View
127
Download
0
Category
Tags:
Preview:
DESCRIPTION
Do you know how to increase you website traffic? This is an example of a SEO analysis of a website with high traffic, to see how we can improve the results of indexing, you can learn too and increase the traffic of your website. The example that we have used is the website, gifmania.ca a website of animated gifs online since 2000 and have increase the traffic following the advices of the SEO Analysis.
Citation preview
SeoSiteCheckup Report
Overall score for httpwwwgifmaniacaYour Score is 66 | Grade B
26 Important Fixes
2 Semi-Important Fixes
42 Passed Checks
TitleThe meta title of your page have a length of 58 characters Most search engines will truncate meta titles to 70 characters
Animated Gifs ~ Cartoons Sports Love Terror Movies
DescriptionThe meta description of your page have a length of 234 characters Most search engines will truncate meta descriptions to 160 characters
Animated Gifs of Cartoons and Movies Free Animated Gifs of Animated Cartoons Free Animations Images Pictures Pics of Animated Images Animations Web Pages for Webmaster Canada graphics Free Comics Games and TV Series Animated Gifs
KeywordsThe meta-keywords tag is missing from your page You should include meta-keywords to help indicate what your page is about to search engines
HOW TO FIX
In order to pass this test you must include a meta-keywords tag in your page header (ltheadgt section)
ltheadgtltmeta name=keywords content=keyword1 keyword2 keyword3gtltheadgt
Separate keywords with commas and dont use any other punctuation beyond commasNote that in HTML the ltmetagt tag has no end tag but in XHTML this tag must be properly closed
Most Common Keywords TestIt appears that you can further optimize the density of your keywords above Various sourcesindicate that a safe keyword density should range between 2-4 for your targeted keywords
animated - 13 times - 289
gifs - 12 times - 267
free - 11 times - 244
file - 7 times - 156
games - 6 times - 133
HOW TO FIX
In order to pass this test you must optimize the density of your primary keywords displayed aboveIf the density of a specific keyword is below 2 you must increase it and if the density is over 4 you must decrease it
Keyword UsageYour most common keywords are not appearing in one or more of the meta-tags above Your primary keywords should appear in your meta-tags to help identify the topic of your webpage to search engines
Keyword(s) included in Meta-Title Tag
Keyword(s) included in Meta-Description Tag
Keyword(s) not included in Meta-Keywords Tag
HOW TO FIX
First of all you must make sure that your page is using the title meta-description and meta-keywords tagsSecond you must adjust these tags content in order to include some of the primary keywords displayed above
lth1gt Headings StatusYour page contains H1 headings Their contents are listed below
Free Animated Gifs
lth2gt Headings StatusYour page contains H2 headings Their contents are listed below
Specials for you
Animated Gifs
Robotstxt TestCongratulations your site uses a robotstxt file and the URL is httpwwwgifmaniacarobotstxt You may want to use Googles robotstxt analysis tool to check that you are using valid syntax and confirm the directories that you are allowingblocking for robots
Sitemap TestCongratulations Your site has a sitemap file and the URL is httpwwwgifmaniacasitemapxml You may want to confirm that youve submitted your sitemap to Google and that it is correctly formatted
Favicon Test and ValidatorCongratulations Your website appears to have a favicon
Page ObjectsFaviconImage type unknownhttpwwwgifmaniacarecimgfaviconico
Total 76 Html pages 7 Images 32 Css files 3 Scripts 22 Css images 12 Video files 0Your page has more than 20 http requests which can slow down page loading You can try reducing http requests through various methods such as using text instead of images using css sprites using data URIs instead of images or combining several external files together into one
Html files 19494 Kbhttpwwwgifmaniaca
httpwwwgifmaniacareccsshomecss
[] C20Moviesampurl=http3A2F2Fwwwgifmaniaca2F
httpgoogleadsgdoubleclicknetpageadhtmlr20140424r20140417zrt_lookuphtml
[] nel=f369bcb24camporigin=http3A2F2Fwwwgifmaniaca+ Show More
CSS files 5172 Kbhttpwwwgifmaniacareccssstylescss
httpfontsgoogleapiscomcssfamily=Jockey+Oneampsubset=latinlatin-ext
httpfontsgoogleapiscomcssfamily=Chewy
Scripts 89512 Kbhttpassetspinterestcomjspinitjs
httpplatformtumblrcomv1sharejs
httpwwwgifmaniacarecjsvertical-alignjs
httpwwwgifmaniacarecjsjqueryeasing13js
httpwwwgifmaniacarecjsslider_gifmaniajs+ Show More
Images 268509 Kbhttpassetspinterestcomimagespidgetspin_it_buttonpng
httpplatformtumblrcomv1share_1png
httpwwwgifmaniacarecimghead_backgroundpng
httpwwwgifmaniacarecimgfondo_bodypng
httpwwwf-r-e-e-gamescomimgimgprevias3040gif+ Show More
Css Images 5277 Kbhttpwwwgifmaniacaimg0png
httpwwwgifmaniacaimg1png
httpwwwgifmaniacaimg2png
httpwwwgifmaniacaimg3png
httpwwwgifmaniacaimagesajax-loadergif+ Show More
4264 KB
476 KB
8475 KB
1078 KB
2354 KB
5122 KB
027 KB
023 KB
031 KB
168 KB
034 KB
791 KB
767 KB
089 KB
071 KB
285 KB
293 KB
366 KB
476 KB
476 KB
476 KB
476 KB
041 KB
Total Page Size 379 Mb
Largest Resourcehttpwwwgifmaniacarecimgslidersgamespng
Smallest Resource[] ct)7Cutmcmd3D(none)3Bamputmu=qAAAAAAAAAAAAAAAAAQ~
Code To Text RatioYour page size (source code) is 7122 Kb and your content text size is 398 Kb Your content text represents 559 from your webpage source code This is a low ratio and you might need to add more content
HOW TO FIX
In order to pass this test you must increse your text to HTML code ratio Here are some tehniques
move all inline styling rules into a external CSS filemove your JavaScript code into a external JS fileuse CSS layout instead of HTML tables
URL SEO Friendly TestThe URL and all links inside this page are SEO friendly
Broken Links TestYour page has 204 distinct anchor links A good practice is to keep the links to a reasonable number (under 100)
From 100 distinct anchor links analyzed none of them appears to be broken
Google Analytics TestCongratulations Your website is using the asynchronous version of Google Analytics tracking code
Underscores in Links TestCongratulations We have not found underscores in your in-page URLs
32917 KB
003 KB
Google PageRank TestYour Google PageRank is 1 and this value is below the average which is 3 Improving your Google PageRank (building quality backlinks) is very important if you want to improve your search engine rankings
Alexa Page Rank TestYour Alexa Rank (14613015) is above 100000 and the number of backlinks is 9 You might consider that your website should produce some more and good traffic For additional information about your Alexa traffic you might check this link
HOW TO FIX
Some best practices for increase your Alexa Page Rank are listed below
The most important thing is the content write useful and qualitative contentRegularly submit fresh and unique contentIncrease the traffic on your siteGenerate quality backlinks on your websiteConnect to social networking sitesInstall Alexa Toolbar on your browser and Alexa Rank Widget into your webpageVerify your website on Alexacom
Image Alt TestYour webpage has 17 images 13 of them are unique and all of them has an alt attribute
Inline CSS TestYour webpage is using 46 inline CSS properties
HOW TO FIX
Is a good practice to move all the inlines CSS rules into an external file in order to make your page lighter in weight and decreasing the code to text ratio
check the HTML code of your page and identify all style attributefor each style attribute found you must proper move all declarations in the external CSS file and remove the style attribute
For example
lt--this HTML code with inline CSS rule--gtltp style=colorred font-size 12pxgtsome text hereltpgtlt--would became--gtltpgtsome text hereltpgtlt--and the rule added into your CSS file--gtpcolorred font-size 12px
Media Print TestYour webpage doesnt take the advantages of media print CSS rule Here are some tips on how to set up a print style sheet
HOW TO FIX
For printing your webpage in a user-friendly format you can use one of these methods
1 Use a media print rule at the end of your CSS file (note that specificity and precedence rules still apply)Example
media print your print styles go here header footer menu display none body font 12pt georgiaserif h1 font-size 18pt h2 font-size 16pt color 000
2 Create and use a print stylesheet
ltlink rel=stylesheet href=printcss type=textcss media=print gt
The file printcss is the print stylesheet and the media=print command means that this CSS file only gets called up when your page is printed The only CSS rules you need to put in the print stylesheet are ones to override the CSS rules in the main stylesheet (you dont need to repeat any colour or branding CSS commands as theyll already be taken from the main stylesheet)
In order to decrease the HTTP requests we recommend method 1 for creating your print styles
Google PreviewAnimated Gifs ~ Cartoons Sports Love Terror Movies
httpwwwgifmaniaca
Animated Gifs of Cartoons and Movies Free Animated Gifs of Animated Cartoons Free Animations
Images Pictures Pics of Animated Images Animations Web Pages for Webmaster Canada
graphics Free Comics Games and TV Series Animated Gifs
Keywords Cloudactresses adventure algebra aliments animalsanimated animates animearts bars beaches bears cartoons characters chinese christmas clothes colorscompuserve computer confectionery create danger day design disaster disneydownload fantasy fathers female file films flowers fonts food format free funnygames ghosts gif gifmaniagifs gifts graduation halloween histories holidayshoroscope html image images its just knights lakes landscapes letters like lovemessages mothers movement movies musical networks objects office oops people platesplay presentation ready romantic sale scarecrow scares science screensaversseries share signs smileys social space supplies teddy text thanksgiving use usedvacations video wallpapers war warriors web zodiac
Deprecated HTML TagsCongratulations Your page does not use HTML deprecated tags
HTML Page Size TestCongratulations Your HTML size is 1188 Kb and this is under the average web page size of 33 KbThis helps lead to a faster than average page load time
HTML CompressionGZIP TestCongratulations Your page is successfully compressed using gzip compression on your codeYour HTML is compressed from 7122 Kb to 1188 Kb (83 size savings) This helps ensure a faster loading web page and improved user experience
Page Cache TestIt does not appear that you are caching your pages Cached pages serve up static html and avoid potentially time consuming queries to your database It also helps lower server load by up to 80 Caching most visibly benefits high traffic pages that access a database but whose content does not change on every page view Common caching methods include Alternative PHP Cache Quickcache and jpcache Caching mechanisms also typically compress HTML further reducing page size and load time
HOW TO FIX
In order to pass this test you are advised to use a caching mechanism for your pages There are three methods which can be used to caching your web pages
1 Alternative PHP caching
- Alternative PHP Cache (APC) is an open source framework which caches data using intermediate PHP code Most web programmers who are familiar with the PHP programming language can easily set up Alternative PHP Cache for your site
2 Quickcache- Quickcache is a lightweight page caching solution which was formerly known as jpcache Quickcache caches the page output rather than compiling the PHP page making it a superior version of page caching to the Alternative PHP caching Quickcache can be quickly downloaded from their website and can reduce your page load time up to 80
3 WP Super Cache- If you have a Wordpress website WP Super Cache can be installed within seconds and without no programming knowledge
Flash TestYour website contains flash objects
Nested Tables TestCongratulations your page does not use nested tables This speeds up page loading time and optimizes the user experience
