Upload
others
View
5
Download
0
Embed Size (px)
Citation preview
Unrivaled Performance and Flexibility
LTQ Orbitrap XL™
Hybrid FT Mass Spectrometer
Part of Thermo Fisher Scientific
m a s s s p e c t r o m e t r y
LTQ O
rbitrap XL
OFFERING OUTSTANDING MASS ACCURACY, RESOLVING POWER, DYNAMIC RANGE, AND HIGH SENSITIVITY
The hybrid FT mass spectrometer combines a linear ion trapMS and the Orbitrap mass analyzer. Ions generated by APIare collected in the LTQ XL followed by axial ejection to theC-shaped storage trap which is used to store and collisionallycool ions before injection into the orbital trap. The ionstransferred from the C-Trap are captured in the orbital trapby rapidly increasing the electric field and the detection ofthe image current from coherent ion packets takes placeafter the voltages have stabilized. Signals from each of theorbital trap outer electrodes are amplified and transformedinto a frequency spectrum by fast Fourier transformationwhich is finally converted into a mass spectrum.
Additionally, the LTQ Orbitrap XL features a new collision cell to provide additional flexibility to any MS/MSexperiment. Ions can be selected in the linear ion trap andfragmented either in the ion trap (CID) or in the new collisioncell (HCD). For HCD (Higher Energy Collisional Dissociation)ions are passed through the C-trap into the gas-filled collision cell. Normalized Collision Energy in HCD MS/MSexperiments provides reproducible data from instrument to instrument.
LTQ ORBITRAP XL – UNRIVALED PERFORMANCE AND FLEXIBILITY• Features the new HCD (Higher Energy Collisional Dissociation)
collision cell for ultimate flexibility in fragmentation experimentsfor advanced proteomics and small molecule research
• Future upgrades will include ETD (Electron Transfer Dissociation)and MALDI capabilities
Based on the fast and highly sensitive Thermo Scientific LTQ XL™ linear ion trapand the patented Orbitrap™ technology, the LTQ Orbitrap XL hybrid FTMS(Fourier Transform Mass Spectrometer) supports a wide range of applications from routine compound identification to the most challenging analysis of low level components in complex mixtures.
The LTQ Orbitrap™ received theR&D 100 Award in 2006 and thePITTCON Editor’s Gold Award atPITTCON 2006.
PRINCIPLE OF OPERATION
Schematic of the LTQ Orbitrap XL.
API Ion Source LTQ XL Linear Ion Trap C-Trap HCD Collision Cell
Orbitrap Mass Analyzer
THE MOST CONFIDENT PROTEIN IDENTIFICATION
The analysis of complex protein mixtures is one of the most challengingtasks in the area of proteomics. The key requirements of mass spectrometrybased methods are a wide dynamic range, outstanding mass accuracy, fast cycle times for MS/MS experiments, and high sensitivity. The LTQOrbitrap XL meets all of these requirements and provides the most confidentprotein identification.
Experimental Method • E. coli total digest (500 ng)• Online nano LC-MS and MS/MS • Optimized productivity with parallel detection • Orbitrap mass analyzer full scan with Ion Trap
Top 7 Data Dependent™ MS/MS • Dynamic exclusion
THE LTQ ORBITRAP XL PROVIDES: • Superior mass accuracy for lower false positive rates
• High sensitivity and dynamic range leading to more protein ID
• Parallel acquisition mode for optimized productivity
• Excellent MS/MS sensitivity
Comparison of the proteinidentification results (MASCOT)between the LTQ Orbitrap XLand latest Q-TOF technology.
Orbitrap mass analyzer full scan MS at RT 89.4 min with zoom-in.
BioWorks™ result of the database search showing the confident peptide identification.
Base peak chromatogram of E. coli total enzymatic digest.
LTQ O
rbitrap XL
FROM PROTEIN ID TO BIOMARKER DISCOVERY
An important aspect of proteomics is not only the identification of all proteinsin complex biological samples but also the accurate determination of their relative concentrations. Several analytical approaches to protein quantitationhave been developed, including isotopic labeling techniques such as iTRAQ™.This method relies on the measurement of specific reporter ions in the low m/zregion of MS/MS spectra of target peptides. The new HCD collision cell of theLTQ Orbitrap XL is ideally suited to perform such experiments with excellentsensitivity and signal-to-noise ratio (S/N) for the reporter ions and the fragmentions of the peptide sequence.
