abaixo de 4,5 Kgf.(cm2)-1 como
carne macia. A maciez da carne vem sendo desenvolvido em animais da raça Nelore mocho e visa
selecionar indivíduos que possuam superioridade genética para desempenho e carcaça. Este trabalho
de seleção genética é importante, pois a maciez da carne é um importante atributo organoléptico (2,3)
e de acordo com Castro et al. (8) esta seleção não afeta as características de deposição de gordura
subcutânea, muscularidade e ganho de peso diário médio.
As proteínas são fruto da expressão dos genes do indivíduo e a diferença na produção das
proteínas contribui para a diferença entre os indivíduos. As proteínas são responsáveis por diversas
funções na célula muscular e podem estar solúveis no citoplasma da célula ou das organelas ou
insolúveis, por exemplo, na estrutura celular ou membranas. Proteínas sarcoplasmáticas solúveis
ligadas à defesa celular foram identificadas diferentemente expressas entre os grupos de animais
(Tabela 2).
89
8 Tabela 2 – Proteínas relacionadas à defesa celular, diferentemente expressas entre os grupos macio (M) e duro (D).
Descrição Acesso# Score Relação
Macio:Duro* Função
14 3 3 protein epsilon 1433E_BOVIN 4312,4 1,82 Anti apoptose
14 3 3 protein gamma 1433G_BOVIN 3658,7 2,08 Anti apoptose
Mth938 domain containing protein AAMDC_BOVIN 4329,7 0,54 Anti-apoptose
Glutathione S transferase P GSTP1_BOVIN 24269,9 0,502 Detoxificação de radicais de oxigênio
Peroxiredoxin 1 PRDX1_BOVIN 20102,8 0,583 Detoxificação de radicais de oxigênio
Peroxiredoxin 2 PRDX2_BOVIN 13099,9 0,492 Detoxificação de radicais de oxigênio
Thioredoxin dependent peroxide reductase
mitochondrial PRDX3_BOVIN 1934,2 >100 Detoxificação de radicais de oxigênio
Peroxiredoxin 4 PRDX4_BOVIN 2045,8 0,560 Detoxificação de radicais de oxigênio
Superoxide dismutase Cu Zn SODC_BOVIN 5107,9 <0,01 Detoxificação de radicais de oxigênio
S formylglutathione hydrolase ESTD_BOVIN 1914,5 0,502 Detoxificação por modificação
Aldo keto reductase family 1 member B1 Q5E962_BOVIN 3095,3 >100 Metabolismo de açucar, glicosídeo,
poliol e carboxilato
Alpha crystallin B chain CRYAB_BOVIN 12623,7 2,203 Receptor transmembrana e sinalizador da
via tirosina quinase
Tripartite motif containing 72 E1BE77_BOVIN 1316,0 >100 Reorganização do citoesqueleto
dependente do ciclo celular
LIM domain binding 3 F1MRX5_BOVIN 1442,6 <0,01 Reorganização do citoesqueleto
dependente do ciclo celular
Protein CutA F1MTI7_BOVIN 2773,3 <0,01 Resposta a estimulos externos
Heat shock 70kDa protein 5 (glucose-regulated
protein, 78kDa) F1N614_BOVIN 1138,0 <0,01 Resposta ao choque térmico
Zeta crystallin QOR_BOVIN 3608,2 0,492 Resposta ao choque térmico
Heat shock protein beta 6 HSPB6_BOVIN 18413,1 2,160 Resposta ao choque térmico
Heat shock protein beta 1 G3X7S2_BOVIN 27819,4 3,065 Resposta ao choque térmico
Heat shock protein HSP 90 beta HS90B_BOVIN 484,5 >100 Resposta ao choque térmico
Heat shock protein 75 kDa mitochondrial TRAP1_BOVIN 436,6 >100 Resposta ao choque térmico
90
Protein DJ 1 PARK7_BOVIN 47840,0 0,482 Resposta ao estresse oxidativo
Aldehyde dehydrogenase 1 family, member L2 E1BDG9_BOVIN 164,7 <0,01 Transferidor de C-1 tetrahidrofolato-
dependente
Aldehyde dehydrogenase E1BMG9_BOVIN 164,7 <0,01 Transferidor de grupos C-1 ativados
Serotransferrin G3X6N3_BOVIN 3555,5 >100 Transporte de íons metálicos (Cu, Fe, etc)
Cytochrome c CYC_BOVIN 3343,2 0,538 Transporte mitocondrial
# Número de acesso no banco de dados UNIPROT.
* Razão entre a abundância relativa da proteína no grupo M pelo grupo D.
91
A Heat shock 70kDa protein 5 (HSP-5 70) foi identificada inibida em animais do grupo M e
a Zeta cristalin mais expressa nos animais do grupo D. As Heat shock protein 75 kDa mitochondrial
e Heat shock protein 90 beta foram identificadas somente nos animais do grupo M e as Heat shock
protein beta 1 e beta 6 e αβ-cristalin foram identificadas como mais expressas no grupo dos animais
Macio.
As proteínas de choque térmico (HSPs) fazem parte de uma família de proteínas de uma cadeia
interativa de chaperonas, constitutivamente expressas, tem rápida expressão sob condições de estresse
com uma das principais funções a prevenção contra danos a célula (17). A família das HSP de 70
kDa está ligadas a proteção celular contra a apoptose promovendo a estruturação espacial correta das
proteínas (folding) e prevenindo a translocação de proteínas pró apoptóticas por se ligarem a elas
(17–19). A apoptose foi proposta recentemente como o primeiro estágio do processo de maturação
da carne (20), contribuindo para o processo de amaciamento, favorecendo a ativação das caspases no
processo apoptótico (18).
Outra forma de evitar danos à célula é evitando a formação de espécies reativas de oxigênio
(ERO). Animais do grupo D apresentaram as proteínas Superoxide dismutase Cu Zn (SOD CuZn),
Aldehyde dehydrogenase 1 (ADH1) e Peroxiredoxin 2 (PRX 2) identificada reprimida no grupo M.
Apesar de estar reprimida em animais do grupo M a atividade da SOD CuZn não apresentou diferença
entre os grupos (Figura 1). A SOD é regulada por uma chaperona específica de Cobre para a sua
ativação que introduz íons Cobre e pontes dissulfeto na sua molécula para torná-la ativa (21).
A PRX 2 foi relacionada com a característica maciez com 33% de repressão no dia 7 em relação
ao dia 0 (22). A ADH1 também é um potencial para maciez, atua em processo citoprotetor e
eliminando a conversão de aldeídos potencialmente citotóxicos gerados pela peroxidação lipídica e
atuando também no processo glicolítico convertendo o gliceraldeído a 2-fosfoglicerato (23).
92
15 Figura 1 – Atividade da enzima SOD (% inibição da formação do íon super óxido) entre os
grupos baixo WBSF (Macio) e alto WBSF (Duro)
A proteína DJ1 foi identificada reprimida nos animais do grupo M e em conjunto com a proteína
Mth938 domain containing e a PRX2 também está envolvida na defesa celular contra a formação de
ERO e foram relacionadas negativamente com a maciez da carne durante juntamente com a SOD no
processo de maturação (24). Os autores atribuíram os efeitos negativos à prevenção contra a apoptose
e a não ativação das caspases no período post mortem, sendo estas proteases relatadas como
importantes no processo de amaciamento da carne. A proteína DJ1 foi também encontrada menos
expressa em animais com característica de carne mais macia provavelmente envolvida em algum
processo que irá determinar a maciez da carne (25).
A proteína Cytochrome c foi encontrada como reprimida nos animais do grupo M, sendo
possivelmente uma evidencia de maior ativação do processo apoptótico em animais do grupo D. Uma
vez liberada no citoplasma, a proteína cytochrome c induz a formação do apoptossoma ativando o
sistema das caspases, não corroborando com os achados descritos por Picard et al. (24).
Identificada induzida nos animais do grupo M, a proteína Heat shock protein 75 kDa
mitochondrial está relacionada com a regulação negativa da apoptose inibindo a formação de ERO,
a modulação da respiração celular, quando há falta de glicose disponível para evitar a formação de
ERO (26). Esta proteína também foi apontada como possível marcador para maciez em estudo
envolvendo o músculo Semitendinosus corroborando com o achado deste presente estudo (19).