Image Expires Tag TestCongratulations Your webpage use Expires header for your images and the browsers will display these images from the cache
Doctype TestYour website has a doctype declaration ltDOCTYPE htmlgt
Frameset TestCongratulations Your webpage does not use frames
Site Loading Speed TestYour site loading time is around 2445 seconds and this is under the average loading speed which is 5 seconds
JS and CSS Minification TestIts important to send as few bytes of CSS and JS markup down the wire as possible Its not just about size though its also about the number of requests to get the bits In fact thats often more of a problem then file size
JS Minification TestYou have more than one JS file Try combining them into one in order to decrease the number of HTTP requests
MINIFIED JS FILEShttpassetspinterestcomjspinit_mainjs
httpplatformtwittercomwidgetsjs
httpsapisgooglecomjsplusonejs
httpconnectfacebookneten_USalljs
httpwwwgoogle-analyticscomgajs
httpwwwgoogletagservicescomtagjsgptjs
httpwwwgifmaniacarecjsjquery-143minjs
httppartnergoogleadservicescomgptpubads_impl_37js
httppagead2googlesyndicationcompageadshow_adsjs
httpplatformtumblrcomv1sharejs
httplogpinterestcomvia=http3A2F2Fwwwgifmaniaca2Fampguid=wcKRQKYrYqZTamptype=pidgetampsub=wwwampbutton_count=1ampcallback=PIN_1398953924932fcallback[1]
NOT MINIFIED JS FILEShttpwwwgooglecomcoopcsebrandform=cse-search-boxamplang=en
httpwwwgifmaniacarecjsvertical-alignjs
httpwwwgifmaniacarecjsjqueryeasing13js
httpwwwgifmaniacarecjsslider_gifmaniajs
httpwwwgifmaniacarecjsslider_gifmania_containerjs
httpwwwgifmaniacarecjsparallax_positionjs
httpwwwgifmaniacarecjsparallaxjs
HOW TO FIX
In order to pass this test you must minify all of your external JavaScript files For this task you can use an online JS minifier like YUI Compressor Closure Compiler or JSMin
CSS Minification TestYou have more than one CSS file Try combining them into one in order to decrease the number of HTTP requests
NOT MINIFIED CSS FILEShttpwwwgifmaniacareccsshomecss
httpfontsgoogleapiscomcssfamily=Jockey+Oneampsubset=latinlatin-ext
httpwwwgifmaniacareccssstylescss
httpfontsgoogleapiscomcssfamily=Jockey+Oneampsubset=latinlatin-ext
httpfontsgoogleapiscomcssfamily=Chewy
HOW TO FIX
In order to pass this test you must minify all of your external CSS files For this task you can use an online CSS minifier like YUI Compressor or cssminjs
URL Canonicalization Testhttpwwwgifmaniaca and httpgifmaniaca resolve to the same URL
Directory Browsing TestCongratulations Your server has disabled directory browsing
Libwww-perl Access TestYour server appears to allow access from User-agent Libwww-perl Botnet scripts that automatically look for vulnerabilities in your software are sometimes identified as User-Agent libwww-perl By blocking access from libwww-perl you can eliminate many simpler attacks Read more on blocking Libwww-perl access and improving your websites security
HOW TO FIX
In order to pass this test you must block the libwww-perl user-agent in your htaccess file
If your site is running on apache server you could put these lines in your htaccessafter RewriteEngine on line
RewriteCond HTTP_USER_AGENT libwww-perl RewriteRule acirceuroldquo [FL]
Server Signature TestYour server signature is on Turning off your server signature is generally a good idea from a security standpoint Read more on how to turn off server signature and improve your websites security
Server Apache2225 (Unix) mod_ssl2225 OpenSSL100-fips PHP5217
HOW TO FIX
By default the Apache webserver sends HTTP headers with some information about your server version operating system modules installed etc These informations can be used by hackers in order to exploit vulnerabilities (specially if you are running an older version) These information can be hidden or changed with very basic configurations Open Apacheacirceurotrades configuration file (httpdconf or apacheconf) and search for ServerSignature If you find it edit it to
ServerSignature OffServerTokens Prod
If you dont find it just add these two lines at the end of the file Note that after you modify the configuration file you must restart the Apache server
Plaintext Emails TestCongratulations Your webpage does not include email addresses in plaintext
Website IP CheckYour website ip address is 1447619203
IP Canonicalization TestYour sites IP 1447619203 does not redirect to your sites domain name This could cause duplicate content problems if a search engine indexes your site under both its IP and domain name
HOW TO FIX
In order to pass this test you must consider using a 301 re-write rule in your htaccess file so that your sites IP points to your domain nameIf your site is running on apache server you could put these lines in your htaccessafter RewriteEngine on line
RewriteCond HTTP_HOST ^XXXXXXXXXXXXRewriteRule () httpwwwyourdomaincom$1 [R=301L]
Note that you must proper format the first line using your IP (replace X characters with proper digits from your IP) and the second line using your domain name
Safe Browsing TestThis site is not currently listed as suspicious (no malware or phishing activity found)
Media Query Responsive TestYour website is not using media queries You should consider using this technique in order to implement responsive design functionalities
HOW TO FIX
Media queries allow you to style elements for specific devices (smartphones tablets desktop computers) by using attributes like width height resolution aspect ratio orientation or color By using media queries presentations can be tailored to a specific range of output devices without changing the content itselfExample
ltlink rel=stylesheet media=screen and (min-width 480px) and (max-width 960px) href=480-960css gt
lt-- OR --gtmedia screen and (min-width 480px) and (max-width 960px) header display none
An media rule specifies the target media types of a set of statements In the example above we are specifying the media type screen The max-width and min-width features are telling the browser that at any screen size larger than 480px but smaller than 960px hide any elements with id=header
Mobile Snapshot
Social Media CheckCongratulations your website is connected successfuly with social media using FacebookTwitter Google Plus Pinterest
Social Media ActivityYour website doesnt have any social media activity Search engines are increasingly using social media activity to determine which pages are most relevant for keyword searches In order to increase your page rank and to increase revenue generated through organic search you are adviced to increase your website social media engagement
Facebook Likes 2 Facebook Shares 3 Facebook Comments 0
No activity on Twitter
Google PlusOnes 1
No activity on Pinterest
HOW TO FIX
In order to increase the social media activity for your site you are advised to use some social networks plugins within your page Facebook Like Button Facebook Share Button Facebook Comments Twitter Button Google +1 Button Pinterest Button or AddThis Widget
In order to pass this test you must include a meta-keywords tag in your page header (ltheadgt section)
ltheadgtltmeta name=keywords content=keyword1 keyword2 keyword3gtltheadgt
Separate keywords with commas and dont use any other punctuation beyond commasNote that in HTML the ltmetagt tag has no end tag but in XHTML this tag must be properly closed
Most Common Keywords TestIt appears that you can further optimize the density of your keywords above Various sourcesindicate that a safe keyword density should range between 2-4 for your targeted keywords
animated - 13 times - 289
gifs - 12 times - 267
free - 11 times - 244
file - 7 times - 156
games - 6 times - 133
HOW TO FIX
In order to pass this test you must optimize the density of your primary keywords displayed aboveIf the density of a specific keyword is below 2 you must increase it and if the density is over 4 you must decrease it
Keyword UsageYour most common keywords are not appearing in one or more of the meta-tags above Your primary keywords should appear in your meta-tags to help identify the topic of your webpage to search engines
Keyword(s) included in Meta-Title Tag
Keyword(s) included in Meta-Description Tag
Keyword(s) not included in Meta-Keywords Tag
HOW TO FIX
First of all you must make sure that your page is using the title meta-description and meta-keywords tagsSecond you must adjust these tags content in order to include some of the primary keywords displayed above
lth1gt Headings StatusYour page contains H1 headings Their contents are listed below
Free Animated Gifs
lth2gt Headings StatusYour page contains H2 headings Their contents are listed below
Specials for you
Animated Gifs
Robotstxt TestCongratulations your site uses a robotstxt file and the URL is httpwwwgifmaniacarobotstxt You may want to use Googles robotstxt analysis tool to check that you are using valid syntax and confirm the directories that you are allowingblocking for robots
Sitemap TestCongratulations Your site has a sitemap file and the URL is httpwwwgifmaniacasitemapxml You may want to confirm that youve submitted your sitemap to Google and that it is correctly formatted
Favicon Test and ValidatorCongratulations Your website appears to have a favicon
Page ObjectsFaviconImage type unknownhttpwwwgifmaniacarecimgfaviconico
Total 76 Html pages 7 Images 32 Css files 3 Scripts 22 Css images 12 Video files 0Your page has more than 20 http requests which can slow down page loading You can try reducing http requests through various methods such as using text instead of images using css sprites using data URIs instead of images or combining several external files together into one
Html files 19494 Kbhttpwwwgifmaniaca
httpwwwgifmaniacareccsshomecss
[] C20Moviesampurl=http3A2F2Fwwwgifmaniaca2F
httpgoogleadsgdoubleclicknetpageadhtmlr20140424r20140417zrt_lookuphtml
[] nel=f369bcb24camporigin=http3A2F2Fwwwgifmaniaca+ Show More
CSS files 5172 Kbhttpwwwgifmaniacareccssstylescss
httpfontsgoogleapiscomcssfamily=Jockey+Oneampsubset=latinlatin-ext
httpfontsgoogleapiscomcssfamily=Chewy
Scripts 89512 Kbhttpassetspinterestcomjspinitjs
httpplatformtumblrcomv1sharejs
httpwwwgifmaniacarecjsvertical-alignjs
httpwwwgifmaniacarecjsjqueryeasing13js
httpwwwgifmaniacarecjsslider_gifmaniajs+ Show More
Images 268509 Kbhttpassetspinterestcomimagespidgetspin_it_buttonpng
httpplatformtumblrcomv1share_1png
httpwwwgifmaniacarecimghead_backgroundpng
httpwwwgifmaniacarecimgfondo_bodypng
httpwwwf-r-e-e-gamescomimgimgprevias3040gif+ Show More
Css Images 5277 Kbhttpwwwgifmaniacaimg0png
httpwwwgifmaniacaimg1png
httpwwwgifmaniacaimg2png
httpwwwgifmaniacaimg3png
httpwwwgifmaniacaimagesajax-loadergif+ Show More
4264 KB
476 KB
8475 KB
1078 KB
2354 KB
5122 KB
027 KB
023 KB
031 KB
168 KB
034 KB
791 KB
767 KB
089 KB
071 KB
285 KB
293 KB
366 KB
476 KB
476 KB
476 KB
476 KB
041 KB
Total Page Size 379 Mb
Largest Resourcehttpwwwgifmaniacarecimgslidersgamespng
Smallest Resource[] ct)7Cutmcmd3D(none)3Bamputmu=qAAAAAAAAAAAAAAAAAQ~
Code To Text RatioYour page size (source code) is 7122 Kb and your content text size is 398 Kb Your content text represents 559 from your webpage source code This is a low ratio and you might need to add more content
HOW TO FIX
In order to pass this test you must increse your text to HTML code ratio Here are some tehniques
move all inline styling rules into a external CSS filemove your JavaScript code into a external JS fileuse CSS layout instead of HTML tables
URL SEO Friendly TestThe URL and all links inside this page are SEO friendly
Broken Links TestYour page has 204 distinct anchor links A good practice is to keep the links to a reasonable number (under 100)
From 100 distinct anchor links analyzed none of them appears to be broken
Google Analytics TestCongratulations Your website is using the asynchronous version of Google Analytics tracking code
Underscores in Links TestCongratulations We have not found underscores in your in-page URLs
32917 KB
003 KB
Google PageRank TestYour Google PageRank is 1 and this value is below the average which is 3 Improving your Google PageRank (building quality backlinks) is very important if you want to improve your search engine rankings