Experimental Method• Mouse cell line• iTRAQ labeled• Online nano LC-MS and MS/MS• Orbitrap mass analyzer full scan
at R = 30,000• Data Dependent Top 3 MS/MS
using HCD • Dynamic exclusion
THE LTQ ORBITRAP XLWITH NEW HCD COLLISION CELL PROVIDES:• Excellent sensitivity and fragmentation efficiency
• Reliable identification and quantitation in one experiment
• More confidence in biomarker research
HCD spectrum for FSALESQLQDTQELLQEENR (MYH9_MOUSE, Myosin-9) in mouse cell line digestderivatized with four iTRAQ reagents.*
iTRAQ reporter ions.
Base peak chromatogram of nano LC-MS and MS/MS analysis.*
* The isotopically labeled (iTRAQ) proteindigest sample was provided by JarrodMarto, Ph.D. and Yi Zhang, Ph.D., BLAIS Proteomics Center Boston, MA USA
HIGH QUALITY DATA FOR RELIABLE DE NOVO SEQUENCING
While the extensive use of large-scale genomic sequencing has greatly simplified the task of identifying peptides and proteins by mass spectrometry,the use of de novo sequencing is still required in proteomics research.
BASED ON ULTIMATE PERFORMANCETHE LTQ ORBITRAP XL PROVIDES:• Superior mass accuracy and high resolution leading to
confident de novo sequencing results
• Multiple collision modes (CID and HCD) for comprehensive structural information
Spectrum of precursor ion with excellent mass accuracy.
PEAKS™ view MS/MS of 1086.5445 (YGASAGNVGDEGGVAPNIQTAEEALDLIVDAIK).
Zoom-In on low mass range showing detectedimmonium ions.
Experimental Method• Enzymatic enolase digest• Online nano LC-MS and MS/MS • Orbitrap mass analyzer full scan at R = 60,000• Data Dependent Top 3 MS/MS using HCD • Dynamic exclusion
Zoom-in on low mass range showing detected immonium ions.
LTQ O
rbitrap XL
CONFIDENT METABOLITE PROFILING AND IDENTIFICATION
The characterization of metabolites plays an important role in drug development.Studies performed in vivo and in vitro lead to very complex mixtures containingthe biological matrix background, the parent drug and all of the metabolites overa wide concentration range. Based on the selectivity, sensitivity, and speed ofanalysis, liquid chromatography tandem mass spectrometry has become themethod of choice for metabolite profiling and identification.
Experimental Method• Clozapine in vitro incubation • Online LC-MS and MSn using CID and HCD• Orbitrap mass analyzer full scan • Isotopic pattern triggered MS/MS • Dynamic exclusion
BASED ON ULTIMATE PERFORMANCETHE LTQ ORBITRAP XL PROVIDES:• Automated workflows using MetWorks™ and Mass Frontier™ for
structural elucidation
• Reliable metabolite profiling and identification based on accurate mass
• Improved confidence by MSn spectral tree fingerprints to distinguisheven isobaric compounds
Structural elucidation based on the unique MSn capability of the LTQ Orbitrap XL.
Automated identificationof expected metabolitesbased on accurate mass
using MetWorks.
Proposed fragmentation pathway of m/z 270 according to Mass Frontier.
CONFIDENT CHARACTERIZATION OF METABOLOMIC PROFILES
The goals of metabolomics studies are to compare the abundance of the smallmolecule metabolites in highly complex matrices such as body fluids and tissues. The greatest challenges are the detection of low abundance metabolitesamidst a vast background of unchanged metabolites and to confidently identify their structure.
Experimental Design• In vivo drug treatment of rats• Controls: untreated day one rat urine • Samples: drug treated day one rat urine • Orbitrap mass analyzer full scan • SIEVE and Spotfire® used to display
metabolites that demonstrate statistically significant differences
2-Dimensional scatter plot showing over- and under-expressiongenerated by Spotfire.
Zoom into SIEVE frame
THE LTQ ORBITRAP XL WITH NEW HCDCOLLISION CELL PROVIDES: • Outstanding mass accuracy, sensitivity, and dynamic range for
metabolic profiling
• Confident determination of the identity and structure of metabolites
• Determination of differentially expressed metabolites using SIEVE™
in conjunction with Mass Frontier
Detailed information of over-expressed metabolites.