A HSP 90 está envolvida em várias funções celulares e juntamente com a HSP 75 mitochondrial
(TRAP1) desempenha função anti-apoptótica. Quando associada à óxivo nitroso sintase (ONS), a
HSP 90 diminui a atividade proteólitica da µ-calpaína em 80% (27). A formação de uma tríade
protéica na presença do íon Ca+ entre a HSP 90 a ONS e a µ-calpaína, afirmando que este sistema
possivelmente constitui uma forma de regulação da µ-calpaína, possivelmente reduzindo a afinidade
da pelo Ca+ atuando assim como inibidora parcial da sua atividade (28).
0
5
10
15
20
25
Ati
vid
ade
de
SO
DBaixo WBSF
Alto WBSF
93
Foram detectadas induzidas no grupo M a Thioredoxin dependent peroxide reductase
mitochondrial (PRTDm) e a serotransferina, estas proteínas também estão ligadas à redução da
atividade apoptótica pela redução de ERO (29).
A Proteina tripartite motif containing 72 (TMC72) se mostra identificada reprimida no grupo
M, e pode ser uma possível contribuidora para o processo de amaciamento da carne. Está relacionada
com o reparo da membrana celular e função anti apoptotica, se ligando com a fosfatidilserina e
regulando proteínas de membrana cálcio dependente. Outra função importante é a ação negativa sobre
o hormônio fator de crescimento semelhante à insulina, diminuindo a atividade de calpastatina e não
restringindo a proteólise (30).
As proteínas Heat shock protein beta 1 (HSBb1), Heat shock protein beta 6 (HSPb6) e αβ
cristalin (αβCST) foram evidenciadas induzidas no grupo M. Estas proteínas de menor peso
molecular também fazem parte das chaperonas com a função de proteção da estrutura celular (31). A
atividade destas chaperonas está envolvida na remodelagem da estrutura do citoesqueleto, se ligando
a evitando a agregação e dificultando a ação de proteases, estabilizando e reorganizando as proteínas
estruturais, com grande afinidade pela actina (32). Em estudo envolvendo o músculo Semitendinosus
também foi evidenciado a proteína αβCST como um possível candidato a marcador para maciez (19).
Apesar de estarem altamente relacionadas com o processo de amaciamento da carne (33) o seu
papel de proteção só é efetivo quando estão ligados à miofibrilas, não dissolvidos no sarcoplasma.
Após ocorrer o estresse da fibra muscular, estas chaperonas são rapidamente ativadas e se ligam às
proteínas estruturais, ficando agregadas às miofibras (34), corroborando portanto com os resultados
do presente trabalho. (18) encontraram que a supressão dos genes que codificam estas proteínas estão
ligados com a característica de maciez da carne. Os autores afirmam que a supressão destas
chaperonas leva a uma desorganização das proteínas estruturais presentes na linha Z do músculo
facilitando assim a degradação.
O grupo das proteínas 14-3-3 foi identificado induzido em animais do grupo M e este grupo de
proteínas desempenha as funções de inibição da apoptose e inibição da proteína kinase C. A Proteína
kinase C tem a capacidade de fosforilar a calpastatina (CAST) , alterando as propriedades inibitórias
desta, podendo desta forma atuar no processo de proteólise post mortem, regulando a atividade
inibitória da CAST. A fosforilação da CAST favorece a agregação próximo ao núcleo da célula (35–
37).
Identificada reprimida no grupo M a S formilglutationa hidrolase (SFGH) tem função de
detoxificação pela conversão do formaldeído em glutationa e formato auxiliando na proteção celular
evitando danos à estrutura celular, corroborando com o presente estudo, favorecendo a ativação do
processo apoptótico (38).
94
Única proteína estrutural reprimida no grupo M, a myosin light chain 1 3 skeletal muscle
isoform (MCL1-3) (Tabela 3). Proteína ligada ao aparato contrátil do músculo esquelético, ligada a
miosina de cadeia pesada e a actina, somente é encontrada na fração solúvel quando é hidrolisada ou
quando alguma proteína em que ela está ligada é hidrolisada e está associada a proteólise post mortem
inicial, na dissolução do rigor mortis (39). A liberação desta proteína pode estar provavelmente
relacionada com a lesão celular pré abate e várias causas podem estar envolvidas como o estresse
ocasionado no momento do abate. Eleita como provável marcador para maciez da carne, foi descrita
por JIA et al. (25) como diferentemente expressa na fração solúvel em um curto período de tempo
post mortem, resultado do início da proteólise.
95
9 Tabela 3 - Proteínas relacionadas a estrutura celular diferentemente expressas entre os grupos macio (M) e duro (D).
Descrição Acesso# Score Relação
Macio:Duro* Função
Cysteine and glycine rich protein 3 CSRP3_BOVIN 4295,65 <0,01 Citoesqueleto / proteína estrutural
Myomesin (M-protein) 2, 165kDa E1BF23_BOVIN 832,84 >100 Citoesqueleto / proteína estrutural
Myosin light chain 1 3 skeletal muscle isoform MYL1_BOVIN 6546,25 0,55 Citoesqueleto / proteína estrutural
Adenylate kinase isoenzyme 5 KAD5_BOVIN 2139,97 >100 Conversão e regeneração de energia
Vinculin F1N789_BOVIN 705,96 >100 Guia da extensão longitudinal celular
Filamin B, beta E1BKX7_BOVIN 27,05 >100 Microtubulo/ citoesqueleto
Tubulin alpha-1C chain-like F1MNF8_BOVIN 130,93 >100 Microtubulo/ citoesqueleto
Tubulin alpha 4A chain TBA4A_BOVIN 684,28 >100 Microtubulo/ citoesqueleto
Kinectin 1 (kinesin receptor) F1MLU7_BOVIN 50,63 <0,01 Transporte tubulina dependente
Filamin A, alpha F1N169_BOVIN 6,69 >100 Transporte vesicular # Número de acesso no banco de dados UNIPROT.
* Razão entre a abundância relativa da proteína no grupo M pelo grupo D.
96
Proteínas estruturais Filanin A alpha (αFILA), myomesin 2 (MYOM2), Tubulin alpha 4A chain
(αTUB4A) e 1C (αTUB1A) da αtubulina e βfilanina B (βFILB) foram identificadas induzidas no
grupo M. As proteínas estruturais encontradas solubilizadas logo após o abate, provavelmente são
produtos da proteólise, pelo fato destas proteínas estarem associadas à fração miofibrilar insolúvel.
Estas proteínas são substratos para a µ-calpaína e para as caspases, e esta proteólise precoce pode
estar associada ao turn-over protéico ou ao processo de apoptose (40–42). A proteólise libera
peptídeos de menor peso molecular do que a molécula intacta e esses peptídeos (40,42,43).
Proteólise precoce da MYOM2 foi relatada por Anderson et al. (39) como uma proteína
candidata a indicadora da maciez final da carne em bovinos corroborando com o presente estudo.
Além desta proteína a abundância da miosina de cadeia leve 1 na fração solúvel foi evidenciada sua
rápida solubilização e teve alta correlação com a taxa de proteólise post mortem também sendo uma
proteína de eleição como marcadora molecular de maciez da carne.
A proteína Kinectin 1 (KNT1) está suprimida no grupo M e está envolvida na estruturação da
integrina e fibronectina no músculo estriado esquelético, proteínas estas presentes na estrutura da
linha Z do sarcômero auxiliando no complexo de adesão e estabilização desta proteína (44).
Foi identificada reprimida no grupo M a enzima Alcohol dehydrogenase class 3 (ADH3)
(Tabela 4). Esta enzima tem a função de converter álcoois a respectivos aldeídos e cetonas. O produto
desta conversão poderá ser convertido à acetil-CoA e ser metabolizado no ciclo do ácido cítrico (45).
97
10 Tabela 4 - Proteínas relacionadas ao metabolismo de carboidratos, diferentemente expressas entre os grupos macio (M) e duro (D).