Alexa Page Rank TestYour Alexa Rank (14613015) is above 100000 and the number of backlinks is 9 You might consider that your website should produce some more and good traffic For additional information about your Alexa traffic you might check this link
HOW TO FIX
Some best practices for increase your Alexa Page Rank are listed below
The most important thing is the content write useful and qualitative contentRegularly submit fresh and unique contentIncrease the traffic on your siteGenerate quality backlinks on your websiteConnect to social networking sitesInstall Alexa Toolbar on your browser and Alexa Rank Widget into your webpageVerify your website on Alexacom
Image Alt TestYour webpage has 17 images 13 of them are unique and all of them has an alt attribute
Inline CSS TestYour webpage is using 46 inline CSS properties
HOW TO FIX
Is a good practice to move all the inlines CSS rules into an external file in order to make your page lighter in weight and decreasing the code to text ratio
check the HTML code of your page and identify all style attributefor each style attribute found you must proper move all declarations in the external CSS file and remove the style attribute
For example
lt--this HTML code with inline CSS rule--gtltp style=colorred font-size 12pxgtsome text hereltpgtlt--would became--gtltpgtsome text hereltpgtlt--and the rule added into your CSS file--gtpcolorred font-size 12px
Media Print TestYour webpage doesnt take the advantages of media print CSS rule Here are some tips on how to set up a print style sheet
HOW TO FIX
For printing your webpage in a user-friendly format you can use one of these methods
1 Use a media print rule at the end of your CSS file (note that specificity and precedence rules still apply)Example
media print your print styles go here header footer menu display none body font 12pt georgiaserif h1 font-size 18pt h2 font-size 16pt color 000
2 Create and use a print stylesheet
ltlink rel=stylesheet href=printcss type=textcss media=print gt
The file printcss is the print stylesheet and the media=print command means that this CSS file only gets called up when your page is printed The only CSS rules you need to put in the print stylesheet are ones to override the CSS rules in the main stylesheet (you dont need to repeat any colour or branding CSS commands as theyll already be taken from the main stylesheet)
In order to decrease the HTTP requests we recommend method 1 for creating your print styles
Google PreviewAnimated Gifs ~ Cartoons Sports Love Terror Movies
httpwwwgifmaniaca
Animated Gifs of Cartoons and Movies Free Animated Gifs of Animated Cartoons Free Animations
Images Pictures Pics of Animated Images Animations Web Pages for Webmaster Canada
graphics Free Comics Games and TV Series Animated Gifs
Keywords Cloudactresses adventure algebra aliments animalsanimated animates animearts bars beaches bears cartoons characters chinese christmas clothes colorscompuserve computer confectionery create danger day design disaster disneydownload fantasy fathers female file films flowers fonts food format free funnygames ghosts gif gifmaniagifs gifts graduation halloween histories holidayshoroscope html image images its just knights lakes landscapes letters like lovemessages mothers movement movies musical networks objects office oops people platesplay presentation ready romantic sale scarecrow scares science screensaversseries share signs smileys social space supplies teddy text thanksgiving use usedvacations video wallpapers war warriors web zodiac
Deprecated HTML TagsCongratulations Your page does not use HTML deprecated tags
HTML Page Size TestCongratulations Your HTML size is 1188 Kb and this is under the average web page size of 33 KbThis helps lead to a faster than average page load time
HTML CompressionGZIP TestCongratulations Your page is successfully compressed using gzip compression on your codeYour HTML is compressed from 7122 Kb to 1188 Kb (83 size savings) This helps ensure a faster loading web page and improved user experience
Page Cache TestIt does not appear that you are caching your pages Cached pages serve up static html and avoid potentially time consuming queries to your database It also helps lower server load by up to 80 Caching most visibly benefits high traffic pages that access a database but whose content does not change on every page view Common caching methods include Alternative PHP Cache Quickcache and jpcache Caching mechanisms also typically compress HTML further reducing page size and load time
HOW TO FIX
In order to pass this test you are advised to use a caching mechanism for your pages There are three methods which can be used to caching your web pages
1 Alternative PHP caching
- Alternative PHP Cache (APC) is an open source framework which caches data using intermediate PHP code Most web programmers who are familiar with the PHP programming language can easily set up Alternative PHP Cache for your site
2 Quickcache- Quickcache is a lightweight page caching solution which was formerly known as jpcache Quickcache caches the page output rather than compiling the PHP page making it a superior version of page caching to the Alternative PHP caching Quickcache can be quickly downloaded from their website and can reduce your page load time up to 80
3 WP Super Cache- If you have a Wordpress website WP Super Cache can be installed within seconds and without no programming knowledge
Flash TestYour website contains flash objects
Nested Tables TestCongratulations your page does not use nested tables This speeds up page loading time and optimizes the user experience
Image Expires Tag TestCongratulations Your webpage use Expires header for your images and the browsers will display these images from the cache
Doctype TestYour website has a doctype declaration ltDOCTYPE htmlgt
Frameset TestCongratulations Your webpage does not use frames
Site Loading Speed TestYour site loading time is around 2445 seconds and this is under the average loading speed which is 5 seconds
JS and CSS Minification TestIts important to send as few bytes of CSS and JS markup down the wire as possible Its not just about size though its also about the number of requests to get the bits In fact thats often more of a problem then file size
JS Minification TestYou have more than one JS file Try combining them into one in order to decrease the number of HTTP requests
MINIFIED JS FILEShttpassetspinterestcomjspinit_mainjs
httpplatformtwittercomwidgetsjs
httpsapisgooglecomjsplusonejs
httpconnectfacebookneten_USalljs
httpwwwgoogle-analyticscomgajs
httpwwwgoogletagservicescomtagjsgptjs
httpwwwgifmaniacarecjsjquery-143minjs
httppartnergoogleadservicescomgptpubads_impl_37js
httppagead2googlesyndicationcompageadshow_adsjs
httpplatformtumblrcomv1sharejs
httplogpinterestcomvia=http3A2F2Fwwwgifmaniaca2Fampguid=wcKRQKYrYqZTamptype=pidgetampsub=wwwampbutton_count=1ampcallback=PIN_1398953924932fcallback[1]
NOT MINIFIED JS FILEShttpwwwgooglecomcoopcsebrandform=cse-search-boxamplang=en
httpwwwgifmaniacarecjsvertical-alignjs
httpwwwgifmaniacarecjsjqueryeasing13js
httpwwwgifmaniacarecjsslider_gifmaniajs
httpwwwgifmaniacarecjsslider_gifmania_containerjs
httpwwwgifmaniacarecjsparallax_positionjs
httpwwwgifmaniacarecjsparallaxjs
HOW TO FIX
In order to pass this test you must minify all of your external JavaScript files For this task you can use an online JS minifier like YUI Compressor Closure Compiler or JSMin
CSS Minification TestYou have more than one CSS file Try combining them into one in order to decrease the number of HTTP requests
NOT MINIFIED CSS FILEShttpwwwgifmaniacareccsshomecss
httpfontsgoogleapiscomcssfamily=Jockey+Oneampsubset=latinlatin-ext
httpwwwgifmaniacareccssstylescss
httpfontsgoogleapiscomcssfamily=Jockey+Oneampsubset=latinlatin-ext
httpfontsgoogleapiscomcssfamily=Chewy
HOW TO FIX
In order to pass this test you must minify all of your external CSS files For this task you can use an online CSS minifier like YUI Compressor or cssminjs
URL Canonicalization Testhttpwwwgifmaniaca and httpgifmaniaca resolve to the same URL
Directory Browsing TestCongratulations Your server has disabled directory browsing
Libwww-perl Access TestYour server appears to allow access from User-agent Libwww-perl Botnet scripts that automatically look for vulnerabilities in your software are sometimes identified as User-Agent libwww-perl By blocking access from libwww-perl you can eliminate many simpler attacks Read more on blocking Libwww-perl access and improving your websites security
HOW TO FIX
In order to pass this test you must block the libwww-perl user-agent in your htaccess file
If your site is running on apache server you could put these lines in your htaccessafter RewriteEngine on line
RewriteCond HTTP_USER_AGENT libwww-perl RewriteRule acirceuroldquo [FL]
Server Signature TestYour server signature is on Turning off your server signature is generally a good idea from a security standpoint Read more on how to turn off server signature and improve your websites security
Server Apache2225 (Unix) mod_ssl2225 OpenSSL100-fips PHP5217
HOW TO FIX
By default the Apache webserver sends HTTP headers with some information about your server version operating system modules installed etc These informations can be used by hackers in order to exploit vulnerabilities (specially if you are running an older version) These information can be hidden or changed with very basic configurations Open Apacheacirceurotrades configuration file (httpdconf or apacheconf) and search for ServerSignature If you find it edit it to
ServerSignature OffServerTokens Prod
If you dont find it just add these two lines at the end of the file Note that after you modify the configuration file you must restart the Apache server
Plaintext Emails TestCongratulations Your webpage does not include email addresses in plaintext
Website IP CheckYour website ip address is 1447619203
IP Canonicalization TestYour sites IP 1447619203 does not redirect to your sites domain name This could cause duplicate content problems if a search engine indexes your site under both its IP and domain name
HOW TO FIX
In order to pass this test you must consider using a 301 re-write rule in your htaccess file so that your sites IP points to your domain nameIf your site is running on apache server you could put these lines in your htaccessafter RewriteEngine on line
RewriteCond HTTP_HOST ^XXXXXXXXXXXXRewriteRule () httpwwwyourdomaincom$1 [R=301L]
Note that you must proper format the first line using your IP (replace X characters with proper digits from your IP) and the second line using your domain name
Safe Browsing TestThis site is not currently listed as suspicious (no malware or phishing activity found)
Media Query Responsive TestYour website is not using media queries You should consider using this technique in order to implement responsive design functionalities
HOW TO FIX
Media queries allow you to style elements for specific devices (smartphones tablets desktop computers) by using attributes like width height resolution aspect ratio orientation or color By using media queries presentations can be tailored to a specific range of output devices without changing the content itselfExample
ltlink rel=stylesheet media=screen and (min-width 480px) and (max-width 960px) href=480-960css gt
lt-- OR --gtmedia screen and (min-width 480px) and (max-width 960px) header display none
An media rule specifies the target media types of a set of statements In the example above we are specifying the media type screen The max-width and min-width features are telling the browser that at any screen size larger than 480px but smaller than 960px hide any elements with id=header
Mobile Snapshot
Social Media CheckCongratulations your website is connected successfuly with social media using FacebookTwitter Google Plus Pinterest
Social Media ActivityYour website doesnt have any social media activity Search engines are increasingly using social media activity to determine which pages are most relevant for keyword searches In order to increase your page rank and to increase revenue generated through organic search you are adviced to increase your website social media engagement