Power
230 Vac ±10% 3 phase, 16 Amps,50/60 Hz, with earth ground forthe instrument
120 or 230 Vac single phase withearth ground for the data system
120 or 230 Vac single phase, 15 Amps,with earth ground for the water chiller
Gas
One high purity (99.5% pure, flowrate 15 L/min) nitrogen gas supplyfor the API source
One ultra high-purity helium gassupply (99.998%) with less than1 ppm each of water, oxygen,and total hydrocarbons for thelinear ion trap
EnvironmentSystem averages 2800 W(10,000 Btu/hr) output whenconsidering air conditioning needs
Operating environment must be15-26 °C (59-78 °F) and relativehumidity must be 40-70% withno condensation
Optimum operating temperatureis 18-21 °C (65-70 °F)
Weight
~600 kg
Dimensions
141.4 × 87 × 146.3 cm(H × W × D)
Installation Requirements
BR30135_E 06/07M
©2007 Thermo Fisher Scientific Inc. All rights reserved.iTRAQ is a trademark of Applera Corporation. MassFrontier is a trademark of HighChem, Ltd. PEAKS is atrademark of Bioinformatics Solutions, Inc. Spotfire is aregistered trademark of Spotfire, Inc. SEQUEST is a registered trademark of the University of Washington.All other trademarks are the property of Thermo FisherScientific Inc. and its subsidiaries.
Specifications, terms and pricing are subject to change.Not all products are available in all countries. Pleaseconsult your local sales representative for details.
In addition to these offices, ThermoFisher Scientific maintains a network of representative organizationsthroughout the world.
Australia+61 2 8844 9500 • [email protected]
Austria+43 1 333 50340 • [email protected]
Belgium+32 2 482 30 30 • [email protected]
Canada+1 800 532 4752 • [email protected]
China+86 10 5850 3588 • [email protected]
Denmark+45 70 23 62 60 • [email protected]
France+33 1 60 92 48 00 • [email protected]
Germany+49 6103 408 1014 • [email protected]
India+91 22 6742 9434 • [email protected]
Italy+39 02 950 591 • [email protected]
Japan+81 45 453 9100 • [email protected]
Latin America+1 608 276 5659 • [email protected]
Netherlands+31 76 587 98 88 • [email protected]
South Africa+27 11 570 1840 • [email protected]
Spain+34 91 657 4930 • [email protected]
Sweden / Norway / Finland+46 8 556 468 00 • [email protected]
Switzerland+41 61 48784 00 • [email protected]
UK+44 1442 233555 • [email protected]
USA+1 800 532 4752 • [email protected]
www.thermo.com
Xcalibur™ data systemStable operating platformXcalibur is the versatile, easy-to-usedata system that controls all ThermoScientific MS systems. Xcalibur’sHome Page offers easy navigationthrough the process of instrumentsetup, sequence setup, and dataacquisition. The XReport reportingpackage simplifies custom reportingwith drag-and-drop functionality.
ProteinCalculatorProteinCalculator performs in silicodigestion. Specify peptide sequencesor import them from a fasta database,select post-translational modificationsfrom a list or edit novel PTMs, thendigest them with an enzyme of yourchoosing. The proteolytic fragmentspectra can be saved as RAW datafiles for comparison with acquiredspectra.
XtractXtract deconvolutes isotopicallyresolved data, simplifying complexMS/MS spectra acquired in top-down, intact protein analysis.Specify the mass range, massresolution, and S/N criteria fordeconvolution and display in one offour modes: monoisotopic masses,isotopic pattern, or approved ordisapproved signals. The resultscan be exported as RAW or ASCIIfile formats.
BioWorks protein identification softwareConfident protein ID featuringthe SEQUEST® algorithmBioWorks utilizes the SEQUESTsearch algorithm to automaticallyidentify proteins by comparingexperimental tandem massspectrometry (MS/MS) data withspectra created from standardprotein and DNA databases.
MetWorks drug metabolismsoftwareSimplify the interpretation of complexmetabolism dataMetWorks simultaneously searchesmultiple modifications of one or moreparent drugs and interprets simple tocomplex isotope patterns, or unex-pected or low abundance metabolites.
Mass Frontier spectralelucidation softwareTurning mass spectral data into resultsMass Frontier contains a state-of-the-art database and predictivefragmentation module which allowsyou to easily interrogate and assignthe structure of your compounds.
SIEVE differential expression softwareAnalysis of differential expressionbased on comparison of LC-MSn
datasets SIEVE software provides label-free,semi-quantitative differentialexpression analysis of proteins,peptides, or metabolites from thecomparison of multiple LC-MS datasets. It is a statistically rigorous toolfor analyzing data from metabolismor biomarker discovery experiments.
Thermo Electron (Bremen)GmbH is certified DIN ENISO 2001:9000
Thermo Fisher Scientific,San Jose, CA USAis ISO Certified.
THERMO SCIENTIFIC APPLICATION-SPECIFICSOFTWARE–TURNING DATA INTO INFORMATION