Descrição Acesso# Score Relação
Macio:Duro* Função
Aconitate hydratase mitochondrial ACON_BOVIN 6093,9 0,48 Ciclo do ácido tricarboxilico
Malate dehydrogenase cytoplasmic MDHC_BOVIN 39534,6 0,50 Ciclo do ácido tricarboxilico
Citrate synthase mitochondrial CISY_BOVIN 3519,9 0,52 Ciclo do ácido tricarboxilico
Malate dehydrogenase mitochondrial MDHM_BOVIN 41957,6 0,53 Ciclo do ácido tricarboxilico
Dihydrolipoyllysine residue succinyltransferase
component of 2 oxoglutarate dehydrogenase complex m ODO2_BOVIN 1026,9 <0,01 Ciclo do ácido tricarboxilico
GLO1 protein (Lactoylglutathione lyase) A4FUZ1_BOVIN 7828,3 0,56 Composto-C e metabolismo de carboidratos
O acetyl ADP ribose deacetylase MACROD1 MACD1_BOVIN 1193,6 <0,01 Composto-C e metabolismo de carboidratos
Alcohol dehydrogenase class 3 ADHX_BOVIN 838,7 <0,01 Composto-C e metabolismo de carboidratos
Myoglobin MYG_BOVIN 92859,8 0,56 Distribuição e troca gasosa
Phosphoglycerate kinase 1 PGK1_BOVIN 145747,7 0,57 Glicólise e gliconeogênese
6 phosphofructokinase liver type K6PL_BOVIN 126,1 2,64 Glicólise e gliconeogênese
6 phosphofructokinase muscle type K6PF_BOVIN 1573,7 3,53 Glicólise e gliconeogênese
6 phosphofructokinase E1BCW3_BOVIN 209,7 >100 Glicólise e gliconeogênese
Creatine kinase B type KCRB_BOVIN 1489,2 47,47 Metabolismo da creatina
Glyceraldehyde 3 phosphate dehydrogenase testis
specific G3PT_BOVIN 3685,5 0,43
Metabolismo de açucar, glicosídeo, poliol e
carboxilato
Mannosidase, alpha, class 2C, member 1 F1MWT0_BOVIN 725,2 >100 Metabolismo de açucar, glicosídeo, poliol e
carboxilato
Glycogen starch synthase muscle GYS1_BOVIN 709,0 >100 Metabolismo de reserva de energia
Phosphorylase kinase gamma 1 Muscle Q29RI2_BOVIN 813,4 >100 Metabolismo de reserva de energia
ATP synthase subunit alpha F1MLB8_BOVIN 1187,4 0,30 Transporte de elétrons e proteína associada a
membrana
# Número de acesso no banco de dados UNIPROT.
* Razão entre a abundância relativa da proteína no grupo M pelo grupo D.
98
A enzima Dihydrolipoyllysine residue succinyltransferase component of 2 oxoglutarate
dehydrogenase complex m (RDSODO2) , Glyceraldehyde 3 phosphate dehydrogenase testis specific
(G3PT), Aconitate hydratase mitochondrial (ACONm), Citrate synthase mitochondrial (CSIm),
Malate dehydrogenase mitochondrial (MDHm) e Malate dehydrogenase cytoplasmic (MDHc) foram
identificadas suprimidas no grupo M e todas estas enzimas estão envolvidas no ciclo do ácido
tricarboxílico. Os resultados sugerirem que os animais do grupo D apresentam metabolismo
predominante oxidativo e outras proteínas interessantes encontradas suprimidas no grupo M são a
Myoglobin e a ATP synthase subunit α (ATBSα), contribuem na caracterização de músculo dos
animais do grupo D, com característica predominante oxidativa. Contrariamente a este resultado a
ATBSα foi sugerida como uma eleita como possível marcador para a característica de maciez, mas
contrariamente ao presente trabalho os autores utilizaram outro método de extração protéica que
promove a solubilização de proteínas que o presente método utilizado (46). A presença desta proteína
na fração solúvel pode estar ligada possivelmente à proteólise desta proteína.
Apesar de ser um atributo que é influenciado por várias características pré e pós abate, o tipo
do metabolismo predominante na fibra muscular pode estar relacionado à característica de maciez
onde fibras que predominam o metabolismo oxidativo estão relacionadas com carne mais dura
(47,48). Mas são controversos os resultados encontrados na literatura que suportam estas
características (49,50), atribuindo maior maciez a carne apresentando maior atividade oxidativa.
A supressão das proteínas Fatty acid binding protein heart, Prostaglandin F synthase 1,
Prostaglandin reductase 2 e a proteína Phosphoribosylaminoimidazole carboxylase
phosphoribosylaminoimidazole succinocarboxamide synthetase nos animais do grupo M, ajuda a
reforçar a característica oxidativa do músculo de animais do grupo D. A oxidação lipídica também
pode ser uma característica de células que sofreram maior stress (18).
As enzimas envolvidas na glicólise 6 phosphofructokinase (6CPK), 6 phosphofructokinase
muscle type (FKG1m) e 6 phosphofructokinase liver type (6CPKl) foram identificadas induzidas
animais do grupo M. Este resultado reforça a idéia de que a característica de predominância de fibras
glicolíticas está relacionada a maciez da carne. A característica de predominância do metabolismo
glicolítico está relacionada com a presença de menores quantidades de calpastatina, maior fragilidade
na constituição das proteínas que compõe a linha Z e maior pressão osmótica na célula muscular
favorecendo o processo da proteólise post mortem (47).
Foi evidenciada a indução da proteína Creatine kinase B type, outra proteína que corrobora com
a característica de células com predominância do metabolismo glicolítico. Fibras musculares com
predominância do metabolismo glicolítico têm, em média, diâmetro maior quando comparada com
99
fibras com metabolismo oxidativo predominante, e esta característica está relacionada com a
característica de maciez (51).
As proteínas Dihydropteridine reductase (DPR), Calpastatin (CAST), Cytosol aminopeptidase
(APSc) e Peptidyl prolyl cis trans isomerase (PEP), Aspartate aminotransferase mitochondrial
(ASTm) e citoplasmic (ASTc) peptidil prolil cis-trans isomerase (PPCTI) foram identificadas
suprimidas no grupo M (Tabela 5).
100
11 Tabela 5 - Proteínas relacionadas ao metabolismo de proteínas, diferentemente expressas entre os grupos macio (M) e duro (D).
Descrição Acesso# Score Relação
Macio:Duro* Função
Aspartate aminotransferase cytoplasmic AATC_BOVIN 21150,8 0,57 Biosintese do glutamato
Aspartate aminotransferase mitochondrial AATM_BOVIN 12146,2 0,42 Biosintese do glutamato
KBTBD10 protein A4FV78_BOVIN 2085,9 >100 Degradação proteica citoplasmática e nuclear
Adenosylhomocysteinase SAHH_BOVIN 2039,7 0,56 Degradação da homocisteina
Dihydropteridine reductase DHPR_BOVIN 2521,7 <0,01 Metabolismo da cisteina e grupo aromatico
Transitional endoplasmic reticulum ATPase TERA_BOVIN 1595,0 >100 Modificação por ubiquitinação e deubiquitinação
Calpastatin G3N2N7_BOVIN 1011,0 <0,01 Degradação de proteinas e peptideos
Prolyl endopeptidase PPCE_BOVIN 563,0 <0,01 Degradação de proteinas e peptideos
Cytosol aminopeptidase G3N0I4_BOVIN 637,5 <0,01 Processamento proteolítico
Peptidyl prolyl cis trans isomerase FKBP1A FKB1A_BOVIN 2820,9 0,54 Tradução
nuclear receptor subfamily 5, group A, member 2 F1MCM4_BOVIN 13,7 <0,01 Controle transcripcional
Phosphoribosylaminoimidazole carboxylase
phosphoribosylaminoimidazole succinocarboxamide
synthetase
Q2HJ26_BOVIN 2187,8 0,53 Anabolismo de
nucleotideo/nucleosideo/nucleobase
LIM and cysteine rich domains protein 1 LMCD1_BOVIN 987,8 <0,01 Supressor transcripcional # Número de acesso no banco de dados UNIPROT.