Facebook Likes 2 Facebook Shares 3 Facebook Comments 0
No activity on Twitter
Google PlusOnes 1
No activity on Pinterest
HOW TO FIX
In order to increase the social media activity for your site you are advised to use some social networks plugins within your page Facebook Like Button Facebook Share Button Facebook Comments Twitter Button Google +1 Button Pinterest Button or AddThis Widget
HOW TO FIX
First of all you must make sure that your page is using the title meta-description and meta-keywords tagsSecond you must adjust these tags content in order to include some of the primary keywords displayed above
lth1gt Headings StatusYour page contains H1 headings Their contents are listed below
Free Animated Gifs
lth2gt Headings StatusYour page contains H2 headings Their contents are listed below
Specials for you
Animated Gifs
Robotstxt TestCongratulations your site uses a robotstxt file and the URL is httpwwwgifmaniacarobotstxt You may want to use Googles robotstxt analysis tool to check that you are using valid syntax and confirm the directories that you are allowingblocking for robots
Sitemap TestCongratulations Your site has a sitemap file and the URL is httpwwwgifmaniacasitemapxml You may want to confirm that youve submitted your sitemap to Google and that it is correctly formatted
Favicon Test and ValidatorCongratulations Your website appears to have a favicon
Page ObjectsFaviconImage type unknownhttpwwwgifmaniacarecimgfaviconico
Total 76 Html pages 7 Images 32 Css files 3 Scripts 22 Css images 12 Video files 0Your page has more than 20 http requests which can slow down page loading You can try reducing http requests through various methods such as using text instead of images using css sprites using data URIs instead of images or combining several external files together into one
Html files 19494 Kbhttpwwwgifmaniaca
httpwwwgifmaniacareccsshomecss
[] C20Moviesampurl=http3A2F2Fwwwgifmaniaca2F
httpgoogleadsgdoubleclicknetpageadhtmlr20140424r20140417zrt_lookuphtml
[] nel=f369bcb24camporigin=http3A2F2Fwwwgifmaniaca+ Show More
CSS files 5172 Kbhttpwwwgifmaniacareccssstylescss
httpfontsgoogleapiscomcssfamily=Jockey+Oneampsubset=latinlatin-ext
httpfontsgoogleapiscomcssfamily=Chewy
Scripts 89512 Kbhttpassetspinterestcomjspinitjs
httpplatformtumblrcomv1sharejs
httpwwwgifmaniacarecjsvertical-alignjs
httpwwwgifmaniacarecjsjqueryeasing13js
httpwwwgifmaniacarecjsslider_gifmaniajs+ Show More
Images 268509 Kbhttpassetspinterestcomimagespidgetspin_it_buttonpng
httpplatformtumblrcomv1share_1png
httpwwwgifmaniacarecimghead_backgroundpng
httpwwwgifmaniacarecimgfondo_bodypng
httpwwwf-r-e-e-gamescomimgimgprevias3040gif+ Show More
Css Images 5277 Kbhttpwwwgifmaniacaimg0png
httpwwwgifmaniacaimg1png
httpwwwgifmaniacaimg2png
httpwwwgifmaniacaimg3png
httpwwwgifmaniacaimagesajax-loadergif+ Show More
4264 KB
476 KB
8475 KB
1078 KB
2354 KB
5122 KB
027 KB
023 KB
031 KB
168 KB
034 KB
791 KB
767 KB
089 KB
071 KB
285 KB
293 KB
366 KB
476 KB
476 KB
476 KB
476 KB
041 KB
Total Page Size 379 Mb
Largest Resourcehttpwwwgifmaniacarecimgslidersgamespng
Smallest Resource[] ct)7Cutmcmd3D(none)3Bamputmu=qAAAAAAAAAAAAAAAAAQ~
Code To Text RatioYour page size (source code) is 7122 Kb and your content text size is 398 Kb Your content text represents 559 from your webpage source code This is a low ratio and you might need to add more content
HOW TO FIX
In order to pass this test you must increse your text to HTML code ratio Here are some tehniques
move all inline styling rules into a external CSS filemove your JavaScript code into a external JS fileuse CSS layout instead of HTML tables
URL SEO Friendly TestThe URL and all links inside this page are SEO friendly
Broken Links TestYour page has 204 distinct anchor links A good practice is to keep the links to a reasonable number (under 100)
From 100 distinct anchor links analyzed none of them appears to be broken
Google Analytics TestCongratulations Your website is using the asynchronous version of Google Analytics tracking code
Underscores in Links TestCongratulations We have not found underscores in your in-page URLs
32917 KB
003 KB
Google PageRank TestYour Google PageRank is 1 and this value is below the average which is 3 Improving your Google PageRank (building quality backlinks) is very important if you want to improve your search engine rankings
Alexa Page Rank TestYour Alexa Rank (14613015) is above 100000 and the number of backlinks is 9 You might consider that your website should produce some more and good traffic For additional information about your Alexa traffic you might check this link
HOW TO FIX
Some best practices for increase your Alexa Page Rank are listed below
The most important thing is the content write useful and qualitative contentRegularly submit fresh and unique contentIncrease the traffic on your siteGenerate quality backlinks on your websiteConnect to social networking sitesInstall Alexa Toolbar on your browser and Alexa Rank Widget into your webpageVerify your website on Alexacom
Image Alt TestYour webpage has 17 images 13 of them are unique and all of them has an alt attribute
Inline CSS TestYour webpage is using 46 inline CSS properties
HOW TO FIX
Is a good practice to move all the inlines CSS rules into an external file in order to make your page lighter in weight and decreasing the code to text ratio
check the HTML code of your page and identify all style attributefor each style attribute found you must proper move all declarations in the external CSS file and remove the style attribute
For example
lt--this HTML code with inline CSS rule--gtltp style=colorred font-size 12pxgtsome text hereltpgtlt--would became--gtltpgtsome text hereltpgtlt--and the rule added into your CSS file--gtpcolorred font-size 12px
Media Print TestYour webpage doesnt take the advantages of media print CSS rule Here are some tips on how to set up a print style sheet
HOW TO FIX
For printing your webpage in a user-friendly format you can use one of these methods
1 Use a media print rule at the end of your CSS file (note that specificity and precedence rules still apply)Example
media print your print styles go here header footer menu display none body font 12pt georgiaserif h1 font-size 18pt h2 font-size 16pt color 000
2 Create and use a print stylesheet
ltlink rel=stylesheet href=printcss type=textcss media=print gt
The file printcss is the print stylesheet and the media=print command means that this CSS file only gets called up when your page is printed The only CSS rules you need to put in the print stylesheet are ones to override the CSS rules in the main stylesheet (you dont need to repeat any colour or branding CSS commands as theyll already be taken from the main stylesheet)
In order to decrease the HTTP requests we recommend method 1 for creating your print styles
Google PreviewAnimated Gifs ~ Cartoons Sports Love Terror Movies
httpwwwgifmaniaca
Animated Gifs of Cartoons and Movies Free Animated Gifs of Animated Cartoons Free Animations
Images Pictures Pics of Animated Images Animations Web Pages for Webmaster Canada
graphics Free Comics Games and TV Series Animated Gifs
Keywords Cloudactresses adventure algebra aliments animalsanimated animates animearts bars beaches bears cartoons characters chinese christmas clothes colorscompuserve computer confectionery create danger day design disaster disneydownload fantasy fathers female file films flowers fonts food format free funnygames ghosts gif gifmaniagifs gifts graduation halloween histories holidayshoroscope html image images its just knights lakes landscapes letters like lovemessages mothers movement movies musical networks objects office oops people platesplay presentation ready romantic sale scarecrow scares science screensaversseries share signs smileys social space supplies teddy text thanksgiving use usedvacations video wallpapers war warriors web zodiac
Deprecated HTML TagsCongratulations Your page does not use HTML deprecated tags
HTML Page Size TestCongratulations Your HTML size is 1188 Kb and this is under the average web page size of 33 KbThis helps lead to a faster than average page load time
HTML CompressionGZIP TestCongratulations Your page is successfully compressed using gzip compression on your codeYour HTML is compressed from 7122 Kb to 1188 Kb (83 size savings) This helps ensure a faster loading web page and improved user experience
Page Cache TestIt does not appear that you are caching your pages Cached pages serve up static html and avoid potentially time consuming queries to your database It also helps lower server load by up to 80 Caching most visibly benefits high traffic pages that access a database but whose content does not change on every page view Common caching methods include Alternative PHP Cache Quickcache and jpcache Caching mechanisms also typically compress HTML further reducing page size and load time
HOW TO FIX
In order to pass this test you are advised to use a caching mechanism for your pages There are three methods which can be used to caching your web pages
1 Alternative PHP caching
- Alternative PHP Cache (APC) is an open source framework which caches data using intermediate PHP code Most web programmers who are familiar with the PHP programming language can easily set up Alternative PHP Cache for your site
2 Quickcache- Quickcache is a lightweight page caching solution which was formerly known as jpcache Quickcache caches the page output rather than compiling the PHP page making it a superior version of page caching to the Alternative PHP caching Quickcache can be quickly downloaded from their website and can reduce your page load time up to 80
3 WP Super Cache- If you have a Wordpress website WP Super Cache can be installed within seconds and without no programming knowledge
Flash TestYour website contains flash objects
Nested Tables TestCongratulations your page does not use nested tables This speeds up page loading time and optimizes the user experience
Image Expires Tag TestCongratulations Your webpage use Expires header for your images and the browsers will display these images from the cache
Doctype TestYour website has a doctype declaration ltDOCTYPE htmlgt
Frameset TestCongratulations Your webpage does not use frames
Site Loading Speed TestYour site loading time is around 2445 seconds and this is under the average loading speed which is 5 seconds
JS and CSS Minification TestIts important to send as few bytes of CSS and JS markup down the wire as possible Its not just about size though its also about the number of requests to get the bits In fact thats often more of a problem then file size
JS Minification TestYou have more than one JS file Try combining them into one in order to decrease the number of HTTP requests
MINIFIED JS FILEShttpassetspinterestcomjspinit_mainjs
httpplatformtwittercomwidgetsjs
httpsapisgooglecomjsplusonejs
httpconnectfacebookneten_USalljs
httpwwwgoogle-analyticscomgajs
httpwwwgoogletagservicescomtagjsgptjs
httpwwwgifmaniacarecjsjquery-143minjs
httppartnergoogleadservicescomgptpubads_impl_37js
httppagead2googlesyndicationcompageadshow_adsjs
httpplatformtumblrcomv1sharejs
httplogpinterestcomvia=http3A2F2Fwwwgifmaniaca2Fampguid=wcKRQKYrYqZTamptype=pidgetampsub=wwwampbutton_count=1ampcallback=PIN_1398953924932fcallback[1]
NOT MINIFIED JS FILEShttpwwwgooglecomcoopcsebrandform=cse-search-boxamplang=en
httpwwwgifmaniacarecjsvertical-alignjs
httpwwwgifmaniacarecjsjqueryeasing13js
httpwwwgifmaniacarecjsslider_gifmaniajs
httpwwwgifmaniacarecjsslider_gifmania_containerjs
httpwwwgifmaniacarecjsparallax_positionjs
httpwwwgifmaniacarecjsparallaxjs
HOW TO FIX
In order to pass this test you must minify all of your external JavaScript files For this task you can use an online JS minifier like YUI Compressor Closure Compiler or JSMin
CSS Minification TestYou have more than one CSS file Try combining them into one in order to decrease the number of HTTP requests
NOT MINIFIED CSS FILEShttpwwwgifmaniacareccsshomecss
httpfontsgoogleapiscomcssfamily=Jockey+Oneampsubset=latinlatin-ext
httpwwwgifmaniacareccssstylescss
