Upload
jchowjs
View
364
Download
0
Embed Size (px)
Citation preview
Adobe InDesign CS5.5 Reviewer’s Guide
Create dynamic, accessible documents that deliver revolutionary reading experiences on the web, e-readers, tablets, and desktops. Take advantage of productivity enhancements in Adobe InDesign CS5.5 software, whether you’re designing for print, mobile devices, online publication—or all of the above.
With InDesign CS5.5, your documents can reach and engage audiences in new and exciting ways. The new Folio Producer tools let you create interactive content in InDesign for publication to tablet devices with the Adobe Digital Publishing Suite hosted solution.* EPUB export† enhancements help you create stunning eBooks more effectively—and more efficiently—than ever before. It’s also easier to create Adobe PDF documents that are accessible to people with disabilities. And no matter how your designs will be viewed, InDesign CS5.5 includes timesaving features that can make page layout faster and easier.
Develop stronger, more compelling messages with rich interactive documents for viewing on a tablet, smartphone, or computer. With InDesign CS5.5, you can create an attractive eBook, with greater control of content and typography. New productivity features—including linked stories and the Articles panel—help make page layout simpler and smoother. For example, if you’ve ever wrestled with anchored objects, you’ll appreciate the simplified process for that common layout task.
This Reviewer’s Guide provides a hands-on tour of the most important and powerful new features in Adobe InDesign CS5.5. Here is an overview:
Folio Producer toolsPart 1: Create interactive overlays—Use the Folio Producer tools to add interactive overlays to your page layouts, including 360-degree views of objects, panoramas, slide shows, HTML content pulled from websites, and scroll-and-pan image windows. Interactive overlays are supported only in the .folio format used by Adobe Digital Publishing Suite.* (Page 3)
Part 2: Save a .folio file—Use the Folio Builder panel to create a new .folio file for use with Digital Publishing Suite.* (Page 7)
Part 3: Preview a .folio file—See how your interactive overlays and the entire publication will appear on tablets with Content Viewer for Desktop. (Page 9)
Layout and EPUB featuresPart 4: Set images to resize automatically in eBooks—Maintain the image’s relationship to the page width on virtually any screen size. You can control other ways an image displays in eBooks, too. (Page 11)
Part 5: Link stories—If you’re using the same text in multiple places in a document, link the stories so you can update them all at once, reducing editing time and increasing consistency. (Page 12)
Adobe® InDesign® CS5.5Design professional page layouts for print and digital publishing
Adobe InDesign CS5.5 is also available as a component of:•AdobeCreativeSuite®5.5DesignStandard
•AdobeCreativeSuite5.5DesignPremium
•AdobeCreativeSuite5.5MasterCollection
Subscription option
Getthesameproductwithlowmonthlypayments.Visitwww.adobe.com/go/cssubscriptiontolearnmore.
*AdobeDigitalPublishingSuiterequiresaseparatelicenseandpaymentofassociatedfee(s).Seewww.adobe.com/products/ digitalpublishingsuiteformoreinformation.
†InDesignusesEPUB3andHTML5codetocreateeBookswithaudio,video,andotheradvancedfeatures.EPUB3andHTML5presentation,mediaplayback,anddouble-bytecharactersupport(e.g.,Chinese,Japanese,Korean)maynotbesupportedbyalldevices,brows-ersorEPUBreaders.
2Adobe InDesign CS5.5 Reviewer’s Guide
Part 6: Map styles to tags†—Ensure eBook readers and web browsers display text as you intend in exported EPUB and HTML files by mapping paragraph and character styles to the appropriate tags. You can also map paragraph styles to PDF tags to communicate your intent for accessible PDF files. (Page 14)
Part 7: Embed video and audio†—Add another dimension to eBooks with embedded video and audio, which can be played in eBook reader applications that support HTML5 and EPUB 3 standards, such as Apple iBooks. (Page 15)
Part 8: Drag and drop anchored objects—Quickly anchor objects so that they reflow with the related text. The new drag-and-drop process makes anchoring objects much simpler than before. (Page 16)
Part 9: Organize content using the Articles panel—Decide which page items to include and what order they should appear in when you export eBooks, HTML files, or accessible PDF files. You can arrange stories, graphics, and images in the new Articles panel. (Page 17)
Part 10: Export an EPUB document—Take advantage of all the enhancements in EPUB export, from the ability to keep footnotes near related text to support for headers and footers in tables. You have much greater control over the look and feel of your eBooks with the new EPUB export options. (Page 19)
Accessible PDFPart 11: Include alternate (alt) text—Alt text is used by screen readers to describe images for people with disabilities. Now you can include alt text in PDF documents you export from InDesign much more efficiently. (Page 21)
Part 12: Organize content for the PDF file—The Articles panel and the ability to map styles to tags aren’t just for eBook creation. They help you make your PDF files more accessible, too. (Page 22)
Before you beginPlease do the following before starting this tour:
• MakesureyouhaveAdobeInDesignCS5.5andAdobeAcrobat®Xsoftwareinstalled.Ifyoudonothaveacopyofthesoftware,pleasecontactAdobePublicRelations.
• InInDesign,chooseWindow>Extensions>FolioBuilderPanel.
• MakesureyouhaveanAppleiPadavailable.IfyouneedtoborrowaniPad,pleasecontactAdobePublic Relations.
• MakesurethatAppleiTunesisinstalledonyourcomputer.ToinstallthefreeiTunesapplication,visit www.apple.com.
• DownloadInDesign_CS55_RG_Assets.zipfromthepresswebsiteatwww.adobe.com/aboutadobe/pressroom/cs5.Afterdownloading,extractthecontentsofthefiletoyourlocalharddrive.ThisgivesyouafoldernamedInDesign_CS55_RG_Assets,whichincludesthefilesyou’llneed to complete the exercises in this guide.
• IfyouhavepreviouslyinstalledandworkedwithInDesign,youmaywanttorestoreallprefer-ences and default settings before beginning this tour. To do so, launch InDesign CS5.5 while pressingCommand+Shift+Option+Control(MacOS)orCtrl+Shift+Alt(Windows),andthenclickYes when prompted.
• Foroptimumviewing,increasedisplayqualityinInDesign:
1. ChooseInDesign>Preferences>DisplayPerformance(MacOS)orEdit>Preferences>Display Performance (Windows) to open the Display Performance pane of the Prefer-ences dialog box.
2. From the Default View menu, choose High Quality.
Top new features•FolioProducertools(Page#)
•EPUBexportenhancements(Page#)
•Articlespanel(Page#)
•Dynamicimageresizing(Page#)
•Stylesmappedtotags(Page#)
•EmbeddedvideoandaudioineBooks(Page#)
•Linkedtext(Page#)
•Drag-and-dropanchoredobjects(Page#)
•PDFaccessibilityenhancements(Page#)
What’s new in CS5.5 workspace
Unfortunately,wecan’tcovereverynewfeatureinthisReviewer’sGuide.Toseeeverythingthat’snew,selecttheWhat’sNewInCS5.5workspace.Inthisworkspace,thenewestfeaturesarehighlightedinpurple.YoucanalsoeasilyseewhichfeatureswereintroducedinInDesignCS5;thosearehighlightedinblue.