* Razão entre a abundância relativa da proteína no grupo M pelo grupo D.
101
Dentre os fatores que influenciam na maciez final da carne um dos principais fatores é a
proteólise post mortem de proteínas estruturais das células musculares (43,52). O sistema proteolítico
calpaína vem sido atribuído como principal no processo de proteólise post mortem (40,43,53–55) e a
calpastatina está correlacionada negativamente com a maciez em bovinos por ser o inibidor natural
das calpaínas (56–59).
A relação entre calpastatina/calpaína tem grande influência na taxa de proteólise post mortem
e a presença de uma concentração maior deste inibidor irá contribuir negativamente para a proteólise
(60).
Identificadas induzidas no grupo D as proteínas LIM domain binding 3 (DLIM3), Cysteine and
glycine rich protein 3 (PRCG3) e LIM and cysteine rich domains protein 1 (PDRC1) fazem parte de
uma família de proteínas regulatórias celulares mediando a interação protéica e o metabolismo de
ácidos nucléico (61). Bernard et al. (18) utilizando a ferramenta transcriptômica, encontraram uma
menor expressão desta proteína em animais com carne macia mas não encontraram associação direta
com os mecanismos de amaciamento da carne.
Foram identificadas suprimidas no grupo M as proteínas nuclear receptor subfamily 5, group
A, member 2 (FTN2), Sodium channel subunit beta 3 (CSβ3) (Tabela 6). possivelmente esta proteína
pode ser negativamente associada a maciez atuando na estabilização destas proteínas estruturais,
dificultando a proteólise post mortem.
102
12 Tabela 6 - Proteínas relacionadas ao metabolismo de lipídeos, ligadas ao transporte de íons, diferentemente expressas entre os grupos macio (M)
e duro (D).
Descrição Acesso* Score Relação
Macio:Duro# Função
ATP binding cassette, subfamily A (ABC1), member 13 E1BM08_BOVIN 13.7 Duro Ligação de ATP
Calsequestrin Q05JF3_BOVIN 1811.5 >100 Ligante de Ca+
Retinal dehydrogenase 1 AL1A1_BOVIN 3922.9 0,51 Não calssificada
Alpha 1B glycoprotein A1BG_BOVIN 809.4 <0,01 Não calssificada
carboxymethylenebutenolidase homolog F1N2I5_BOVIN 1588.2 0,55 Não calssificada
Lumican LUM_BOVIN 958.9 >100 Não calssificada
Sodium channel subunit beta 3 SCN3B_BOVIN 545.3 <0,01 Transporte de cations (Na, K, CA, NH4, etc)
Nuclear transport factor 2 NTF2_BOVIN 3588.3 <0,01 Transporte nuclear
Hemopexin HEMO_BOVIN 1832.0 <0,01 Transporte de íons metálicos (Cu, Fe, etc)
Serotransferrin TRFE_BOVIN 7830.0 <0,01 Transporte de íons metálicos (Cu, Fe, etc)
Fatty acid binding protein heart FABPH_BOVIN 7743.3 0,42 Metabolismo de fosfolipídeos
Prostaglandin F synthase 1 PGFS1_BOVIN 157.7 <0,01 Biosíntese de prostaglandinas
Prostaglandin reductase 2 PTGR2_BOVIN 1846.0 <0,01 Biosíntese de prostaglandinas # Número de acesso no banco de dados UNIPROT.
* Razão entre a abundância relativa da proteína no grupo M pelo grupo D.
103
Identificadas somente expressas no grupo M as proteínas Lumican (LUM), Calsequestrina
(CTRN) e Proteína KBTBD10 e mais expressas as proteínas 14-3-3 epsilon e gama. Proteína que se
liga ao Ca+ no retículo sarcoplasmático, a calsequestrina está envolvida na regulação da concentração
deste íon fundamental para a atividade das principais enzimas envolvidas na proteólise post mortem
(62). A proteína serotransferin foi idetificada induzina em animais do grupo M, ela atua na ligação e
transporte do íon Fe++ .
CONCLUSÕES
A expressão aumentada das chaperonas HSP90, αβ cristalina, HSP β1 e β6 são potenciais
marcadores para maciez da carne aos 7 dias de maturação.
A indução das proteínas relacionadas ao metabolismo glicolítico, 6 fosfofrutokinase, creatina
kinase tipo B e fosforilase kinase gamma e a supressão das proteínas ATP sintase subunidade alfa,
gliceraldeído 3 fosfato testículo específico, citrato sintase mitocondrial e malato desidrogenase são
relacionadas a baixos valores de WBSF e são candidatas a marcadores para maciez da carne assim
como a supressão da expressão da calpastatina.
A interação entre as vias metabólicas é complexa e mais estudos no intuito de identificar as
interações e as atividades enzimáticas de cada parte do metabolismo celular para tentar elucidar este
truncado complexo metabólico.
AGRADECIMENTOS
Os autores agradecem a Agropecuária Guaporé e a Empresa Brasileira de Pesquisa
Agropecuária pela oportunidade de fazer parte desta pesquisa.
CAPES por formecer a bolsa de doutorado para o primeiro autor.
Ao Laboratório de Biologia Molecular “José Salum” – ICB – UFG por viabilizar as análises
e ao Laboratório de Fisiologia da Digestão por todo apoio dado à pesquisa.
104
REFERÊNCIAS
1. ANDERSON, M. J.; LONERGAN, S. M.; LONERGAN, E. H. Miosin light chain 1 release from
myofiblillar fraction during postmortem aging is a potential indicator of proteolysis and
tenderness of beef. Meat Science. v.90, p. 345-351. 2012
2. ALVES, D. D., GOES, R. H. T. B., MANCIO, A. B. Maciez da Carne Bovina. Ciência Animal
Brasileira. v.6, n.3, p.135-149. 2005.
3. AMERICAN MEAT SCIENCE ASSOCIATION. Research guidelines for cookery, sensory
evaluation, and instrumentaltenderness measurements of meat. Chicago: American Meat
Science Association, 1995.
4. ANUALPEC 2011. Anuário da pecuária brasileira. São Paulo: FNP - 2011. 335p.
5. ASSOCIAÇÃO BRASILEIRA DAS INDÚSTRIAS EXPORTADORAS DE CARNE, Pecuária
Brasileira, 2011. Disponível em: http://www.abiec.com.br/3_pecuaria.asp. Acesso em: 05 de
novembro de 2011.
6. AVERNA, M.; STIFANESE, R.; DE TULLIO, R.; SALAMINO F.; BERTUCCIO, M.;
PONTREMOLI, S.; MELLONI, E. Proteolytic degradation of nitric oxide synthase isoforms by
calpain is modulated by the expression levels of HSP90. FEBS Journal, v.274, p.6116–6127,
2007. doi:10.1111/j.1742-4658.2007.06133.x
7. AVERNA, M.; DE TULLIO, R.; PEDRAZZI, M.; BAVESTRELLO, M.; PELLEGRINI, M.;
SALAMINO, F.; PONTREMOLI, S.; MELLONI, E. Interaction between Calpain-1 and HSP90:
New Insights into the Regulation of Localization and Activity of the Protease. Plos One, v.10.
n.1, p.1-19. 2015. e0116738. doi:10.1371/journal.pone.0116738
8. BARREIROS, A. L. B. S.; DAVID, J.M.; DAVID, J.P. Estresse oxidativo: Relação entre geração
de espécies reativas de defesa do organismo. Química Nova, v.29, n.1, p.113-123, 2006.
9. BEERE, H. M. Death versus survival: Functional interaction between the apoptotic and stress-
inducible heat shock protein pathways. Journal of Clinical Investigation, v.115, n.10, p.2633–
2639, 2005.