httpfontsgoogleapiscomcssfamily=Jockey+Oneampsubset=latinlatin-ext
httpfontsgoogleapiscomcssfamily=Chewy
HOW TO FIX
In order to pass this test you must minify all of your external CSS files For this task you can use an online CSS minifier like YUI Compressor or cssminjs
URL Canonicalization Testhttpwwwgifmaniaca and httpgifmaniaca resolve to the same URL
Directory Browsing TestCongratulations Your server has disabled directory browsing
Libwww-perl Access TestYour server appears to allow access from User-agent Libwww-perl Botnet scripts that automatically look for vulnerabilities in your software are sometimes identified as User-Agent libwww-perl By blocking access from libwww-perl you can eliminate many simpler attacks Read more on blocking Libwww-perl access and improving your websites security
HOW TO FIX
In order to pass this test you must block the libwww-perl user-agent in your htaccess file
If your site is running on apache server you could put these lines in your htaccessafter RewriteEngine on line
RewriteCond HTTP_USER_AGENT libwww-perl RewriteRule acirceuroldquo [FL]
Server Signature TestYour server signature is on Turning off your server signature is generally a good idea from a security standpoint Read more on how to turn off server signature and improve your websites security
Server Apache2225 (Unix) mod_ssl2225 OpenSSL100-fips PHP5217
HOW TO FIX
By default the Apache webserver sends HTTP headers with some information about your server version operating system modules installed etc These informations can be used by hackers in order to exploit vulnerabilities (specially if you are running an older version) These information can be hidden or changed with very basic configurations Open Apacheacirceurotrades configuration file (httpdconf or apacheconf) and search for ServerSignature If you find it edit it to
ServerSignature OffServerTokens Prod
If you dont find it just add these two lines at the end of the file Note that after you modify the configuration file you must restart the Apache server
Plaintext Emails TestCongratulations Your webpage does not include email addresses in plaintext
Website IP CheckYour website ip address is 1447619203
IP Canonicalization TestYour sites IP 1447619203 does not redirect to your sites domain name This could cause duplicate content problems if a search engine indexes your site under both its IP and domain name
HOW TO FIX
In order to pass this test you must consider using a 301 re-write rule in your htaccess file so that your sites IP points to your domain nameIf your site is running on apache server you could put these lines in your htaccessafter RewriteEngine on line
RewriteCond HTTP_HOST ^XXXXXXXXXXXXRewriteRule () httpwwwyourdomaincom$1 [R=301L]
Note that you must proper format the first line using your IP (replace X characters with proper digits from your IP) and the second line using your domain name
Safe Browsing TestThis site is not currently listed as suspicious (no malware or phishing activity found)
Media Query Responsive TestYour website is not using media queries You should consider using this technique in order to implement responsive design functionalities
HOW TO FIX
Media queries allow you to style elements for specific devices (smartphones tablets desktop computers) by using attributes like width height resolution aspect ratio orientation or color By using media queries presentations can be tailored to a specific range of output devices without changing the content itselfExample
ltlink rel=stylesheet media=screen and (min-width 480px) and (max-width 960px) href=480-960css gt
lt-- OR --gtmedia screen and (min-width 480px) and (max-width 960px) header display none
An media rule specifies the target media types of a set of statements In the example above we are specifying the media type screen The max-width and min-width features are telling the browser that at any screen size larger than 480px but smaller than 960px hide any elements with id=header
Mobile Snapshot
Social Media CheckCongratulations your website is connected successfuly with social media using FacebookTwitter Google Plus Pinterest
Social Media ActivityYour website doesnt have any social media activity Search engines are increasingly using social media activity to determine which pages are most relevant for keyword searches In order to increase your page rank and to increase revenue generated through organic search you are adviced to increase your website social media engagement
Facebook Likes 2 Facebook Shares 3 Facebook Comments 0
No activity on Twitter
Google PlusOnes 1
No activity on Pinterest
HOW TO FIX
In order to increase the social media activity for your site you are advised to use some social networks plugins within your page Facebook Like Button Facebook Share Button Facebook Comments Twitter Button Google +1 Button Pinterest Button or AddThis Widget
Total 76 Html pages 7 Images 32 Css files 3 Scripts 22 Css images 12 Video files 0Your page has more than 20 http requests which can slow down page loading You can try reducing http requests through various methods such as using text instead of images using css sprites using data URIs instead of images or combining several external files together into one
Html files 19494 Kbhttpwwwgifmaniaca
httpwwwgifmaniacareccsshomecss
[] C20Moviesampurl=http3A2F2Fwwwgifmaniaca2F
httpgoogleadsgdoubleclicknetpageadhtmlr20140424r20140417zrt_lookuphtml
[] nel=f369bcb24camporigin=http3A2F2Fwwwgifmaniaca+ Show More
CSS files 5172 Kbhttpwwwgifmaniacareccssstylescss
httpfontsgoogleapiscomcssfamily=Jockey+Oneampsubset=latinlatin-ext
httpfontsgoogleapiscomcssfamily=Chewy
Scripts 89512 Kbhttpassetspinterestcomjspinitjs
httpplatformtumblrcomv1sharejs
httpwwwgifmaniacarecjsvertical-alignjs
httpwwwgifmaniacarecjsjqueryeasing13js
httpwwwgifmaniacarecjsslider_gifmaniajs+ Show More
Images 268509 Kbhttpassetspinterestcomimagespidgetspin_it_buttonpng
httpplatformtumblrcomv1share_1png
httpwwwgifmaniacarecimghead_backgroundpng
httpwwwgifmaniacarecimgfondo_bodypng
httpwwwf-r-e-e-gamescomimgimgprevias3040gif+ Show More
Css Images 5277 Kbhttpwwwgifmaniacaimg0png
httpwwwgifmaniacaimg1png
httpwwwgifmaniacaimg2png
httpwwwgifmaniacaimg3png
httpwwwgifmaniacaimagesajax-loadergif+ Show More
4264 KB
476 KB
8475 KB
1078 KB
2354 KB
5122 KB
027 KB
023 KB
031 KB
168 KB
034 KB
791 KB
767 KB
089 KB
071 KB
285 KB
293 KB
366 KB
476 KB
476 KB
476 KB
476 KB
041 KB
Total Page Size 379 Mb
Largest Resourcehttpwwwgifmaniacarecimgslidersgamespng
Smallest Resource[] ct)7Cutmcmd3D(none)3Bamputmu=qAAAAAAAAAAAAAAAAAQ~
Code To Text RatioYour page size (source code) is 7122 Kb and your content text size is 398 Kb Your content text represents 559 from your webpage source code This is a low ratio and you might need to add more content
HOW TO FIX
In order to pass this test you must increse your text to HTML code ratio Here are some tehniques
move all inline styling rules into a external CSS filemove your JavaScript code into a external JS fileuse CSS layout instead of HTML tables
URL SEO Friendly TestThe URL and all links inside this page are SEO friendly
Broken Links TestYour page has 204 distinct anchor links A good practice is to keep the links to a reasonable number (under 100)
From 100 distinct anchor links analyzed none of them appears to be broken
Google Analytics TestCongratulations Your website is using the asynchronous version of Google Analytics tracking code
Underscores in Links TestCongratulations We have not found underscores in your in-page URLs
32917 KB
003 KB
Google PageRank TestYour Google PageRank is 1 and this value is below the average which is 3 Improving your Google PageRank (building quality backlinks) is very important if you want to improve your search engine rankings
Alexa Page Rank TestYour Alexa Rank (14613015) is above 100000 and the number of backlinks is 9 You might consider that your website should produce some more and good traffic For additional information about your Alexa traffic you might check this link
HOW TO FIX
Some best practices for increase your Alexa Page Rank are listed below
The most important thing is the content write useful and qualitative contentRegularly submit fresh and unique contentIncrease the traffic on your siteGenerate quality backlinks on your websiteConnect to social networking sitesInstall Alexa Toolbar on your browser and Alexa Rank Widget into your webpageVerify your website on Alexacom
Image Alt TestYour webpage has 17 images 13 of them are unique and all of them has an alt attribute
Inline CSS TestYour webpage is using 46 inline CSS properties
HOW TO FIX
Is a good practice to move all the inlines CSS rules into an external file in order to make your page lighter in weight and decreasing the code to text ratio
check the HTML code of your page and identify all style attributefor each style attribute found you must proper move all declarations in the external CSS file and remove the style attribute
For example
lt--this HTML code with inline CSS rule--gtltp style=colorred font-size 12pxgtsome text hereltpgtlt--would became--gtltpgtsome text hereltpgtlt--and the rule added into your CSS file--gtpcolorred font-size 12px
Media Print TestYour webpage doesnt take the advantages of media print CSS rule Here are some tips on how to set up a print style sheet
HOW TO FIX
For printing your webpage in a user-friendly format you can use one of these methods
1 Use a media print rule at the end of your CSS file (note that specificity and precedence rules still apply)Example
media print your print styles go here header footer menu display none body font 12pt georgiaserif h1 font-size 18pt h2 font-size 16pt color 000
2 Create and use a print stylesheet
ltlink rel=stylesheet href=printcss type=textcss media=print gt
The file printcss is the print stylesheet and the media=print command means that this CSS file only gets called up when your page is printed The only CSS rules you need to put in the print stylesheet are ones to override the CSS rules in the main stylesheet (you dont need to repeat any colour or branding CSS commands as theyll already be taken from the main stylesheet)
In order to decrease the HTTP requests we recommend method 1 for creating your print styles
Google PreviewAnimated Gifs ~ Cartoons Sports Love Terror Movies
httpwwwgifmaniaca
Animated Gifs of Cartoons and Movies Free Animated Gifs of Animated Cartoons Free Animations
Images Pictures Pics of Animated Images Animations Web Pages for Webmaster Canada
graphics Free Comics Games and TV Series Animated Gifs
Keywords Cloudactresses adventure algebra aliments animalsanimated animates animearts bars beaches bears cartoons characters chinese christmas clothes colorscompuserve computer confectionery create danger day design disaster disneydownload fantasy fathers female file films flowers fonts food format free funnygames ghosts gif gifmaniagifs gifts graduation halloween histories holidayshoroscope html image images its just knights lakes landscapes letters like lovemessages mothers movement movies musical networks objects office oops people platesplay presentation ready romantic sale scarecrow scares science screensaversseries share signs smileys social space supplies teddy text thanksgiving use usedvacations video wallpapers war warriors web zodiac
Deprecated HTML TagsCongratulations Your page does not use HTML deprecated tags
HTML Page Size TestCongratulations Your HTML size is 1188 Kb and this is under the average web page size of 33 KbThis helps lead to a faster than average page load time
HTML CompressionGZIP TestCongratulations Your page is successfully compressed using gzip compression on your codeYour HTML is compressed from 7122 Kb to 1188 Kb (83 size savings) This helps ensure a faster loading web page and improved user experience
Page Cache TestIt does not appear that you are caching your pages Cached pages serve up static html and avoid potentially time consuming queries to your database It also helps lower server load by up to 80 Caching most visibly benefits high traffic pages that access a database but whose content does not change on every page view Common caching methods include Alternative PHP Cache Quickcache and jpcache Caching mechanisms also typically compress HTML further reducing page size and load time