3Adobe InDesign CS5.5 Reviewer’s Guide
3. From the Adjust View Settings menu, choose High Quality. Make sure all three sliders in the dialog box are set all the way to the right.
4. IntheGreekTypeBelowfield,type4,andthenclickOK.
• Preparetoworkonthesampleprojectsduringthistour:IntheInDesign_CS55_RG_Assetsfolderyouextractedearlier,locateandopenthefilescalledLocal_eBook.indd(intheLocal_eBookfolder)andLocal_Magazine_h.inddandLocal_Magazine_v.indd(intheLocal_Magazinefolder).
◆ Ifyouseeanalertaboutacolorprofilemismatch,selectLeaveDocumentAsIs,andthenclickOK.
◆ Ifyouseeanalertthatlinkshavebeenmodified,selectUpdateLinks.
◆ Ifyouseeanalertthatlinksaremissing,clickOKtoopenthedocument.Then,opentheLinkspanel(Window>Links),selectthefirstentrythathasaquestionmarkicon,andchoose Relink from the Links panel menu. In the Locate dialog box that opens, navigate to the Links folder that is in the same parent folder as the active document. Browse the contentsofthatLinksfolder,selectingthemissingfileindicatedintheLocatedialogboxtitlebar,andthenclickOpen.InDesignautomaticallylinkstoothermissingfilesthatarein the same folder. You can close the Links panel when you’re done.
• Saveworkingcopiesofthelayouts:
1. ChooseFile>SaveAsfortheactivedocument.
2. Navigatetotheappropriateprojectfolder(Local_eBookorLocal_Magazine)withintheInDesign_CS55_RG_Assetsfoldersoyourfilewillbesavedwithinit.
3. ChangethefilenamebyaddingMy_infrontoftheoriginalfilename.(Forexample,saveLocal_eBook.inddasMy_Local_eBook.indd.)ThenclickSave.
4. DothesamefortheotherInDesignfiles.Usethefilesthatbeginwith“My_”asyour workingfilesthroughoutthistour.KeeptheoriginalINDDfilesintactincaseyouwanttostart over.
FIRSTPROJECT:Designandsavea.foliofileAdobe InDesign CS5.5 includes tools you can use to design immersive digital publications, such as consumer and corporate magazines, newspapers, retail catalogs, and advertisements for tablet devices such as the Apple iPad, BlackBerry Playbook, and a wide variety of Android tablets, includingtheMotorolaXoom.Youcancreateandpreview.foliofileswithinInDesignforpublication through the Adobe Digital Publishing Suite hosted solution,* which lets you further produce, distribute, and analyze digital publications.
Part 1: Create interactive overlaysThe .folio format supports interactive overlays, which let viewers engage more deeply with the content. For example, interactive overlays provide the ability to rotate an object in 360 degrees, pan and zoom images, play a slide show, or display HTML content within the document. You can createinteractiveoverlaysusingtheOverlayCreatorpanelinInDesign.
Create an image sequence overlayAnimagesequenceoverlaygivesviewersa360-degreeviewofanobject.Youcreateanimagesequenceoverlayusingafolderofimagestakenfromdifferentperspectivessothatuserscanmanipulate the view.
Deliver innovative ideas with Adobe Creative Suite 5.5 Design Standard
CombineInDesignwithindustry-leadingtoolsetsfordigitalimageediting,vectorillustration,andportabledocumentediting,andgetmorecreativepoweratanappeal-ingprice.InadditiontoInDesign,CreativeSuite5.5DesignStandardincludesthelatestversionsofAdobePhotoshop®,AdobeIllustrator®,andAdobeAcrobatProsoftware.
WithDesignStandard,youcan:
Automate tasks. UsetheActionWizardinAcrobatXProtoautomateroutine,multisteptasksthroughguidedactions.Create,manage,execute,andshareasequenceoffrequentlyusedstepsthatcanbeappliedtoasinglePDForbatchesoffiles.
Accelerate project workflows.SpeedupkeyprojectworkflowsthroughintegrationwithCSLiveonlineservices.‡§Bringcreativereviewsdirectlyintoyourdesignworkflow.Initiatereviewsandreceivecommentsfromwithinyourdesignsoftware.
Formoreinformation,seeAdobe Creative Suite 5.5 Design Standard What’s New.
Contents
Before you begin 2
FIRSTPROJECT:Designandsavea.foliofile 3
Part 1: Create interactive overlays 3
Create an image sequence overlay 4
Customize a slide show overlay 5
Create a pan & zoom overlay 6
Part2:Createa.foliofile 7
Part 3: Preview your folio 8
SECONDPROJECT:PrepareandexportanEPUB(eBook)file 9
Part 4: Set images to resize automatically in eBooks 9
Part 5: Link stories 10
Part 6: Map styles to tags 12
Part 7: Embed video and audio† 13
4Adobe InDesign CS5.5 Reviewer’s Guide
Try it: Add an image sequence overlay1. ChooseWindow>Extensions>OverlayCreator.
TheOverlayCreatorpanelopens.Itliststhetypesofinteractiveoverlaysyoucancreatefor.foliofiles. When you select an object, the panel lists applicable overlay options in Roman text; options unavailable for the selected object are italicized. Because you have nothing selected, all options are in italics when you first open the panel.
2. OpentheMy_Local_Magazine_h.inddfile,andselecttheimageofthebicycleonpage3.
3. ClickImageSequenceintheOverlayCreatorpanel.
4. Click the Info icon on the right side of the panel to see instructions for creating an image sequence.Clicktheinfoiconagaintoreturntotheoptions.
5. Click the folder icon next to Load Images. In the Choose Folder dialog box, navigate to the InDesign_CS55_RG_Assets/Local_Magazine/Linksfolder,andselecttheHUBBike_360folder.ClickOpen.
TheHUBBike_360foldercontainsaseriesofimagesofthebicycletakenatdifferentangles,namedin the order in which they appear for rotation.
Accessing Adobe Digital Publishing Suite from within InDesign CS5.5
Createanewgenerationofdigitalpublicationsfordesktopsandtabletdevices.AdobeDigitalPublishingSuite*integrateswithInDesignCS5.5,soyoucanusefamiliarlayoutsoft-waretoproducecutting-edgedigitalpublications.
AdobeDigitalPublishingSuiteisaturnkeysetofhostedservicesandviewertechnologythattightlyintegrateswithAdobeInDesignCS5.5software.UsingAdobeInDesignCS5.5andnewonlinepublishingservicesincludedinDigitalPublish-ingSuite,youcandesign,distribute,monetize,andanalyzeanewclassofinnovativedigitalpublications,includingmagazines,newspapers,retailcatalogs,andinteractiveadver-tisementsontheAppleiPad,AndroidtabletsincludingtheMotorolaXoomandSamsungGalaxy,BlackBerryPlayBook,andothertabletdevicesastheybecomeavailable.AdobeDigitalPublishingSuiterequiresaseparatelicenseandpaymentofassociatedfee(s).FormoreinformationaboutAdobeDigitalPublishingSuite,seewww.adobe.com/products/ digitalpublishingsuite.