10. BECILA, S.; HERRERA-MENDEZ, C. H.; COULIS, G.; LABAS, R.; ASTRUC, T.; PICARD,
G.; BOUDJELLAL, A.; PELISSIER, P.; BREMAUD, L.; OUALI, A. Postmortem muscle cells
die through apoptosis. European Food Research and Technology, v.231, p.485–493, 2010. DOI
10.1007/s00217-010-1296-5
11. BERNARD, C.; CASSAR-MALEK, I.; LE CUNFF, M.; DUBROEUCQ, H.; RENAND, G.;
HOCQUETTE, J. F.New indicators of beef sensory quality revealed by expression of specific
genes. Journal of Agricultural and Food Chemistry, v.55, n.13, p.5229–5237. 2007
12. BJARNADOTTIR, S. G.; HOLLUNG, K.; HOY, M.; VEISETH-KENT, E. Proteomics changes
in the insoluble protein fraction of bovine Longíssimus dorsi muscle as a result of low voltage
electrical stimulation. Meat Science. v. 89, p. 143-149, 2011
13. BORGES, C. L.; PARENTE, J. A.; BARBOSA, M. S.; SANTANA, J. M.; BÁO, S. N.; SOUSA,
M. V.; SOARES, C.M.A. Detection of a homotetrameric structure and protein-protein
interactions of Paracoccidioides brasiliensis formamidase lead to new functional insights.
105
Federation of European Microbiological Societies, v.10, p.104-113, 2010.
DOI:10.1111/j.1567-1364.2009.00594.x
14. BOUTON, P.E.; HARRIS, P.V.; SHORTOSE, W.R. Effect of ultimate pH upon the water-
holding capacity and tenderness of mutton. Journal of Food Science, v. 36, n. 3, p. 435-439,
1971.
15. BRADFORD, M. A rapid and sensitive method for the quantification of microgram quantities of
protein utilizing the principle of protein-glye binding. Analytical Biochemistry, v. 72: p. 248-
254, 1976
16. CEÑA, P., JAIME, I., BELTRAN, J. A. AND RONCALES, P. Postmortem shortening of lamb
logissimus oxidative and glycolytic fibers. Journal of Muscle Foods v.3, p.253-260, 1992.
17. CALVO, J. H.; IGUÁCEL, L. P.; KIRINUS, J.K.; SERRANO, M.; RIPOLL, G.; CASASÚS, I.;
JOY, M.; PÉREZ-VELASCO, L.; SARTO, P.; ALBERTÍ, P.; BLANCO, M. A new single
nucleotide polymorphism in the calpastatin (CAST) gene associated with beef tenderness. Meat
Science, v.96, p.775-782, 2014. http://dx.doi.org/10.1016/j.meatsci.2013.10.003
18. CASTRO, L. M.; MAGNABOSCO, C. U.; SAINZ, R. D.; FARIA, C. U.; LOPES, F. B.
Quantitative genetic analysis for meat tenderness trait in Polled Nellore cattle. Revista Ciência
Agronômica, v. 45, n. 2, p. , abr-jun, 2014
19. CALKINS C. R.; DUTSON T.R.; SMITH G. C.; CARPENTER Z. L.; DAVIS G. W. Relationship
of fiber type composition to marbling and tenderness of bovine muscle. Journal of Food Science.
v.46, p.708-710, 1981.
20. CRUZEN, S. M., PAULINO, P. V. R., LONERGAN, S., HUFF-LONERGAN, E. Postmortem
proteolysis in three muscles from growing and mature beef cattle. Meat Science, v.96, p.854-
861, 2014. http://dx.doi.org/10.1016/j.meatsci.2013.09.021.
21. DAMON M.; WYSZYNSKA-KOTO J.; VICENT A.; HE´RAULT F.; LEBRET B. Comparison
of muscle transcriptome between pigs with divergent meat quality phenotypes identifies genes
related to muscle metabolism and structure. PLoS ONE v.7, n.3 2012. e337632012.
doi:10.1371/journal.pone.0033763
22. FRYLINCK, L.; VAN WYK, G. L.; SMITH, T.P.L.; STRYDOM, P. E.; VAN MARLE-
KÖSTER, E.; WEBB, E. C.; KOOHMARAIE, M.; SMITH, M. F. Evaluation of biochemical
parameters and genetic markers for associationwith meat tenderness in South African feedlot
cattle. Meat Science, v.83, p.657-665, 2009.
23. FU, H.; SUBRAMANIAN, R. R.; MASTERS, S. C. 14-3-3 PROTEINS: Structure, function, and
regulation. Annual Revision of Pharmacology and Toxicology, v.40, p.617–647, 2000.
24. GEESINK, G. H., KOOLMEES, P. A., VAN LAACK, H. L. J. M., SMULDERS, F. J. M.
Determinants of tenderisation in beef longissimus dorsi and triceps brachii muscles. Meat
Science, v.41, n.1, p.7–17, 1995.
25. GEESINK, G. H., KUCHAY, S., CHISHTI, A. H., & KOOHMARAIE, M. Micro-calpain
isessential for postmortem proteolysis of muscle proteins. Journal of Animal Science, v.84,
p.2834–2840, 2006.
26. GLITSCH, K. Consumer perceptions or fresh meat quality: cross-national comparison. British
Food Journal, v.102, p.177-194, 2000
106
27. GOLL, D.E.; THOMPSON,V.F,; TAYLOR, R.G.; ZALEWSKA, T. Is calpain activity regulated
by membranes and autolysis or by calcium and calpastatin?. Bioessays, v.14, p.549–556, 1992.
28. GOLL D. E.; THOMPSON V. F.; LI, H.; WEI, W.; CONG, J. The calpain system. American
Physiology Society Revision, V.83, p.731–801. 2003
29. GHOSH, J. G.; HOUCK, S. A.; CLARK, J. I. Interactive sequences in the stress protein and
molecular chaperone human alpha B crystallin recognize and modulate the assembly of filaments.
International Journal of Biochemistry & Cell Biology, v.39, n.10, p.1804-1815, 2007a.
http://dx.doi.org/10.1016/j.biocel.2007.04.027
30. GHOSH, J. G.; SHENOY JR, A. K.; CLARK, J. I. Interactions between important regulatory
proteins and human αβcrystallin. Biochemistry, v.46, n.21, p.6308-6317, 2007b. doi:
10.1021/bi700149h
31. GUILLEMIN, N.; JURIE, C.; CASSAR-MALEK, I.; HOCQUETTE, J. F.; RENAND, G.;
PICARD, B. Variations in the abundance of 24 protein biomarkers of beef tenderness according
to muscle and animal type. Animal, v.5, n.6, p.885-894, 2011.
http://dx.doi.org/10.1017/s1751731110002612
32. GUILLEMIN, N.; JURIE, C.; RENAND, G.; HOCQUETE, J.; MICOL, D.; LEPETIT, J.;
PICARD, B. Different Phenotypic and ProteomicMarkers Explain Variability of Beef Tenderness
across Muscles. International Journal of Biology, v.4, n.2, p.26-38, 2012.
doi:10.5539/ijb.v4n2p26
33. HAMILL, R. M.; MCBRYAN, J.; MCGEE, C.; MULLEN, A. M.; SWEENEY, T.; TALBOT,
A.; CAIRNS, M. T.; DAVEY, G. C. Functional analysis of muscle gene expression profiles
associated with tenderness and intramuscular fat content in pork. Meat Science, v.92, n.4, p.440–
450, (2012).
34. HAYWARD, M. D., MCADAM, N. J., JONES, J. G., EVANS, C., EVANS, G. M., FOSTER, J.
W., USTIN, A., HOSSAIN, K. G., QUARTER, B., STAMERS, M., WILL, J. K. Genetic markers
and the selection of quantitative traits in forage grasses. Euphytica, v.77 , p.269-275, 1994
35. HAUSSER A, STORZ P, LINK G, STOLL H, LIU YC. 1999. Protein kinase C mu is negatively
regulated by 14-3-3 signal transduction proteins. Journal of Biological Chemistry, v.274,
p.9258–9264, 1999
36. HOLLUNG, K.; VEISETH, E.; JIA, X.; FÆRGESTAD, E. M.; HILDRUM, K. I. Application of
proteomics to understand a molecular mechanisms behind meat quality. Meat Science. v.77, p.
97-104, 2007
37. HUFF-LONERGAN, E.; PARRISH-JR, F. C.; ROBSON, R. M. Effects of postmortem aging
time, animal age, and sex on degradation of Titin, Nebulin in bovine Longissimus muscle.
Journal of Animal Science. v. 73, p. 1064-1073, 1995.