HOW TO FIX
In order to pass this test you are advised to use a caching mechanism for your pages There are three methods which can be used to caching your web pages
1 Alternative PHP caching
- Alternative PHP Cache (APC) is an open source framework which caches data using intermediate PHP code Most web programmers who are familiar with the PHP programming language can easily set up Alternative PHP Cache for your site
2 Quickcache- Quickcache is a lightweight page caching solution which was formerly known as jpcache Quickcache caches the page output rather than compiling the PHP page making it a superior version of page caching to the Alternative PHP caching Quickcache can be quickly downloaded from their website and can reduce your page load time up to 80
3 WP Super Cache- If you have a Wordpress website WP Super Cache can be installed within seconds and without no programming knowledge
Flash TestYour website contains flash objects
Nested Tables TestCongratulations your page does not use nested tables This speeds up page loading time and optimizes the user experience
Image Expires Tag TestCongratulations Your webpage use Expires header for your images and the browsers will display these images from the cache
Doctype TestYour website has a doctype declaration ltDOCTYPE htmlgt
Frameset TestCongratulations Your webpage does not use frames
Site Loading Speed TestYour site loading time is around 2445 seconds and this is under the average loading speed which is 5 seconds
JS and CSS Minification TestIts important to send as few bytes of CSS and JS markup down the wire as possible Its not just about size though its also about the number of requests to get the bits In fact thats often more of a problem then file size
JS Minification TestYou have more than one JS file Try combining them into one in order to decrease the number of HTTP requests
MINIFIED JS FILEShttpassetspinterestcomjspinit_mainjs
httpplatformtwittercomwidgetsjs
httpsapisgooglecomjsplusonejs
httpconnectfacebookneten_USalljs
httpwwwgoogle-analyticscomgajs
httpwwwgoogletagservicescomtagjsgptjs
httpwwwgifmaniacarecjsjquery-143minjs
httppartnergoogleadservicescomgptpubads_impl_37js
httppagead2googlesyndicationcompageadshow_adsjs
httpplatformtumblrcomv1sharejs
httplogpinterestcomvia=http3A2F2Fwwwgifmaniaca2Fampguid=wcKRQKYrYqZTamptype=pidgetampsub=wwwampbutton_count=1ampcallback=PIN_1398953924932fcallback[1]
NOT MINIFIED JS FILEShttpwwwgooglecomcoopcsebrandform=cse-search-boxamplang=en
httpwwwgifmaniacarecjsvertical-alignjs
httpwwwgifmaniacarecjsjqueryeasing13js
httpwwwgifmaniacarecjsslider_gifmaniajs
httpwwwgifmaniacarecjsslider_gifmania_containerjs
httpwwwgifmaniacarecjsparallax_positionjs
httpwwwgifmaniacarecjsparallaxjs
HOW TO FIX
In order to pass this test you must minify all of your external JavaScript files For this task you can use an online JS minifier like YUI Compressor Closure Compiler or JSMin
CSS Minification TestYou have more than one CSS file Try combining them into one in order to decrease the number of HTTP requests
NOT MINIFIED CSS FILEShttpwwwgifmaniacareccsshomecss
httpfontsgoogleapiscomcssfamily=Jockey+Oneampsubset=latinlatin-ext
httpwwwgifmaniacareccssstylescss
httpfontsgoogleapiscomcssfamily=Jockey+Oneampsubset=latinlatin-ext
httpfontsgoogleapiscomcssfamily=Chewy
HOW TO FIX
In order to pass this test you must minify all of your external CSS files For this task you can use an online CSS minifier like YUI Compressor or cssminjs
URL Canonicalization Testhttpwwwgifmaniaca and httpgifmaniaca resolve to the same URL
Directory Browsing TestCongratulations Your server has disabled directory browsing
Libwww-perl Access TestYour server appears to allow access from User-agent Libwww-perl Botnet scripts that automatically look for vulnerabilities in your software are sometimes identified as User-Agent libwww-perl By blocking access from libwww-perl you can eliminate many simpler attacks Read more on blocking Libwww-perl access and improving your websites security
HOW TO FIX
In order to pass this test you must block the libwww-perl user-agent in your htaccess file
If your site is running on apache server you could put these lines in your htaccessafter RewriteEngine on line
RewriteCond HTTP_USER_AGENT libwww-perl RewriteRule acirceuroldquo [FL]
Server Signature TestYour server signature is on Turning off your server signature is generally a good idea from a security standpoint Read more on how to turn off server signature and improve your websites security
Server Apache2225 (Unix) mod_ssl2225 OpenSSL100-fips PHP5217
HOW TO FIX
By default the Apache webserver sends HTTP headers with some information about your server version operating system modules installed etc These informations can be used by hackers in order to exploit vulnerabilities (specially if you are running an older version) These information can be hidden or changed with very basic configurations Open Apacheacirceurotrades configuration file (httpdconf or apacheconf) and search for ServerSignature If you find it edit it to
ServerSignature OffServerTokens Prod
If you dont find it just add these two lines at the end of the file Note that after you modify the configuration file you must restart the Apache server
Plaintext Emails TestCongratulations Your webpage does not include email addresses in plaintext
Website IP CheckYour website ip address is 1447619203
IP Canonicalization TestYour sites IP 1447619203 does not redirect to your sites domain name This could cause duplicate content problems if a search engine indexes your site under both its IP and domain name
HOW TO FIX
In order to pass this test you must consider using a 301 re-write rule in your htaccess file so that your sites IP points to your domain nameIf your site is running on apache server you could put these lines in your htaccessafter RewriteEngine on line
RewriteCond HTTP_HOST ^XXXXXXXXXXXXRewriteRule () httpwwwyourdomaincom$1 [R=301L]
Note that you must proper format the first line using your IP (replace X characters with proper digits from your IP) and the second line using your domain name
Safe Browsing TestThis site is not currently listed as suspicious (no malware or phishing activity found)
Media Query Responsive TestYour website is not using media queries You should consider using this technique in order to implement responsive design functionalities
HOW TO FIX
Media queries allow you to style elements for specific devices (smartphones tablets desktop computers) by using attributes like width height resolution aspect ratio orientation or color By using media queries presentations can be tailored to a specific range of output devices without changing the content itselfExample
ltlink rel=stylesheet media=screen and (min-width 480px) and (max-width 960px) href=480-960css gt
lt-- OR --gtmedia screen and (min-width 480px) and (max-width 960px) header display none
An media rule specifies the target media types of a set of statements In the example above we are specifying the media type screen The max-width and min-width features are telling the browser that at any screen size larger than 480px but smaller than 960px hide any elements with id=header
Mobile Snapshot
Social Media CheckCongratulations your website is connected successfuly with social media using FacebookTwitter Google Plus Pinterest
Social Media ActivityYour website doesnt have any social media activity Search engines are increasingly using social media activity to determine which pages are most relevant for keyword searches In order to increase your page rank and to increase revenue generated through organic search you are adviced to increase your website social media engagement
Facebook Likes 2 Facebook Shares 3 Facebook Comments 0
No activity on Twitter
Google PlusOnes 1
No activity on Pinterest
HOW TO FIX
In order to increase the social media activity for your site you are advised to use some social networks plugins within your page Facebook Like Button Facebook Share Button Facebook Comments Twitter Button Google +1 Button Pinterest Button or AddThis Widget
Total Page Size 379 Mb
Largest Resourcehttpwwwgifmaniacarecimgslidersgamespng
Smallest Resource[] ct)7Cutmcmd3D(none)3Bamputmu=qAAAAAAAAAAAAAAAAAQ~
Code To Text RatioYour page size (source code) is 7122 Kb and your content text size is 398 Kb Your content text represents 559 from your webpage source code This is a low ratio and you might need to add more content
HOW TO FIX
In order to pass this test you must increse your text to HTML code ratio Here are some tehniques
move all inline styling rules into a external CSS filemove your JavaScript code into a external JS fileuse CSS layout instead of HTML tables
URL SEO Friendly TestThe URL and all links inside this page are SEO friendly
Broken Links TestYour page has 204 distinct anchor links A good practice is to keep the links to a reasonable number (under 100)
From 100 distinct anchor links analyzed none of them appears to be broken
Google Analytics TestCongratulations Your website is using the asynchronous version of Google Analytics tracking code
Underscores in Links TestCongratulations We have not found underscores in your in-page URLs
32917 KB
003 KB
Google PageRank TestYour Google PageRank is 1 and this value is below the average which is 3 Improving your Google PageRank (building quality backlinks) is very important if you want to improve your search engine rankings
Alexa Page Rank TestYour Alexa Rank (14613015) is above 100000 and the number of backlinks is 9 You might consider that your website should produce some more and good traffic For additional information about your Alexa traffic you might check this link
HOW TO FIX
Some best practices for increase your Alexa Page Rank are listed below
The most important thing is the content write useful and qualitative contentRegularly submit fresh and unique contentIncrease the traffic on your siteGenerate quality backlinks on your websiteConnect to social networking sitesInstall Alexa Toolbar on your browser and Alexa Rank Widget into your webpageVerify your website on Alexacom
Image Alt TestYour webpage has 17 images 13 of them are unique and all of them has an alt attribute
Inline CSS TestYour webpage is using 46 inline CSS properties
HOW TO FIX
Is a good practice to move all the inlines CSS rules into an external file in order to make your page lighter in weight and decreasing the code to text ratio
check the HTML code of your page and identify all style attributefor each style attribute found you must proper move all declarations in the external CSS file and remove the style attribute
For example
lt--this HTML code with inline CSS rule--gtltp style=colorred font-size 12pxgtsome text hereltpgtlt--would became--gtltpgtsome text hereltpgtlt--and the rule added into your CSS file--gtpcolorred font-size 12px
Media Print TestYour webpage doesnt take the advantages of media print CSS rule Here are some tips on how to set up a print style sheet
HOW TO FIX
For printing your webpage in a user-friendly format you can use one of these methods
1 Use a media print rule at the end of your CSS file (note that specificity and precedence rules still apply)Example
media print your print styles go here header footer menu display none body font 12pt georgiaserif h1 font-size 18pt h2 font-size 16pt color 000
2 Create and use a print stylesheet
ltlink rel=stylesheet href=printcss type=textcss media=print gt
The file printcss is the print stylesheet and the media=print command means that this CSS file only gets called up when your page is printed The only CSS rules you need to put in the print stylesheet are ones to override the CSS rules in the main stylesheet (you dont need to repeat any colour or branding CSS commands as theyll already be taken from the main stylesheet)
In order to decrease the HTTP requests we recommend method 1 for creating your print styles
Google PreviewAnimated Gifs ~ Cartoons Sports Love Terror Movies
httpwwwgifmaniaca