5Adobe InDesign CS5.5 Reviewer’s Guide
6. Select Show First Image Initially.
The initial image appears, but it’s too large for the space. You’ll need to scale it.
7. In the Control panel, type 50 to change the scale percentage.
8. IntheOverlayCreatorpanel,makesureSwipeToChangeImageisselected.
Youcouldalsosetthesequencetoplayautomatically,playinreverse,orplaywhentapped.
Theimagesequenceisinplace.You’llhaveachancetopreviewitsoon.
Customize a slide show overlayIn earlier versions, you could create multi-state objects in InDesign. Now you can turn those multi-state objects into automatic slide shows in .folio files.
Try it: Customize a slide show1. Go to page 5.
2. Selecttheimageofradishes.TheSlideshowoptionsappearintheOverlayCreatorpanel.
Theradishesarethefirststateinamulti-stateobjectthatwasalreadycreatedinthisdocument.
3. ChooseWindow>Interactive>ObjectStatestoopentheObjectStatespanel.
6Adobe InDesign CS5.5 Reviewer’s Guide
4. Select each state to see it in context on the page, and then return to State 1.
5. Click outside the page, and then select the image again so that Slideshow options appear in the OverlayCreatorpanel.
6. IntheOverlayCreatorpanel,makesureCrossFadeisselected,andthenchangeSpeedto0.125 secs.
7. SelectTapToPlay/Pause.
The slide show will play or pause when the viewer taps the image.
Create a pan & zoom overlayA pan & zoom overlay provides powerful interactivity, yet it’s one of the simplest overlays to create becauseitrequiresonlyasinglecroppedimage.Usingtheoverlay,viewerscanchangewhichpartof the image is shown. If you choose to permit it, they can also zoom in to areas of the image.
Try it: Create a pan & zoom overlay1. Go to page 6.
2. Select the image of the street corner. This is a cropped image.
7Adobe InDesign CS5.5 Reviewer’s Guide
3. ClickPan&ZoomintheOverlayCreatordialogbox.
4. Select Pan And Zoom from the list of options.
Part2:Createa.foliofileWhen you’ve designed your publication and added any interactive overlays, you’re ready to create a .folio file. If you have an Adobe Digital Publishing Suite account,* you can upload the .folio file to Digital Publishing Suite to produce, distribute, monetize, and analyze a digital document consumed on a tablet device. Without a Digital Publishing Suite account, you can create a single .folio file and share it using Acrobat.com.§ You can also view the document on an iPad using the Content Viewer foriOSapp.
Try it: Create a .folio file1. MakesureboththeMy_Local_Magazine_h.inddandMy_Local_Magazine_v.inddfilesare
openinInDesign,andthattheMy_Local_Magazine_h.inddfileisactive.You’llcombinethehorizontal and vertical versions of the magazine so that users can view the content in either orientation.
2. ChooseWindow>Extensions>FolioBuildertoopentheFolioBuilderpanel.
3. Click Sign In in the Folio Builder panel to access the service.
4. LoginusingyourAcrobat.comusernameandpassword,andclickOK.
With a free Acrobat.com account,§youcancreateasingle.foliofile.
Import items for the folio
Inadditiontoaddingarticlestoafolioindividually,youcanimportanHTMLarticle(createdinanapplica-tionotherthanInDesign)ormultipledocumentsatonce.
Preview
ThePreviewbuttoninthebottomleftcorneroftheOverlayCreatorpanelallowsyoutoseehowyourdocument—includingalltheinter-activityyoubuiltin—willlookonatabletdevice.Itwillalsoalertyoutoproblemswiththeoverlaysthatwouldpreventyoufromsuccessfullycreatingafolio.
8Adobe InDesign CS5.5 Reviewer’s Guide
5. Click New at the bottom of the Folio Builder panel.
6. In the New Folio dialog box, name the folio Local.
The folio size defaults to the resolution for an iPad (1024 x 768). You’re creating a magazine for an iPad, so that setting is fine. If you were creating a publication for different device, you’d need to design the document for that device resolution, and select the appropriate resolution here.
7. ChooseAutomaticfortheimageformat,andthenclickOK.
Your new folio appears in the Folio Builder panel, and the panel changes to article view. You’re ready to add content to the folio.
8. Click New.
The New Article dialog box opens. The active document is selected by default.
9. Change the article name to Local_Magazine.
10.ChooseAutomaticfortheimageformat,andclickOK.
The entire article is converted to an image when you create a .folio file. You can choose which format to use, or, by choosing Automatic, you can allow the Folio Builder panel to determine which imageformatisappropriate.WhenyouclickOK,theFolioBuilderpanelconvertsthearticleandadds it to the folio on Acrobat.com. (This may take a couple of minutes to complete.)
Change the properties
Youcanchoosecoverimages,renamethefolio,ormakeotherchangesusingtheFolioPropertiesdialogbox.Toopenthedialogbox,choosePropertiesfromtheFolioBuilderpanelmenu.
9Adobe InDesign CS5.5 Reviewer’s Guide
11. Click the arrow next to the Local article name to go to layout view. You’ve added the horizonal layout. Now you’ll add the vertical layout for the same article.
12.SelecttheMy_Local_Magazine_v.inddtabinInDesigntomakeittheactivedocument.
13. In the Folio Builder panel, click New. The active document is added to the article, using the samesettingsyouselectedforthefirstlayoutinthearticle.
You have created a folio that includes both the horizontal and vertical layouts for a magazine.
Part 3: Preview your folioYou can preview the entire document, including the interactive overlays you created, as it will appear on an iPad or other tablet device using Content Viewer for Desktop, which comes with InDesign. Though the .folio file itself is stored on Acrobat.com, InDesign creates a cache of the file on your computer so that you can preview it.
Try it: Preview your folio file on your computer1. In the Folio Builder panel, select the Local folio.
2. Click Preview.
InDesign opens Adobe Content Viewer, which displays the folio you created.
Share your folio!
YoucanshareyourfoliowithothersjustasyoucanshareanyothercontentyoupostonAcrobat.com.§ChooseSharefromtheFolioBuilderpanelmenutogetstarted.Individu-alsyoushareafoliowithcanaddcontenttoitorpreviewthefolio.Forexample,apublishercancreateafolioandshareitwithfreelancewrit-ers,designers,andothercontributorssothattheycanaddtheircontent.OnefolioequalsoneworkspaceonAcrobat.com,soifyouhaveseveralworkspaces,youcansaveasmanyfoliosasyouhaveworkspaces.
10Adobe InDesign CS5.5 Reviewer’s Guide
3. Press the R key to toggle between horizontal and vertical views of your folio.
4. Click the folio to display navigational tools such as those you’d see on a tablet. You can use these tools to move forward and backward through the folio, view a table of contents, rotate it, or scrub through it. You can also swipe the page with your mouse just as you would swipe the page to turn it on a tablet. (Because you currently have only a single article open, not a full folio, you cannot actually scroll between articles now.)