38. HUFF-LONERGAN, E.; MITSUHASHI, T.; BEEKMAN, D. D.; PARRISH-JR, F. C.; OLSON,
D. G.; ROBSON, R. M. Proteolysis of specific muscle structural proteins by µ-calpain at low pH
and temperature is similar to degradation in postmortem bovine muscle. Journal of Animal
Science. v. 74, p. 993-1008, 1996.
39. JIA, X., HILDRUM, K. I., WESTAD, F., KUMMEN, E., AASS, L., & HOLLUNG, K. Changes
in enzymes associated with energy metabolism during the early post mortem period in
longissimus thoracis bovine muscle analyzed by proteomics. Journal of Proteome Research,
v.5, n.7, p.1763–1769, 2006.
107
40. JIA, X., VEISETH-KENT, E., GROVE, H., KUZIORA, P., AASS, L., HILDRUM, K. I., &
HOLLUNG, K. Peroxiredoxin-6-A potential protein marker for meat tenderness in bovine
longissimus thoracis muscle. Journal of Animal Science, v.87, n.7, p.2391-2399, 2009.
http://dx.doi.org/10.2527/jas.2009-1792
41. JULIÀ P.; FARRÉS J.; PARÉS X. Characterization of three isoenzymes of rat dehydrogenase.
Tissue distribution and physical and enzymes properties. European Journal of Biochemistry,
v.162., p.179-189, 1987.
42. JUSZCZUK-KUBIAK, E.; SŁONIEWSKI, K.; OPRZADEK, J.; WICIŃSKA, K.;
POŁOSZYNOWICZ, J.; ROSOCHACKI, S. The effect of polymorphisms in the intron 12 of
CAST gene on meat quality of young bulls. Animal Science Papers and Reports, v.27, n.4,
p.281–292, 2009.
43. KADRMAS, J.L.; BECKERLE, M. C. The LIM domain: From the cytoskeleton to the nucleus.
Nature, v.5, p.920-931, 2004. doi:10.1038/nrm1499
44. KOOHMARAIE, M. Biochemical factors regulating the toughening and tenderization process of
meat. Meat Science, v.43, p.193–201, 1996.
45. KOOMARAIE, M. The role of Ca (2+)-dependent proteases (calpains) in postmortem proteolysis
and meat tenderness. Biochimie. v.74: p. 239-245, 1992.
46. LAMETSCH, R.; ROEPSTORFF, P.; BENDIXEN, E. Identification of protein degradation
during postmortem storage of pig meat. Journal of Agricultural and Food Chemistry. v.50, p.
5508-5512, 2002
47. LAMETSCH, R.; ROEPSTORFF, P.; MOLLER, H. S.; BENDIXEN, E. Identification of
myofibrillar substrates for µ-calpain. Meat Science. v.68, p.515-521, 2004
48. LEE, C.S.; YI, J. S.; JUNG, S. Y.; KIM, B.W.; LEE, N.R.; CHOO, H.J.; JANG, S.Y.; HAN, J.;
CHI, S.G.; PARK, M.; LEE, J.H.; KO, Y.G. TRIM72 negatively regulates myogenesis via
targeting insulin receptor substrate-1. Cell Death and Differentiation, v.17, p.1254–1265, 2010.
doi:10.1038/cdd.2010.1
49. LIPPOLIS, J.D.; REINHARDT, T.A. Proteomics in animal science. Journal of Animal Science,
[on line] v. 86, p. 2430 - 2441, 2008. Disponível em: http://jas.fass.org/content/86/9/2430.
Acesso: 31 ago. 2011.
50. LONERGAN, E. H.; PARRISH-JR, F. C.; ROBSON, R. M. Effects of postmortem aging time,
animal age, and sex on degradation of Titin, Nebulin in bovine Longissimus muscle. Journal of
Animal Science. v. 73, p. 1064-1073, 1995.
51. LONERGAN, E. H.; MITSUHASHI, T.; BEEKMAN, D. D.; PARRISH-JR, F. C.; OLSON, D.
G.; ROBSON, R. M. Proteolysis of specific muscle structural proteins by µ-calpain at low pH
and temperature is similar to degradation in postmortem bovine muscle. Journal of Animal
Science. v. 74, p. 993-1008, 1996.
52. LONERGAN, E. H.; ZHANG, W.; LONERGAN, S. M. Biochemistry of postmortem muscle –
Lessons of mechanisms of meat tenderization. Meat Science, v. 86, p. 184-195, 2010.
53. LOWRY, O. H., ROSEBROUGH, N. J., FARR, A. L., RANDALL, R. J. Protein measurement
with the folin phenol reagent. Journal of Biological Chemistry. v.193, p.265-275, 1951
54. MAGNABOSCO, C. U., SAINZ, R. D., FARIA, C. U., YOKOO, M. J., MANICARDI, F.,
BARBOSA, V., GUEDES, C., LEME, P. L., PEREIRA, A., ARAUJO, F. C. R., SANCHES, A.
C., LOBO, R. Avaliação genética e critérios de seleção para características de carcaça em
zebuínos: relevância econômica para mercados globalizados. In: V Simpósio de Produção de
108
Gado de Corte, Anais... Viçosa, 2006. Disponível em:
http://simcorte.com/index/Palestras/5_simcorte/simcorte9.pdf
55. MAGNABOSCO, C. U.; TROVO, J. B., TORRES JUNIOR, R. A. A.; FARIA, C. U.; MARTINS,
C. F.; REGINATO, L.; FRAGOSO, R. R.; TELLES, M. P. C.; SILVA, C. C.; ARAUJO, F. R.
C.; PRADO, C. S.; SAINZ, R. D. Caracterização e seleção genética para maciez da carne em
bovinos Nelore Mocho. Projeto Macroprograma 2, Documento de Circulação Restrita, Embrapa
Cerrados, Planaltina-DF, 2009.
56. MALTIN C. A.; LOBLEY G. E.; GRANT C. M.; MILLER L. A.; KYLE D. J. HORGAN G. W.;
MATTHEWS K. R.; SINCLAIR K. D. Factors influencing beef eating quality. 2 Effects of
nutritional regimen and genotype on muscle fibre characteristics. Animal Science. v.66, p.341-
348, 2001.
57. MALTIN, C.; BALCERZAK, D.; TILLEY, R.; DELDAY, M. Determinants of meat quality:
tenderness. Proceedings of the Nutrition Society, v.62, n.2, p.337-347, 2003
http://dx.doi.org/10.1079/pns2003248
58. MORZEL, M.; TERLOUW, C.; CHAMBON, C.; MICOL, D.; PICARD, B. Muscle proteome
and meat eating qualities of Longissimus thoracis of "Blonde d'Aquitaine" young bulls: A central
role of HSP27 isoforms. Meat Science, v.78, n.3, p.297-304, 2008.
http://dx.doi.org/10.1016/j.meatsci.2007.06.016
59. NATTRASS, G. S.; CAFE, L. M.; MCINTYRE, B. L.; GARDNER, G. E.; MCGILCHRIST, P.;
ROBINSON, D. L.; WANG, Y. H.; PETHICK D. W.; GREENWOOD P. L. A post-
transcriptional mechanism regulates calpastatin expression in bovine skeletal muscle. Journal of
Animal Science, v.92, p.443-455, 2014. doi:10.2527/jas2013-6978
60. OCKERMAN H. W.; JAWOERK D.; VAN STAVERN B.; PARRET N.; PIERSON C. J.
castration and sire effects on carcase traits, meat palatability and muscle fiber characteristics in
Angus cattle. Journal of Animal Science. v.59, p.981-990, 1984.
61. OUALI, A.; TALMANT, A. Calpains and calpastatin distribution in bovine, porcineand ovine
skeletal muscles. Meat Science, v.28, n.4, p.331–348, 1990.
62. OUALI A.; HERRERA-MENDEZ C.H.; COULIS G.; BECILA SAMIRA; BOUDJELLAL A.;
HARHOURA K.; AUBRY L.; SENTANDREU M.A. Meat tenderisation and muscle cell death,
two highly related events. Tehnologija Mesa, v.48,p.1-15, 2007.