Animated Gifs of Cartoons and Movies Free Animated Gifs of Animated Cartoons Free Animations
Images Pictures Pics of Animated Images Animations Web Pages for Webmaster Canada
graphics Free Comics Games and TV Series Animated Gifs
Keywords Cloudactresses adventure algebra aliments animalsanimated animates animearts bars beaches bears cartoons characters chinese christmas clothes colorscompuserve computer confectionery create danger day design disaster disneydownload fantasy fathers female file films flowers fonts food format free funnygames ghosts gif gifmaniagifs gifts graduation halloween histories holidayshoroscope html image images its just knights lakes landscapes letters like lovemessages mothers movement movies musical networks objects office oops people platesplay presentation ready romantic sale scarecrow scares science screensaversseries share signs smileys social space supplies teddy text thanksgiving use usedvacations video wallpapers war warriors web zodiac
Deprecated HTML TagsCongratulations Your page does not use HTML deprecated tags
HTML Page Size TestCongratulations Your HTML size is 1188 Kb and this is under the average web page size of 33 KbThis helps lead to a faster than average page load time
HTML CompressionGZIP TestCongratulations Your page is successfully compressed using gzip compression on your codeYour HTML is compressed from 7122 Kb to 1188 Kb (83 size savings) This helps ensure a faster loading web page and improved user experience
Page Cache TestIt does not appear that you are caching your pages Cached pages serve up static html and avoid potentially time consuming queries to your database It also helps lower server load by up to 80 Caching most visibly benefits high traffic pages that access a database but whose content does not change on every page view Common caching methods include Alternative PHP Cache Quickcache and jpcache Caching mechanisms also typically compress HTML further reducing page size and load time
HOW TO FIX
In order to pass this test you are advised to use a caching mechanism for your pages There are three methods which can be used to caching your web pages
1 Alternative PHP caching
- Alternative PHP Cache (APC) is an open source framework which caches data using intermediate PHP code Most web programmers who are familiar with the PHP programming language can easily set up Alternative PHP Cache for your site
2 Quickcache- Quickcache is a lightweight page caching solution which was formerly known as jpcache Quickcache caches the page output rather than compiling the PHP page making it a superior version of page caching to the Alternative PHP caching Quickcache can be quickly downloaded from their website and can reduce your page load time up to 80
3 WP Super Cache- If you have a Wordpress website WP Super Cache can be installed within seconds and without no programming knowledge
Flash TestYour website contains flash objects
Nested Tables TestCongratulations your page does not use nested tables This speeds up page loading time and optimizes the user experience
Image Expires Tag TestCongratulations Your webpage use Expires header for your images and the browsers will display these images from the cache
Doctype TestYour website has a doctype declaration ltDOCTYPE htmlgt
Frameset TestCongratulations Your webpage does not use frames
Site Loading Speed TestYour site loading time is around 2445 seconds and this is under the average loading speed which is 5 seconds
JS and CSS Minification TestIts important to send as few bytes of CSS and JS markup down the wire as possible Its not just about size though its also about the number of requests to get the bits In fact thats often more of a problem then file size
JS Minification TestYou have more than one JS file Try combining them into one in order to decrease the number of HTTP requests
MINIFIED JS FILEShttpassetspinterestcomjspinit_mainjs
httpplatformtwittercomwidgetsjs
httpsapisgooglecomjsplusonejs
httpconnectfacebookneten_USalljs
httpwwwgoogle-analyticscomgajs
httpwwwgoogletagservicescomtagjsgptjs
httpwwwgifmaniacarecjsjquery-143minjs
httppartnergoogleadservicescomgptpubads_impl_37js
httppagead2googlesyndicationcompageadshow_adsjs
httpplatformtumblrcomv1sharejs
httplogpinterestcomvia=http3A2F2Fwwwgifmaniaca2Fampguid=wcKRQKYrYqZTamptype=pidgetampsub=wwwampbutton_count=1ampcallback=PIN_1398953924932fcallback[1]
NOT MINIFIED JS FILEShttpwwwgooglecomcoopcsebrandform=cse-search-boxamplang=en
httpwwwgifmaniacarecjsvertical-alignjs
httpwwwgifmaniacarecjsjqueryeasing13js
httpwwwgifmaniacarecjsslider_gifmaniajs
httpwwwgifmaniacarecjsslider_gifmania_containerjs
httpwwwgifmaniacarecjsparallax_positionjs
httpwwwgifmaniacarecjsparallaxjs
HOW TO FIX
In order to pass this test you must minify all of your external JavaScript files For this task you can use an online JS minifier like YUI Compressor Closure Compiler or JSMin
CSS Minification TestYou have more than one CSS file Try combining them into one in order to decrease the number of HTTP requests
NOT MINIFIED CSS FILEShttpwwwgifmaniacareccsshomecss
httpfontsgoogleapiscomcssfamily=Jockey+Oneampsubset=latinlatin-ext
httpwwwgifmaniacareccssstylescss
httpfontsgoogleapiscomcssfamily=Jockey+Oneampsubset=latinlatin-ext
httpfontsgoogleapiscomcssfamily=Chewy
HOW TO FIX
In order to pass this test you must minify all of your external CSS files For this task you can use an online CSS minifier like YUI Compressor or cssminjs
URL Canonicalization Testhttpwwwgifmaniaca and httpgifmaniaca resolve to the same URL
Directory Browsing TestCongratulations Your server has disabled directory browsing
Libwww-perl Access TestYour server appears to allow access from User-agent Libwww-perl Botnet scripts that automatically look for vulnerabilities in your software are sometimes identified as User-Agent libwww-perl By blocking access from libwww-perl you can eliminate many simpler attacks Read more on blocking Libwww-perl access and improving your websites security
HOW TO FIX
In order to pass this test you must block the libwww-perl user-agent in your htaccess file
If your site is running on apache server you could put these lines in your htaccessafter RewriteEngine on line
RewriteCond HTTP_USER_AGENT libwww-perl RewriteRule acirceuroldquo [FL]
Server Signature TestYour server signature is on Turning off your server signature is generally a good idea from a security standpoint Read more on how to turn off server signature and improve your websites security
Server Apache2225 (Unix) mod_ssl2225 OpenSSL100-fips PHP5217
HOW TO FIX
By default the Apache webserver sends HTTP headers with some information about your server version operating system modules installed etc These informations can be used by hackers in order to exploit vulnerabilities (specially if you are running an older version) These information can be hidden or changed with very basic configurations Open Apacheacirceurotrades configuration file (httpdconf or apacheconf) and search for ServerSignature If you find it edit it to
ServerSignature OffServerTokens Prod
If you dont find it just add these two lines at the end of the file Note that after you modify the configuration file you must restart the Apache server
Plaintext Emails TestCongratulations Your webpage does not include email addresses in plaintext
Website IP CheckYour website ip address is 1447619203
IP Canonicalization TestYour sites IP 1447619203 does not redirect to your sites domain name This could cause duplicate content problems if a search engine indexes your site under both its IP and domain name
HOW TO FIX
In order to pass this test you must consider using a 301 re-write rule in your htaccess file so that your sites IP points to your domain nameIf your site is running on apache server you could put these lines in your htaccessafter RewriteEngine on line
RewriteCond HTTP_HOST ^XXXXXXXXXXXXRewriteRule () httpwwwyourdomaincom$1 [R=301L]
Note that you must proper format the first line using your IP (replace X characters with proper digits from your IP) and the second line using your domain name
Safe Browsing TestThis site is not currently listed as suspicious (no malware or phishing activity found)
Media Query Responsive TestYour website is not using media queries You should consider using this technique in order to implement responsive design functionalities
HOW TO FIX
Media queries allow you to style elements for specific devices (smartphones tablets desktop computers) by using attributes like width height resolution aspect ratio orientation or color By using media queries presentations can be tailored to a specific range of output devices without changing the content itselfExample
ltlink rel=stylesheet media=screen and (min-width 480px) and (max-width 960px) href=480-960css gt
lt-- OR --gtmedia screen and (min-width 480px) and (max-width 960px) header display none
An media rule specifies the target media types of a set of statements In the example above we are specifying the media type screen The max-width and min-width features are telling the browser that at any screen size larger than 480px but smaller than 960px hide any elements with id=header
Mobile Snapshot
Social Media CheckCongratulations your website is connected successfuly with social media using FacebookTwitter Google Plus Pinterest
Social Media ActivityYour website doesnt have any social media activity Search engines are increasingly using social media activity to determine which pages are most relevant for keyword searches In order to increase your page rank and to increase revenue generated through organic search you are adviced to increase your website social media engagement
Facebook Likes 2 Facebook Shares 3 Facebook Comments 0
No activity on Twitter
Google PlusOnes 1
No activity on Pinterest
HOW TO FIX
In order to increase the social media activity for your site you are advised to use some social networks plugins within your page Facebook Like Button Facebook Share Button Facebook Comments Twitter Button Google +1 Button Pinterest Button or AddThis Widget
Google PageRank TestYour Google PageRank is 1 and this value is below the average which is 3 Improving your Google PageRank (building quality backlinks) is very important if you want to improve your search engine rankings
Alexa Page Rank TestYour Alexa Rank (14613015) is above 100000 and the number of backlinks is 9 You might consider that your website should produce some more and good traffic For additional information about your Alexa traffic you might check this link
HOW TO FIX
Some best practices for increase your Alexa Page Rank are listed below
The most important thing is the content write useful and qualitative contentRegularly submit fresh and unique contentIncrease the traffic on your siteGenerate quality backlinks on your websiteConnect to social networking sitesInstall Alexa Toolbar on your browser and Alexa Rank Widget into your webpageVerify your website on Alexacom
Image Alt TestYour webpage has 17 images 13 of them are unique and all of them has an alt attribute
Inline CSS TestYour webpage is using 46 inline CSS properties
HOW TO FIX
Is a good practice to move all the inlines CSS rules into an external file in order to make your page lighter in weight and decreasing the code to text ratio
check the HTML code of your page and identify all style attributefor each style attribute found you must proper move all declarations in the external CSS file and remove the style attribute
For example
lt--this HTML code with inline CSS rule--gtltp style=colorred font-size 12pxgtsome text hereltpgtlt--would became--gtltpgtsome text hereltpgtlt--and the rule added into your CSS file--gtpcolorred font-size 12px
Media Print TestYour webpage doesnt take the advantages of media print CSS rule Here are some tips on how to set up a print style sheet
HOW TO FIX
For printing your webpage in a user-friendly format you can use one of these methods
1 Use a media print rule at the end of your CSS file (note that specificity and precedence rules still apply)Example
media print your print styles go here header footer menu display none body font 12pt georgiaserif h1 font-size 18pt h2 font-size 16pt color 000