5. Gotopage3,andthenswipethebicycletoviewotherangles.Onpage5,clickthroughtheslideshow.Onpage6,panandzoomtheimage.(Youcanpanbyclickinganddragging;zoomby using the wheel on your mouse or by pinching on a trackpad.)
6. To see additional interactive overlays in action, watch the video on page 4, connect to a website on page 3, and view another slide show on page 7.
Viewthebicyclefrommultipleanglesonpage3.
Viewtheslideshowofvegetablesatthemarketonpage5.
Panandzoomtoseemoredetailintheimageofthestreetcorneronpage6.
11Adobe InDesign CS5.5 Reviewer’s Guide
SECONDPROJECT:PrepareandexportanEPUB(eBook)fileInDesign CS5.5 introduces several new features to help you lay out pages more efficiently, especially when you’re designing them for print and digital publication. In this project, you’ll explore many of the improvements that make it easy to prepare documents for EPUB and HTML export. As you’ll see, you have greater control over which content is exported, and in which order. You can export better typography, and determine how images are displayed. You’ll also have the opportunity to try out general productivity enhancements, including the ability to link stories and to more easily anchor objects to text.
Part 4: Set images to resize automatically in eBooksGone are the days when everyone viewed digital documents on standard monitors. In InDesign CS5.5, you can export eBook publications with images that resize with the rest of the page. The Relative To Page setting recognizes the width of the image in relation to the width of the page in InDesign. When readers view the eBooks you export with this setting, the images appear at the appropriate size, whether they’re viewing the eBook on a tablet, a smartphone, or a desktop e-reader such as Adobe Digital Editions. If you don’t want images to resize, you can specify that they remain at a fixed size.
InDesign CS5.5 gives you control over more than just the way the images resize. You can specify theimageformat,itsresolution,theimagequality,andmore.Youcanselectresizingandotheroptions for individual images, and you can set a default for all images in the document when you export the EPUB file.
Try it: Set image options1. ClickthedocumenttabforMy_Local_eBook.inddtobringittothefront,andgotopage4.
2. With the Selection tool, select the image of people walking over a bridge.
3. ChooseObject>ObjectExportOptions.
4. IntheObjectExportOptionsdialogbox,selecttheEPUBAndHTMLtab.
ThenewObjectExportOptionsdialogboxletsyoucontrolhowobjectsareconvertedforexport,and how they are displayed in the exported document. You can also use this dialog box to specify alt text and PDF tags.
5. Select Custom Rasterization, and then choose Relative To Page Width from the Size menu.
6. Choose PNG from the Format menu, and choose 150 from the Resolution menu.Control image quality
WithInDesignCS5.5,youcontrolhowimagesareexported.Ifyou’reexportingabookwithfew,highlydetailedimages,youmaywantaresolutionof300dpi.Inabookwithhundredsofimages,youmaywanttoexport72-dpiimagestoreducethefilesize.
Disable frame highlighting
Bydefault,InDesignhighlightstheedgesofframeswhenyoumovetheSelectiontooloverthem.Youcannowchoosewhetherframesarehighlighted.Todisableframehigh-lighting,chooseEdit>Preferences>Interface(Windows)orInDesign>Preferences>Interface(MacOS),andthendeselectHighlightObjectUnderSelectionTool.
Disablingframeedginghasnoeffectonthewaytheframeisdisplayedwhenyouselectanobject.
12Adobe InDesign CS5.5 Reviewer’s Guide
7. Click Done.
The image you selected will be exported as a 150-dpi PNG image. It will resize to fit the reader’s screen in an exported HTML file or eBook, regardless of the settings you select for images in general when you export the document. Settings for individual images override settings for the entire document.
8. ChooseFile>Export.
9. In the Export dialog box, choose HTML for the format, and then click Save.
10.IntheHTMLExportOptionsdialogbox,clickOKtoacceptthedefaultsettings.
InDesignexportstheHTMLfileandopensitinyourdefaultwebbrowser.
11.ScrollthroughtheHTMLfileuntilyouseetheimageyouwereworkingwith.
12. Resize the browser window. The image grows and shrinks, relative to the page width, as you change the page size.
13. Close the browser.
Part 5: Link storiesWhen the same text appears multiple times in a document—whether it’s a block of copyright text, photo credits, or repeated stories, keeping that text consistent can be challenging. Now you can link copies of stories using the same familiar Links panel you use to link to external content. When you edit the text in the original (parent) story, you need only update the link to apply the same
13Adobe InDesign CS5.5 Reviewer’s Guide
edits to the copied (child) story in your document. In this project, you’ll link text for an EPUB document, but this feature is a time-saver no matter how you output your publication.
Try it: Link stories1. Go to page 2.
2. Select the text frame that contains the copyright language. This is the original text that will become the parent story.
You can select text to link by selecting a text frame or by clicking an insertion point in the text. The entire story is linked.
3. ChooseEdit>PlaceAndLinkStory.
InDesign loads the cursor with the copied story.
4. Go to page 15, and drag a text frame in the lower-right corner of the page. The copied text becomes a linked child story.
There’s a missing word in both copies of the text. You can correct the text in the parent story and update the link to correct the child story.
5. ChooseWindow>Links.
The child story is in the Links panel.
6. SelectthelinkintheLinkspanel,andclicktheEditOriginalicon . InDesign returns you to page 2, with the original story active.
7. Addtheword“this”beforetheword“document,”sothatthetextreads“Nopartofthisdocument.”
You’ve changed the original text. In the Links panel, an alert appears next to the copied story.
8. In the Links panel, select the link to the child frame, and then click the Update Link button.Whentheoriginalstoryhasbeenmodified, an alert appears next to the linked story in the Links panel, and the story’s status is set to Modified.ClicktheUpdateLinkbuttontoupdatethelinkedstorywiththemodificationsmade to the original.
Monitoring linked stories
Worriedthatyoumightacciden-tallyoverwritetextyouwantedtokeep?ChooseLinkedStoryOptionsfromtheLinkspanelmenu,andthenselectWarnIfLinkUpdateWillOverwriteLocalEditstoseeawarningmessagebeforeupdatesgointoeffect.YoucansetotherupdateoptionsintheLinkspanelmenu,too—includingtheabilitytostripsoftreturns.
Ifyouwanttoknowwhetheryou’vemadelocaleditstothestory,checktheLinkspanel.Ifchangeshavebeenmade,thestorystatusdisplays“TextModified.”
Look for the badge
Toidentifyachildstoryonthepage,displaytextframes.Alinkbadgeappearsontheframeofachildstory.Toidentifytheparentstory,selectthechildintheLinkspanel,andthenclicktheEditOriginalbutton.
Link any story—or multiple stories
Youcanlinkmultiplestoriesasagroup:Shift-clicktoselectthem,andchooseEdit>PlaceAndLinkStory.Whenyouplacethelinkedtext,alltheselectedstoriesareincluded.
Youcanalsolinktextonapath.
Ifthelinkedstoryhasanobjectanchoredtoit,thatobjectbecomespartofthechildstory,too.
As you place a linked story, InDesign displays a loaded cursor, just as when you place any other text item.
Oncethestoryisinplace,abadge appears, indicating it is a child story, linked to a parent story. The badge appears only if Show Frame Edges is selected.