63. OUALI, A.; GAGAOUA, M.; BOUDIDA, Y.; BECILA, S.; BOULDJELLAL, A.; HERRERA-
MENDEZ, C.; SENTANDREU, M. A. Biomarkers of meat tenderness: Present knowledge and
perspectivesin regards toour current understanding of the mechanisms involved. Meat science,
v.95, p.854-870, 2010. http://dx.doi.org/10.1016/j.meatsci.2013.05.010
64. PAPPA, A., BROWN, D., KOUTALOS, Y., DEGREGORI, J., WHITE, C., & VASILIOU, V.
Human aldehyde dehydrogenase 3A1 inhibits proliferation and promotes survival of human
corneal epithelial cells. Journal of Biological Chemistry, v.280, n.30, p.27998–28006, 2005.
65. PICARD, B., BERRI, C., LEFAUCHEUR, L., MOLETTE, C., SAYD, T., & TERLOUW, C.
Skeletal muscle proteomics in livestock production. Briefings in Functional Genomics, v.9, n.3,
p.259-278, 2010. http://dx.doi.org/10.1093/bfgp/elq005
66. ROANAS, C. R., & LOYLAND, S. M. Capabilities using 2-D DIGE in proteomics research.
Tissue Proteomics. Totowa, Human press. p.1-18 2008.
109
67. SAINZ, R. D., MAGNABOSCO, C. U., MANICARDIF. R., ARAÚJO, F. R. C., PEREIRA A.
S. C., GUEDES, C. F., MARGARIDO, R. C. C., LEME, P. R., LUCHIARI FILHO, A. Growth
performance, carcass and meat quality in progênie of Nellore, Angus and Brahman bulls and
Nelore cows. Journal of Animal Science, Champaign, v.84, p1-31, 2008.
68. SHACKELFORD, S. D.; KOOHMARAIE, M.; CUNDIFF, L. V.; GREGORY, K. E.; ROHNER,
G. A.; SAVELL, J. W.Heritabilities andphenotypic and genetic correlations for bovine
postrigorcalpastatin activity, intramuscular fat content, Warner-Bratzler shear force, retail
product yield, and growth rate. Journal of Animal Science, v.72, p.857-863, 1994.
69. SILVA E SILVA, A.M.; CORRÊA, G.C.; REIS, E.M. Proteômica – Uma abordagem funcional
do estudo do Genoma. Saúde e Ambiente em Revista, Duque de Caxias, V2, N2, p- 1 - 10, 2007
70. SUZUKI, Y.; ALI, M.; FISCHER, M; RIEMER, J. Human copper chaperone for superoxide
dismutase 1 mediates its own oxidation-dependent import into mitochondria. Nature
Communications, n.4, p.1-9, 2013. DOI: 10.1038/ncomms3430
71. UOTILA L.; KOIVUSALO M. Formaldehyde dehydrogenase from human liver: Purification,
properties and evidence for the formation of glutathione thiol esters by the enzyme. The Journal
of Biological Chemistry, n.249, v.23, p.7653-7663, 1974.
72. TRAN H.; PANKOV R.; TRAN S. D.; HAMPTON B.; BURGESS W. H.; YAMADA K. M.
Integrin clustering induces kinectin accumulation. Journal of Cell Science, n. 115, p. 2031-2040,
2002.
73. WANG, X.; LI, X.; LI, Y. A modified coomassie brilliant blue staining method at nanogram
sensitivity compatible with proteomics analysis. Biotechnology Letter, n. 29, p. 1599-1603,
2007.
74. WATSON, R., GEE, A., POLKINGHORNE, R., PORTER, M. Consumer assessment of eating
quality - Development of protocols for Meat Standards Australia (MSA) testing. Australian
Journal of Experimental Agriculture, 48(11), 1360−1367, 2008
75. WILKINS, M.R.; APPEL, R.D.; WILLIAMS, K.L.; HOCHSTRASSER, D.F. Proteome
Research: Concepts, Technology and Application. New York Press, 2008. 243p.
110
Anexos
Anexo 1 – Géis de poliacrilamida 12,5% para verificação do perfil de bandas da amostra e
confirmação da quantificação protéica corados por comassie. Os números representam as amostras
carregadas em cada poço, de acordo com o anexo 2.
Anexo 2 – Valores de força de cisalhamento (WBSF-7), grupo
Numero
Amostra
WBSF-
7 valores Grupo
Concentração de
proteína após a
extração (mg/mL)
1 1.38 1.38 M 26,6
2 6.11 6.11 D 22,0
3 1.26 1.26 M 27,4
4 6.71 6.71 D 44,2
5 1.24 1.24 M 39,5
6 5.18 5.18 D 47, 7
7 1.17 1.17 M 21,9
8 5.05 5.05 D 31,7
9 1.23 1.23 M 35,1
10 5.61 5.61 D 27,8
11 1.33 1.33 M 24,5
12 6.47 6.47 D 27,3
13 1.09 1.09 M 33,6
14 5.72 5.72 D 26,9
15 1.32 1.32 M 25,8
16 5.49 5.49 D 32,8
17 1.28 1.28 M 32,8
18 5.91 5.91 D 24,1
19 1.07 1.07 M 29,3
20 5.26 5.26 D 32,3
111
Anexo 3 – Proteínas identificadas nos grupos induzidas ou suprimidas com menos de 50% de diferença.
Descrição Acesso# Score Relação
Macio:Duro* Função
Trans 1 2 dihydrobenzene 1 2 diol dehydrogenase DHDH_BOVIN 1326.8 0,677 Metabolismo de compostos aromáticos
Phosphatidylethanolamine binding protein 1 PEBP1_BOVIN 51860.6 0,613 Ligante de ATP
Carbonic anhydrase 3 CAH3_BOVIN 88390.0 0,644 Metabolismo de compostos C-1
GPD1L protein A6QQR7_BOVIN 152.0 0,613 Metabolismo de compostos C-3
Glycerol 3 phosphate dehydrogenase NAD cytoplasmic GPDA_BOVIN 24921.8 0,613 Metabolismo de compostos C-3
ATPase, Ca++ transporting, cardiac muscle, slow
twitch 2 F1MPR3_BOVIN 2813.7 0,932 Transporte de cátions (Na, K, CA, NH4, etc)
Sarcoplasmic endoplasmic reticulum calcium ATPase 1 AT2A1_BOVIN 4633.1 1,000 Transporte de cátions (Na, K, CA, NH4, etc)
ATPase, Ca++ transporting, ubiquitous E1BMQ6_BOVIN 1485.9 1,246 Transporte de cátions (Na, K, CA, NH4, etc)
Aldehyde dehydrogenase mitochondrial ALDH2_BOVIN 1896.3 0,613 Composto-C e metabolismo de carboidratos
Protein NDRG2 F1MTZ1_BOVIN 1120.8 0,795 Reorganização do citoesqueleto dependente
do ciclo celular
PDZ and LIM domain protein 3 PDLI3_BOVIN 2833.9 1,020 Reorganização do citoesqueleto dependente
do ciclo celular
Myosin regulatory light chain 2 skeletal muscle
isoform MLRS_BOVIN 3833.0 0,684 citoesqueleto / proteína estrutural
Actin gamma enteric smooth muscle ACTH_BOVIN 3087.3 0,691 citoesqueleto / proteína estrutural
Tropomyosin beta chain TPM2_BOVIN 7428.9 0,741 citoesqueleto / proteína estrutural
Tropomyosin alpha 3 chain TPM3_BOVIN 2226.4 0,980 citoesqueleto / proteína estrutural
Tropomyosin alpha 1 chain Fragment G3X7S7_BOVIN 4846.7 1,150 citoesqueleto / proteína estrutural
Adenylate kinase isoenzyme 1 KAD1_BOVIN 64903.1 0,726 Conversão e regeneração de energia
Triosephosphate isomerase TPIS_BOVIN 117112.1 0,600 Glicólise e gliconeogênese
Phosphoglycerate kinase G3X7N4_BOVIN 106349.3 0,619 Glicólise e gliconeogênese
Fructose 1 6 bisphosphatase isozyme 2 F16P2_BOVIN 6511.3 0,664 Glicólise e gliconeogênese
Glucose 6 phosphate isomerase G6PI_BOVIN 30635.3 0,664 Glicólise e gliconeogênese