14Adobe InDesign CS5.5 Reviewer’s Guide
9. Go to page 15. The text you added on page 2 is included in the story on page 15 because you updated the link.
You can create multiple links from the same story in a document. However, you can only apply changes made to a parent story to its children; changes made to a child story can’t be applied to the parent story or to other child stories.
If you want to unlink a story, select the link in the Links panel, and then choose Unlink from the Links panel menu. The child story becomes a regular, unlinked story.
Part 6: Map styles to tagsIn the past, when you exported a document to EPUB, HTML, or PDF, InDesign exported all block- leveltexttoa<p>(paragraph)tagandusedCSS(cascadingstylesheets)tocreatethevisualpresentation. However, third-party applications could not infer the organization from the tags, so accessibility readers, for example, were unable to read heading text as different from body text. EPUB readers that didn’t support CSS presented all the information as generic paragraphs, relying onlyonthe<p>tags.Ifyouwantedtomakeyourexporteddocumentmoreuseful,youhadtousepost-processingscripts,editthecodebyhand,orusetheStructurePane>MapStylesToTagsfeatures in InDesign.
Exporting appropriately tagged text just got easier. New in InDesign CS5.5, you can map styles to tags for EPUB, HTML, and PDF within the Paragraph Style and Character Style dialog boxes. Styles remain mapped to the tags you specify as you continue to edit and refine the document, ready for InDesign to apply them accurately when you export your file.
Try it: Map styles to EPUB tags1. ChooseWindow>Styles>ParagraphStylestoopentheParagraphStylesdialogbox.
2. Make sure nothing is selected in the document. Then, double-click the Header style name to opentheParagraphStyleOptionsdialogbox.
3. SelectExportTaggingfromthelistontheleft.
4. In the EPUB And HTML area of the dialog box, choose h1 from the Tag menu.
You can select one of the standard default tags (body, h1-h6) or type your own tag. You can also enter a CSS class, if you’ve defined classes you want to use in the document.
5. For Class, type my_head1.Themy_head1classisdefinedintheCSSfilethatwillaccompanythis document.
Mapping classes
SophisticatedusersmaywanttomapCSSclassnamestostyles.InHTML,classnamescommonlydifferentiateslightvariationsinstyling,suchasspacingandindentationparameters.Inpastreleases,classnameswereautomaticallygeneratedbasedonstylenamesintheInDesigndocument,butthoseclassnamesmightnotmakesenseonadigitaldevice.AddingyourownclassnamescanhelpyousmoothlytakeyourInDesigndocumentintothedigitalworld.IfyouwanttogeneratetheCSSdirectlyfromInDesign,andyou’vemappedtheInDesignstyletoabasictag,youmustincludeaclassnameforthestyledefinitionstobegenerated.ClassnamesareusedonlyinHTMLorEPUBexports;theyhavenopurposeintaggedPDF.
HunSpell open source dictionaries
NowyoucanchooseHunSpellopensourcedictionariesasanalternativetotheproprietarydictionariesincludedinInDesign.HunSpelldictionariesareavailableforbothspellingandhyphenation.Keepinmindthattextmayreflowwhenyouchangedictionaries.
15Adobe InDesign CS5.5 Reviewer’s Guide
6. ClickOK.
In addition to mapping paragraph styles, you can map character styles to tags for EPUB or HTML.
7. ChooseWindow>Styles>CharacterStylestoopentheCharacterStylespanel,ifit’snotalready open.
8. In the Character Styles panel, double-click the Directory Subheads style.
9. IntheCharacterStyleOptionsdialogbox,selectExportTaggingfromthelistontheleft.
10.ChooseStrongfromtheTagmenu,andthenclickOKtoapplyit.
You’ve made changes to the way text will appear in the EPUB document you export, but you won’t see any changes in the InDesign layout. Mapped styles affect only exported files.
Part 7: Embed video and audio†
You probably already know that you can embed video and audio into InDesign. Now, MP4 video (h.264) and MP3 audio plays in eBooks you export, when you play them in an application that supportsHTML5<video>and<audio>tags.Currently,onlytheAppleiBooksapplicationplaysvideos in exported EPUB documents.
Try it: Embed video and audio1. Go to page 7. You’ll add a video to the page, where the blue frame serves as a placeholder.
2. ChooseFile>Place.
3. NavigatetotheInDesign_CS5.5_RG_Assets/Local_eBook/Linksfolder,andselectthePaladin.mp4file.
4. ClickOpen,andthenclickonthepasteboardoutsidethedocument.
5. In the Control panel, type 35intheXscalepercentagebox;theYscaleshould change automatically. If the boxes aren’t linked, change the Y scale to35%,aswell.AsinpreviousversionsofInDesign,thescalefieldsdisplay100%againafterthechangeismade.
6. Dragthevideofileovertheblueplaceholderframeinthemiddleofthepage.
Character style options are similar to those in the Paragraph StylesOptionsdialogbox,exceptthat you can’t map character styles to PDF tags because PDFs don’t use character-level tags. The tags available for character styles (strong, for example) are different from those available for paragraph styles (such as h1) because paragraph-level formatting is different from character-level formatting in EPUBandHTMLfiles.
Whenyoufirstplacethefile,thefirstframe of the movie appears. You’ll select a frame to use as the poster for the video in the following steps.
Reveal the code
ToseehowInDesigncodesthedocu-mentafteryoumapstylestotags,exporttoHTML.Then,useyourwebbrowser’sViewSource,PageSource,orsimilarcommandtoseetheHTMLcodeforthepage.
Map all the styles at once
Ifyouwanttomapmultiplestylesatonce,chooseEditAllExportTagsfromtheParagraphStylesorChar-acterStylespanelmenu.You’llseealistofallthestylenamesandbeabletoviewandeditallthetagandclassmappings.
16Adobe InDesign CS5.5 Reviewer’s Guide
7. ChooseWindow>Interactive>MediatoopentheMediapanel.
8. Makesurethevideofileisselected,andthenscrolltotheendofthevideotofindaframethatdisplays the name of the show.
9. Choose From Current Frame from the Poster menu, and then click the Apply button next to it. The frame you’ve selected appears on the page.
When you export the EPUB document, the video will play in eBook reader applications that support HTML5 video tags. In other applications, the image is static.
10.ChooseWindow>TextWrap.Withthemovieposterselected,selecttheJumpObjecttextwrapoption in the Text Wrap panel.
11. Press Ctrl or Command and click the movie poster to bring the blue placeholder to the front. Then delete the placeholder.
Part 8: Drag and drop anchored objectsYou’ve been able to anchor objects to text in InDesign for a while now, as long as you were willing to work at it. Anchoring still works the same way—as the page reflows due to edits or screen size changes, the object you anchor moves with the text you’ve anchored it to—but the act of anchoringobjectstotexthasbecomemuchsimpler.Eachobjectframehasalittlebluesquareintheupper-rightcorner.Justdragthatbluesquaretotheanchorpointwithinthetext.Theblueboxchanges to an anchor icon to show you it’s anchored. And you’re done! It’s that easy.
Try it: Anchor objects1. Go to page 7, if you’re not already there.