Phosphoglycerate mutase 2 F1N2F2_BOVIN 96861.5 0,670 Glicólise e gliconeogênese
Phosphoglycerate mutase 2 PGAM2_BOVIN 96861.5 0,670 Glicólise e gliconeogênese
112
ENO2 protein A6QR19_BOVIN 17506.5 0,691 Glicólise e gliconeogênese
Alpha enolase ENOA_BOVIN 31283.7 0,691 Glicólise e gliconeogênese
Alpha enolase F1MB08_BOVIN 31283.7 0,691 Glicólise e gliconeogênese
Pyruvate kinase Q1JPG7_BOVIN 5700.9 0,705 Glicólise e gliconeogênese
Pyruvate kinase A5D984_BOVIN 87758.4 0,712 Glicólise e gliconeogênese
Beta enolase ENOB_BOVIN 80172.3 0,795 Glicólise e gliconeogênese
Fructose bisphosphate aldolase A6QLL8_BOVIN 123550.6 0,819 Glicólise e gliconeogênese
Fructose bisphosphate aldolase Q3ZBY4_BOVIN 36419.4 0,835 Glicólise e gliconeogênese
heat shock 70kDa protein 6 (HSP70B') F1MWU9_BOVIN 2678.8 0,684 Resposta ao choque térmico
Heat shock related 70 kDa protein 2 HSP72_BOVIN 3006.6 0,684 Resposta ao choque térmico
Heat shock cognate 71 kDa protein HSP7C_BOVIN 7157.0 0,733 Resposta ao choque térmico
Heat shock 70 kDa protein 1B HS71B_BOVIN 12687.0 0,741 Resposta ao choque térmico
Heat shock 70 kDa protein 1A HS71A_BOVIN 8119.3 0,748 Resposta ao choque térmico
Heat shock 70 kDa protein 1 like HS71L_BOVIN 5324.4 0,756 Resposta ao choque térmico
Heat shock protein HSP 90 alpha HS90A_BOVIN 2420.0 0,914 Resposta ao choque térmico
Creatine kinase M type KCRM_BOVIN 81831.2 0,905 Metabolismo da creatina
Creatine kinase S type mitochondrial F1MJT6_BOVIN 1985.4 0,990 Metabolismo da creatina
Creatine kinase S type mitochondrial KCRS_BOVIN 1985.4 1,162 Metabolismo da creatina
Glycogenin 1 F6QLM5_BOVIN 3199.7 0,619 Metabolismo de reserva de energia
Amylo-alpha-1, 6-glucosidase, 4-alpha-
glucanotransferase F1MHT1_BOVIN 4838.6 0,712 Metabolismo de reserva de energia
Glycogen phosphorylase muscle form PHS2_RABIT 45622.7 0,914 Metabolismo de reserva de energia
Glycogen phosphorylase liver form PYGL_BOVIN 8552.9 0,923 Metabolismo de reserva de energia
Glycogen phosphorylase brain form PYGB_BOVIN 15009.1 0,932 Metabolismo de reserva de energia
Phosphorylase F1MJ28_BOVIN 63620.7 0,942 Metabolismo de reserva de energia
Probable C U editing enzyme APOBEC 2 ABEC2_BOVIN 2150.2 0,691 Processamento do mRNA (splicing, 5'- 3'-
final processamento)
Mitochondrial peptide methionine sulfoxide reductase MSRA_BOVIN 13198.5 0,607 Detoxificação de radicais de oxigênio
Glutathione S-transferase mu 3 (brain) F1MUX6_BOVIN 2201.5 0,619 Detoxificação de radicais de oxigênio
Peroxiredoxin 6 PRDX6_BOVIN 21869.7 0,625 Detoxificação de radicais de oxigênio
113
Glutathione S transferase Mu 1 GSTM1_BOVIN 7112.1 0,670 Detoxificação de radicais de oxigênio
GSTM1 protein A4IFG0_BOVIN 2366.8 0,705 Detoxificação de radicais de oxigênio
Ubiquitin 60S ribosomal protein L40 RL40_BOVIN 19072.8 0,691 Anabolismo de proteínas
Prolyl endopeptidase Fragment F6QHN4_BOVIN 582.0 0,803 Degradação de proteína/ Peptídeo
Purine nucleoside phosphorylase PNPH_BOVIN 2291.9 0,638 Metabolismo de
nucleotideo/nucleosideo/nucleobase
Adenylosuccinate synthetase isozyme 1 PURA1_BOVIN 4594.3 0,607 Anabolismo de
nucleotideo/nucleosideo/nucleobase
Bifunctional purine biosynthesis protein PURH PUR9_BOVIN 1197.9 0,698 Anabolismo de
nucleotideo/nucleosideo/nucleobase
UTP glucose 1 phosphate uridylyltransferase UGPA_BOVIN 2264.4 0,726 Metabolismo de pirimidinae
nucleotideo/nucleosideo/nucleobase
Pyruvate dehydrogenase E1 component subunit alpha
somatic form mitochondrial ODPA_BOVIN 2187.6 0,657 Complexo da piruvato desidrgenase
Pyruvate dehydrogenase E1 component subunit beta
mitochondrial ODPB_BOVIN 2209.1 0,741 Complexo da piruvato desidrgenase
Stress induced phosphoprotein 1 STIP1_BOVIN 1030.5 0,607 Resposta ao estresse
Thioredoxin Fragment G8JKZ8_BOVIN 7535.2 0,664 Resposta ao estresse
Phosphoglucomutase 1 PGM1_BOVIN 79723.9 0,644 Metabolismo de açucar, glicosídeo, poliol e
carboxilato
Glyceraldehyde 3 phosphate dehydrogenase G3P_BOVIN 50248.8 0,741 Metabolismo de açucar, glicosídeo, poliol e
carboxilato
Elongation factor 1 alpha 2 EF1A2_BOVIN 5433.7 0,719 Elogação na translação
Serum albumin ALBU_BOVIN 48995.6 0,589 Transporte de Metais(Cu, Fe, etc)
Isocitrate dehydrogenase NADP mitochondrial IDHP_BOVIN 3654.9 0,595 Ciclo do ácido tricarboxilico
L lactate dehydrogenase B chain LDHB_BOVIN 25425.3 0,619 Ciclo do ácido tricarboxilico
Succinyl CoA ligase ADP GDP forming subunit alpha
mitochondrial F1MZ38_BOVIN 1290.3 0,631 Ciclo do ácido tricarboxilico
L lactate dehydrogenase A chain LDHA_BOVIN 112711.9 0,712 Ciclo do ácido tricarboxilico
Uncharacterized protein G3N3C9_BOVIN 2237.9 0,719 Não classificada
Bridging integrator Q2KJ23_BOVIN 6227.8 0,811 Não classificada
114
# Número de acesso no banco de dados UNIPROT.
* Razão entre a abundância relativa da proteína no grupo M pelo grupo D.
115
CAPITULO 5 – Considerações finais
Os fatores que regulam o processo de amaciamento da carne no período post mortem são
complexos e sofrem influência de muitos fatores intrínsecos e extrínsecos, tornando mais desafiador
compreender os mecanismos chave deste processo mas alguns pontos relativos ao animal podem ser
apontados como promissores determinantes para se conseguir produzir carne mais macia.
Um dos pontos é a avaliação da expressão das chaperonas HSP90, αβ cristalina, HSP β1 e β6 e
relacionadas com o proteínas metabolismo glicolítico positivamente relacionadas com a maciez.
Negativamente relacionadas característica maciez da carne as proteínas envolvidas estão ligadas ao
metabolismo oxidativo celular.
O sistema calpaína tem grande destaque na proteólise post mortem e dentro deste sistema, a
calpastatina é um dos principais fatores que irão determinar a taxa e a extensão desta proteólise. Os
fatores que regulam a ação da calpastatina ainda não estão claros necessitando ainda de mais
pesquisas para entender melhor como é regulada .
O campo do metabolismo ainda é pouco conhecido necessitando assim mais trabalhos para de
entender as interações este complexo sistema.