2. With the Selection tool, select the video frame you created in Part 7.
3. Click the blue box on the object frame, and drag it to the end of the paragraph that ends “…annualoutdoorevent.”
The poster is the image that appears whenever the video is not playing, either because it can’t play (whenyouprintthefileoropenitinanapplicationthat doesn’t support video) or because it hasn’t started playing.
You can select a frame from the movie to use as a poster, or you can select a separate image.
Drag the blue box to the anchor point in the text. The blue box changes to an anchor icon, indicating that the object is anchored. To see whereit’sanchored,chooseView>Extras>Show Text Threads.
Anchored object shortcuts
PressShiftasyoudragtheblueboxtopositionaninlinegraphic.
PressAltorOptionasyoudragtheblueboxtosetoptionsfortheanchoredobject.
17Adobe InDesign CS5.5 Reviewer’s Guide
4. Onpage5,selecttheRestaurantstextblock,anddragitsblueboxtoaninsertionpointjustbeforethewords“AcquaEFarina.”
5. Stillonpage5,selecttheAcquaEFarinalogo,anddragitsblueboxtothesamepoint,justbeforethewords“AcquaEFarina.”
Anchored objects flow with their articles, staying in position as the text of the article moves. We’ve already anchored other objects for you, so they’re ready for export.
Part9:OrganizecontentusingtheArticlespanel†
The Articles panel makes it much easier to create eBooks that flow smoothly from documents that were designed for print or PDF—without having to change the layout of your document in InDesign. You can select which page items to include and in what order those items should appear. An article can include a single page item, or it can include a combination of existing page items in a layout, including images, text stories, and graphics. You can add more content to existing articles, edit them, or change their order in the Articles panel.
The article flow you set up in the Articles panel is also used in HTML documents you export. Additionally, you can use it to determine the reading order in accessible PDF documents, as you’ll see in Part 12.
Try it: Add content to the Articles panel1. ChooseWindow>ArticlestoopentheArticlespanel.
Four articles are already in the panel. You’ll add the table of contents section.
2. Go to page 2 of the document.
3. Select the Table of Contents frame with the Selection tool.
4. Click the New Article icon in the Articles panel.
What about XML?
Ifyou’recomfortableusingXMLtodeterminetheorderofexportedcontent,don’tworry—theXMLstructurepanelisrightwhereyouexpectittobe.TheArticlespanelprovidesamethodfororderingcontentwithoutneedingtounder-standXML,butXMLguruscanopttouseXMLinstead.
18Adobe InDesign CS5.5 Reviewer’s Guide
5. In the New Article dialog box, make sure Include When Exporting is selected, and then name the article TOC,andclickOK.
InDesignautomaticallyaddstheselectedTableofContentsstorytotheTOCarticle.
6. DragtheTOCarticleupintheArticlespanel,sothatitisbetweentheCoverandOld Town articles.
Using the Articles panel, you can select which items are exported to an EPUB document. Here, you’ll include the table of contents and the copyright information, but not the maps that are on the right side of the page.
7. Drag the text frame that contains the list of contents onto the Articles panel, directly beneath the<TableofContents>item.Dropitwhenyouseeadarkblackline,indicatingthattheobjectwillbeaddedtotheTOCarticle.
As you drag the text frame, it moves out of position temporarily. As soon as you drop it over the Articles panel, it snaps back into place.
Items with check marks next to them in the Articles panel will display in the exported eBook in the order they appear in the Articles panel, regardless of their order in the InDesign layout. If you want to leave an article out of the exported file, deselect it in the Articles panel.
8. Drag the copyright text frame from the bottom of the page onto the Articles panel, adding it to theTOCarticle.
When you drag a text frame to the Articles panel, its entire story is added. That is, any text threadedwiththeframeyouselectedisalsoincluded.Inthisdocument,theOldTownarticlecontains text that flows across several pages. You could break the threaded text into multiple text stories, and create separate articles for them, placing graphics in the appropriate positions. However, anchored images are automatically included in articles, so the images you anchored (and the ones we anchored for you) will appear in the appropriate locations.
As you drag any object to the Articles panel, the entire objectshifts,butitwillsnapbackintopositionafteryoudrop it over the Articles panel. In this way, adding objects to the Articles panel is similar to adding items to the Library panel.
If you drop the object before you get to the Articles panel, Undoisyourfriend.JustpressCommand+Z(MacOS)or Ctrl+Z (Windows) to restore your layout.
Naming elements in the Articles panel
WhenyouaddarticlestotheArticlespanel,youcannamethemanythingyoulike.However,thenamesofelementsnestedwithinthearticlecomefrominformationintheLayerspanel.Torenameanelementwithinanarticle,changeitsnameintheLayerspanel.
Creating articles quickly
Youcancreatearticlesbymanu-allydraggingindividualpageitemstotheArticlespanel,asyoudohere.However,youcanalsoaddallselectedcontentatonce,orevenaddanentiredocumenttoanarticle.
19Adobe InDesign CS5.5 Reviewer’s Guide
Part 10: Export an EPUB document†
It’s time to see the results of the changes you’ve made! You’ll export the EPUB file and take it for a spin on an iPad.
EPUB and HTML export features have been completely rewritten in InDesign CS5.5, so that designerscancreatehigher-qualityEPUBorHTMLfileswithouthavingtoknowcodeorrelyonadeveloper.IntheEPUBExportOptionsdialogbox,youcanchoosewhethertoordercontentbasedonthepagelayout,theXMLstructure,ortheArticlespanel.
Try it: Export the document and preview it on an iPad1. ChooseFile>Savetosavethechangesyou’vemade.
2. ChooseFile>Export.
3. IntheExportdialogbox,chooseEPUBfromtheFormatmenu,nameyourfileMy_Local_Ebook.epub,andselectalocationforthefile.ThenclickSave.
4. IntheEPUBExportOptionsdialogbox,selectGeneralfromthelistontheleft.
5. In the EPUB Cover area of the General pane, select Use Existing Image File. Then click Choose, andnavigatetoInDesign_CS55_RG_Assets/Links/NeighborhoodGuideCover.jpg.Selectit,andthenclickOpen.
6. IntheOrderingareaoftheGeneralpane,selectSameAsArticlesPanel.
7. DeselectViewEPUBAfterExportingatthebottomoftheGeneralpane.
8. SelectImagefromthelistontheleft.
You can specify a cover image for your eBookintheEPUBExportOptionsdialog box. The cover is used to represent the book in some e-reader applications. For example, in Apple iBooks, the cover appears on the bookshelf readers use to select the books they want to read.
Specifying margins
WhenyouexportanEPUBfile,youcanenteramarginvalue(emorpixels)intheFormattingOptionsareaoftheEPUBExportOptionsdialogbox.Thesamevalueisappliedtoallmargins—top,bottom,left,andright.Emisthebestvalueformulti-screencompatibility.MarginsarecurrentlysupportedonlybyDigitalEditionsandtheOperawebbrowser.
Additional formatting support
SeveralenhancementsinInDesignCS5.5giveyougreatercontroloverformatting:•Youcanselectwhichparagraphstyletousetoaddpagebreaks,insteadofbeinglimitedtothetop-levelTOCstyle.
•HeadersandfootersinInDesigntablesareincludedinexportedEPUBorHTMLfiles.
•Youcanopttodisplayfootnotesaftertheparagraphwherethey’recitedinsteadofconvertingthemtoendnotes.
•Numberedorbulletedlistscreatedusingtheauto-bulletorauto-numberingfeaturesinInDesignarecorrectlyrepresentedasorderedandunorderedlistsintheexportedEPUBorHTMLfile.
•YoucanselectRemoveSoftReturntoeliminateallsoftreturnsusedintheInDesigndocumentuponexport.
•InDesignCS5.5supportsEPUB3.0J-languagefeatures,includingverticaltextandRuby.†
20Adobe InDesign CS5.5 Reviewer’s Guide
9. Choose Relative To Page from the Image Size menu. This setting ensures that every image inthedocumentwillresizedynamically,exceptthosethatyou’vespecificallysettodisplayatafixedsize.
10.SelectContentsfromthelistontheleft.Youcanselectwheretoincludepagebreaksbasedonparagraph styles, how footnotes are displayed, and how cascading style sheets (CSS) are applied.
11.ClickOKtoacceptthedefaultsettings.InDesignexportstheEPUBfile.
12.OpeniTunes.
13.IniTunes,chooseFile>AddToLibrary.NavigatetotheEPUBdocumentyouexported,selectit,and click Choose.
14. Attach your iPad to your computer, and then drag the eBook you copied to the iPad.
If you’ve set iTunes to let you manually manage your files, you can drag only the eBook; if you have other options set, you may need to wait for the files to sync.
15.OntheiPad,opentheiBooksapp.YoureBookappearsontheiBooksbookshelf.
16. Double-click the eBook to open it.
17. Scroll through the eBook. Resize pages and watch the images resize automatically.
More control over image conversion
Youcanincreasetheresolutionofimagesfrom72ppi(theonlyoptioninearlierversions)to96(Windowsdefault),150(theaverageofeBookdevices),or300(printquality).YoucanalsoconvertimagestoPNGformat,whichcanprovidebetterresultsforimagesthatincludetrans-parency.
21Adobe InDesign CS5.5 Reviewer’s Guide
Notice that anchored objects remain in position, items in the Articles panel appear in the order you set, and styles are mapped to the appropriate EPUB tags. Click the video of the Paladin trailer to view it.
THIRDPROJECT:ExportanaccessiblePDFfileIf you are tasked with preparing accessible PDF documents, you might find this section the most exciting. Substantial changes in InDesign CS5.5 make the process of creating accessible PDF documents that meet WCAG 2.0 (Web Content Accessibility Guidelines) or Section 508 standards much more efficient and much easier, especially for users who don’t have a strong knowledge of structured documents. In particular, it’s much simpler to tag content and add alt text for screen readers directly in InDesign, without having to make the changes in Acrobat. The PDF tags and alt text you apply stay with your document as you revise it.
Part 11: Include alternate (alt) textScreen readers for the visually disabled cannot make sense of images, so accessible PDF files need to include alternate text that the screen reader can read to describe the image. It’s easier to add alt text to images in InDesign CS5.5, especially if alt text has already been added to the metadata for animageinAdobeBridge,MicrosoftWord,oranotherapplicationthatwritesXMLmetadata.Afteryou’ve added alt text to an image, the alt text stays with it as you design your layout.
Add alt text in InDesignYou can add alt text by typing it directly into InDesign.
Try it: Add alt text to images1. OpentheMy_Local_eBook.inddfile,ifit’snotalreadyopen.
2. ChooseFile>SaveAs,andnamethenewfileAccessible.indd. Save it to the InDesign_CS5.5_RG_Assetsfolder.
3. Go to page 4.
4. With the Selection tool, select the image at the top of the page.
5. ChooseObject>ObjectExportOptions.
6. SelecttheAltTexttabintheObjectExportOptionsdialogbox.
7. Choose Custom from the Alt Text Source menu.
8. Type A bridge at Sandhill Parkinthetextfield,andclickDone.
The alt text you entered is included whenever you export this InDesign file as an EPUB, HTML, or PDF document. However, it is not added to the metadata for the image file itself, so you’ll need to re-enter it if you use the image in a different document. To ensure the alt text remains with the image, enter it as metadata in Adobe Bridge.
PDFX-4:2010 support
Youcanproducehigh-qualityPDFfilesforprintfromInDesign,too.InDesignCS5.5addssupportforPDFX-4:2010toitsextensivesupportforPDFstandards.
22Adobe InDesign CS5.5 Reviewer’s Guide
Import existing alt textYou no longer need to re-enter alt text for images in each document. If alt text was entered for an image in Microsoft Word or Adobe Bridge, for example, you can easily assign the same text in InDesign CS5.5.
Try it: Import alt text for images1. Go to page 10.
2. Select the image of the street scene.
3. ChooseObject>ObjectExportOptions.
4. Select the Alt Text tab.
5. ChooseFromXMP:DescriptionfromtheAltTextSourcemenu.Thetext“GreenLightDistrictwhereParkStreetand7thAvenuemeet”appearsinthetextfield.
6. Click Done.
When you export the document, the alt text you’ve assigned will travel with the image.
Part12:OrganizecontentforthePDFfileScreen readers and other assistive devices attempt to identify the logical flow of a PDF document so that it will make sense as it’s read. Now it’s easier to create tagged PDF files, with both tags and articles identifying the content that should be read, the order in which it should be read, and the reading style.
Organize content in the Articles panelYou used the Articles panel in the second project to organize content for an eBook. You can use the same Articles panel to arrange content logically for an accessible PDF file. In fact, in this case, the content has already been arranged logically, so you do not need to make any changes to the order of items in the Articles panel before exporting an accessible PDF file. However, you do need to instruct InDesign to use the panel order when it exports.
Try it: Use the Articles panel in tagged PDF1. OpentheArticlespanel,ifit’snotalreadyopen.
2. ChooseUseForReadingOrderInTaggedPDFfromtheArticlespanelmenu.
Reading order vs. tab order
PDFtagsandtheArticlespanelaffectthereadingorderinaccessiblePDFdocuments,whichdetermineshowscreenreadersreadthecontent.Butithasnoeffectontaborder,whichistheorderinwhichviewersmovethroughthedocumentwhentheypresstheTabkey.
23Adobe InDesign CS5.5 Reviewer’s Guide
Withthisoptionselected,InDesignusestheArticlespanel,ratherthantheXMLstructurepane,todetermine reading order in the exported PDF file.
Map styles to PDF tagsInearlierversionsofInDesign,taggingPDFdocumentscouldbeatediousprocess,requiringyoutounderstand and use the Structure pane or the Tags panel. Now, you can map paragraph styles to PDF tags easily. When InDesign exports the tagged PDF document, those mapped tags automatically define the role map in Acrobat.
Try it: Map styles to PDF tags1. ChooseWindow>Styles>ParagraphStylesiftheParagraphStylespanelisn’talreadyopen.
2. Double-click Header in the Paragraph Styles panel to edit it.
3. SelectExportTaggingfromthelistontheleft.
4. InthePDFareaofthedialogbox,chooseH1fromtheTagmenu,andthenclickOK.
PDF tags determine how screen readers read content. For example, the H1 tag indicates that the text is a heading. The PDF tags you map to paragraph styles appear in the role map in Acrobat.
Export the PDF documentWhen you’ve organized and tagged the content in a PDF file, you’re ready to export. There are two options for exporting PDF— interactive and print. You can export a tagged PDF file using either option. You’ll export the PDF document and then take a look at your work in Acrobat.
Try it: Export the PDF document1. Savethefile.
2. ChooseFile>Export.
3. Choose Adobe PDF (Interactive) from the Format menu.
You can create tagged print PDF files or tagged interactive PDF files. To create tagged PDF files for print, choose Adobe PDF (Print) from the Format menu instead.
Tagged PDF just got much easier
TagsyoumaptostylesautomaticallydefinetherolemapinAcrobat.YounolongerneedtousetheStructurepaneortheTagspaneltotagPDFfiles.
What’s a role map?
ArolemapisthesetofcustomtagsmappedtopredefinedAcrobattags,producingauniquetagsetforthedocument.WhenyoumapstylestoPDFtagsinInDesign,you’respecifyinghowthosetagsshouldbemappedintheexportedPDFdocu-ment’srolemap.
24Adobe InDesign CS5.5 Reviewer’s Guide
4. NamethefileAccessible.pdf,andsaveittotheInDesign_CS5.5_RG_Assetsfolder.
5. Click Save.
6. IntheExportToInteractivePDFdialogbox,selectCreateTaggedPDF.MakesureViewAfterExporting is also selected.
7. ClickOKtoexportthePDFfile;clickOKifyouseeacolorspacewarning.Thedocumentopensin Acrobat.
8. InAcrobat,chooseView>ReadOutLoud>ActivateReadOutLoud.
9. Gotopage2.ChooseView>ReadOutLoud>ReadThisPageOnly.
TheAcrobatReadOutLoudfeaturereadsthetableofcontentspage,butdoesn’tattempttoreadthe maps, because you didn’t include them in the Articles panel. The order of contents in the Articles panel determines the order in which content is read by screen readers.
10.ChooseView>ReadOutLoud>DeactivateReadOutLoudtodisablethefeatureagain.
11. Go to page 10, and move the pointer over the picture of the street scene. The alt text you assigned to that picture appears.
12. Close the PDF document and the InDesign document, as well as InDesign and Acrobat.
Viewing the role map
Thestylesyoumappedarelistedintherolemap.ToseetherolemapinAcrobat,clicktheTagsiconinthenavigationpane.Then,fromtheTagspanelmenu,chooseEditRoleMap.
Adobe Systems Incorporated 345 Park Avenue SanJose,CA95110-2704 USA www.adobe.com
Expected ship dateSecondquarter2011
For more informationProduct details: www.adobe.com/indesign
System requirementsWindows®• Intel®Pentium®4orAMDAthlon®64processor
•Microsoft®Windows®XPwithServicePack2(ServicePack3recommended);WindowsVista®HomePremium,Business,Ultimate,orEnterprisewithServicePack1;orWindows7
•1GBofRAM(2GBrecommended)
•1.6GBofavailablehard-diskspaceforinstallation;additionalfreespacerequiredduringinstallation(cannotinstallonremovableflashstoragedevices)
•1024x768display(1280x800recom-mended)with16-bitvideocard
•DVD-ROMdrive
•AdobeFlash®Player10softwarerequiredtoexportSWFfiles
•BroadbandInternetconnectionrequiredforonlineservicesandtovalidateSubscriptionEdition(ifapplicable)onanongoingbasis‡
Forupdatestosystemrequirements,visitwww.adobe.com/go/indesign_systemreqs.
Mac OS•MulticoreIntel®processor
•MacOSXv10.5.8orv10.6
•1GBofRAM(2GBrecommended)
•2.6GBofavailablehard-diskspaceforinstallation;additionalfreespacerequiredduringinstallation(cannotinstallonavolumethatusesacase-sensitivefilesystemoronremovableflashstoragedevices)
•1024x768display(1280x800recom-mended)with16-bitvideocard
•DVD-ROMdrive
•AdobeFlash®Player10softwarerequiredtoexportSWFfiles
•BroadbandInternetconnectionrequiredforonlineservicesandtovalidateSubscriptionEdition(ifapplicable)onanongoingbasis‡
Forupdatestosystemrequirements,visitwww.adobe.com/go/indesign_systemreqs.
Adobe, the Adobe logo, Acrobat, Creative Suite, Flash, Illustrator, InDesign, and Photoshop are either registered trademarks or trademarks of Adobe Systems IncorporatedintheUnitedStatesand/orothercountries.AMDAthlonisatrademarkorregisteredtrademarkofAdvancedMicroDevices,Inc.Apple,Mac,andMacOSaretrademarksofAppleComputer,Inc.,registeredintheUnitedStatesandothercountries.IntelandPentiumaretrademarksorregisteredtrademarksofIntelCorporationoritssubsidiariesintheUnitedStatesandothercountries.Microsoft,Windows,andWindowsVistaareeitherregisteredtrademarksortrademarksofMicrosoftCorporationintheUnitedStatesand/orothercountries.Allothertrademarksarethepropertiesoftheirrespectiveowners.
©2011AdobeSystemsIncorporated.Allrightsreserved.05/11
*AdobeDigitalPublishingSuiterequiresaseparatelicenseandpaymentofassociatedfee(s).Seewww.adobe.com/products/ digitalpublishingsuiteformoreinformation.
†InDesignusesEPUB3andHTML5codetocreateeBookswithaudio,video,andotheradvancedfeatures.EPUB3andHTML5presentation,mediaplayback,anddouble-bytecharactersupport(e.g.,Chinese,Japanese,Korean)maynotbesupportedbyalldevices,browsersorEPUBreaders.
‡CSLiveonlineservicesarecomplimentaryuntilApril12,2012.Seewww.adobe.com/go/CSLivefordetails.
§Adobeonlineservices,includingAdobeCSLiveServicesandAcrobat.com,areavailableonlytousers13andolderandrequireagree-menttoadditionaltermsandAdobesonlineprivacypolicy(availableatwww.adobe.com/go/terms).Onlineservicesarenotavailableinallcountriesorlanguages,mayrequireuserregistrationandmaybesubjecttochangeordiscontinuationwithoutnotice.Additionalfeesorsubscriptionchargesmayapply.
Wrapping upThanks for taking the time to explore some of the new features in Adobe InDesign CS5.5. For additional information, please refer to Adobe InDesign CS5.5 What’s New, Adobe Creative Suite 5.5 Design Premium What’s New,theReviewer’sGuideforAdobeAcrobatXProfessional,and www.adobe.com/digitalpublishing for information about Adobe Digital Publishing Suite.
About Adobe Systems IncorporatedAdobe is the world’s leading provider of software solutions to create, manage, and deliver high-impact, reliable digital content. For more information, visit www.adobe.com.