2 Create and use a print stylesheet
ltlink rel=stylesheet href=printcss type=textcss media=print gt
The file printcss is the print stylesheet and the media=print command means that this CSS file only gets called up when your page is printed The only CSS rules you need to put in the print stylesheet are ones to override the CSS rules in the main stylesheet (you dont need to repeat any colour or branding CSS commands as theyll already be taken from the main stylesheet)
In order to decrease the HTTP requests we recommend method 1 for creating your print styles
Google PreviewAnimated Gifs ~ Cartoons Sports Love Terror Movies
httpwwwgifmaniaca
Animated Gifs of Cartoons and Movies Free Animated Gifs of Animated Cartoons Free Animations
Images Pictures Pics of Animated Images Animations Web Pages for Webmaster Canada
graphics Free Comics Games and TV Series Animated Gifs
Keywords Cloudactresses adventure algebra aliments animalsanimated animates animearts bars beaches bears cartoons characters chinese christmas clothes colorscompuserve computer confectionery create danger day design disaster disneydownload fantasy fathers female file films flowers fonts food format free funnygames ghosts gif gifmaniagifs gifts graduation halloween histories holidayshoroscope html image images its just knights lakes landscapes letters like lovemessages mothers movement movies musical networks objects office oops people platesplay presentation ready romantic sale scarecrow scares science screensaversseries share signs smileys social space supplies teddy text thanksgiving use usedvacations video wallpapers war warriors web zodiac
Deprecated HTML TagsCongratulations Your page does not use HTML deprecated tags
HTML Page Size TestCongratulations Your HTML size is 1188 Kb and this is under the average web page size of 33 KbThis helps lead to a faster than average page load time
HTML CompressionGZIP TestCongratulations Your page is successfully compressed using gzip compression on your codeYour HTML is compressed from 7122 Kb to 1188 Kb (83 size savings) This helps ensure a faster loading web page and improved user experience
Page Cache TestIt does not appear that you are caching your pages Cached pages serve up static html and avoid potentially time consuming queries to your database It also helps lower server load by up to 80 Caching most visibly benefits high traffic pages that access a database but whose content does not change on every page view Common caching methods include Alternative PHP Cache Quickcache and jpcache Caching mechanisms also typically compress HTML further reducing page size and load time
HOW TO FIX
In order to pass this test you are advised to use a caching mechanism for your pages There are three methods which can be used to caching your web pages
1 Alternative PHP caching
- Alternative PHP Cache (APC) is an open source framework which caches data using intermediate PHP code Most web programmers who are familiar with the PHP programming language can easily set up Alternative PHP Cache for your site
2 Quickcache- Quickcache is a lightweight page caching solution which was formerly known as jpcache Quickcache caches the page output rather than compiling the PHP page making it a superior version of page caching to the Alternative PHP caching Quickcache can be quickly downloaded from their website and can reduce your page load time up to 80
3 WP Super Cache- If you have a Wordpress website WP Super Cache can be installed within seconds and without no programming knowledge
Flash TestYour website contains flash objects
Nested Tables TestCongratulations your page does not use nested tables This speeds up page loading time and optimizes the user experience
Image Expires Tag TestCongratulations Your webpage use Expires header for your images and the browsers will display these images from the cache
Doctype TestYour website has a doctype declaration ltDOCTYPE htmlgt
Frameset TestCongratulations Your webpage does not use frames
Site Loading Speed TestYour site loading time is around 2445 seconds and this is under the average loading speed which is 5 seconds
JS and CSS Minification TestIts important to send as few bytes of CSS and JS markup down the wire as possible Its not just about size though its also about the number of requests to get the bits In fact thats often more of a problem then file size
JS Minification TestYou have more than one JS file Try combining them into one in order to decrease the number of HTTP requests
MINIFIED JS FILEShttpassetspinterestcomjspinit_mainjs
httpplatformtwittercomwidgetsjs
httpsapisgooglecomjsplusonejs
httpconnectfacebookneten_USalljs
httpwwwgoogle-analyticscomgajs
httpwwwgoogletagservicescomtagjsgptjs
httpwwwgifmaniacarecjsjquery-143minjs
httppartnergoogleadservicescomgptpubads_impl_37js
httppagead2googlesyndicationcompageadshow_adsjs
httpplatformtumblrcomv1sharejs
httplogpinterestcomvia=http3A2F2Fwwwgifmaniaca2Fampguid=wcKRQKYrYqZTamptype=pidgetampsub=wwwampbutton_count=1ampcallback=PIN_1398953924932fcallback[1]
NOT MINIFIED JS FILEShttpwwwgooglecomcoopcsebrandform=cse-search-boxamplang=en
httpwwwgifmaniacarecjsvertical-alignjs
httpwwwgifmaniacarecjsjqueryeasing13js
httpwwwgifmaniacarecjsslider_gifmaniajs
httpwwwgifmaniacarecjsslider_gifmania_containerjs
httpwwwgifmaniacarecjsparallax_positionjs
httpwwwgifmaniacarecjsparallaxjs
HOW TO FIX
In order to pass this test you must minify all of your external JavaScript files For this task you can use an online JS minifier like YUI Compressor Closure Compiler or JSMin
CSS Minification TestYou have more than one CSS file Try combining them into one in order to decrease the number of HTTP requests
NOT MINIFIED CSS FILEShttpwwwgifmaniacareccsshomecss
httpfontsgoogleapiscomcssfamily=Jockey+Oneampsubset=latinlatin-ext
httpwwwgifmaniacareccssstylescss
httpfontsgoogleapiscomcssfamily=Jockey+Oneampsubset=latinlatin-ext
httpfontsgoogleapiscomcssfamily=Chewy
HOW TO FIX
In order to pass this test you must minify all of your external CSS files For this task you can use an online CSS minifier like YUI Compressor or cssminjs
URL Canonicalization Testhttpwwwgifmaniaca and httpgifmaniaca resolve to the same URL
Directory Browsing TestCongratulations Your server has disabled directory browsing
Libwww-perl Access TestYour server appears to allow access from User-agent Libwww-perl Botnet scripts that automatically look for vulnerabilities in your software are sometimes identified as User-Agent libwww-perl By blocking access from libwww-perl you can eliminate many simpler attacks Read more on blocking Libwww-perl access and improving your websites security
HOW TO FIX
In order to pass this test you must block the libwww-perl user-agent in your htaccess file
If your site is running on apache server you could put these lines in your htaccessafter RewriteEngine on line
RewriteCond HTTP_USER_AGENT libwww-perl RewriteRule acirceuroldquo [FL]
Server Signature TestYour server signature is on Turning off your server signature is generally a good idea from a security standpoint Read more on how to turn off server signature and improve your websites security
Server Apache2225 (Unix) mod_ssl2225 OpenSSL100-fips PHP5217
HOW TO FIX
By default the Apache webserver sends HTTP headers with some information about your server version operating system modules installed etc These informations can be used by hackers in order to exploit vulnerabilities (specially if you are running an older version) These information can be hidden or changed with very basic configurations Open Apacheacirceurotrades configuration file (httpdconf or apacheconf) and search for ServerSignature If you find it edit it to
ServerSignature OffServerTokens Prod
If you dont find it just add these two lines at the end of the file Note that after you modify the configuration file you must restart the Apache server
Plaintext Emails TestCongratulations Your webpage does not include email addresses in plaintext
Website IP CheckYour website ip address is 1447619203
IP Canonicalization TestYour sites IP 1447619203 does not redirect to your sites domain name This could cause duplicate content problems if a search engine indexes your site under both its IP and domain name
HOW TO FIX
In order to pass this test you must consider using a 301 re-write rule in your htaccess file so that your sites IP points to your domain nameIf your site is running on apache server you could put these lines in your htaccessafter RewriteEngine on line
RewriteCond HTTP_HOST ^XXXXXXXXXXXXRewriteRule () httpwwwyourdomaincom$1 [R=301L]
Note that you must proper format the first line using your IP (replace X characters with proper digits from your IP) and the second line using your domain name
Safe Browsing TestThis site is not currently listed as suspicious (no malware or phishing activity found)
Media Query Responsive TestYour website is not using media queries You should consider using this technique in order to implement responsive design functionalities
HOW TO FIX
Media queries allow you to style elements for specific devices (smartphones tablets desktop computers) by using attributes like width height resolution aspect ratio orientation or color By using media queries presentations can be tailored to a specific range of output devices without changing the content itselfExample
ltlink rel=stylesheet media=screen and (min-width 480px) and (max-width 960px) href=480-960css gt
lt-- OR --gtmedia screen and (min-width 480px) and (max-width 960px) header display none
An media rule specifies the target media types of a set of statements In the example above we are specifying the media type screen The max-width and min-width features are telling the browser that at any screen size larger than 480px but smaller than 960px hide any elements with id=header
Mobile Snapshot
Social Media CheckCongratulations your website is connected successfuly with social media using FacebookTwitter Google Plus Pinterest
Social Media ActivityYour website doesnt have any social media activity Search engines are increasingly using social media activity to determine which pages are most relevant for keyword searches In order to increase your page rank and to increase revenue generated through organic search you are adviced to increase your website social media engagement
Facebook Likes 2 Facebook Shares 3 Facebook Comments 0
No activity on Twitter
Google PlusOnes 1
No activity on Pinterest
HOW TO FIX
In order to increase the social media activity for your site you are advised to use some social networks plugins within your page Facebook Like Button Facebook Share Button Facebook Comments Twitter Button Google +1 Button Pinterest Button or AddThis Widget
lt--this HTML code with inline CSS rule--gtltp style=colorred font-size 12pxgtsome text hereltpgtlt--would became--gtltpgtsome text hereltpgtlt--and the rule added into your CSS file--gtpcolorred font-size 12px
Media Print TestYour webpage doesnt take the advantages of media print CSS rule Here are some tips on how to set up a print style sheet
HOW TO FIX
For printing your webpage in a user-friendly format you can use one of these methods
1 Use a media print rule at the end of your CSS file (note that specificity and precedence rules still apply)Example
media print your print styles go here header footer menu display none body font 12pt georgiaserif h1 font-size 18pt h2 font-size 16pt color 000
2 Create and use a print stylesheet
ltlink rel=stylesheet href=printcss type=textcss media=print gt
The file printcss is the print stylesheet and the media=print command means that this CSS file only gets called up when your page is printed The only CSS rules you need to put in the print stylesheet are ones to override the CSS rules in the main stylesheet (you dont need to repeat any colour or branding CSS commands as theyll already be taken from the main stylesheet)
In order to decrease the HTTP requests we recommend method 1 for creating your print styles
Google PreviewAnimated Gifs ~ Cartoons Sports Love Terror Movies
httpwwwgifmaniaca
Animated Gifs of Cartoons and Movies Free Animated Gifs of Animated Cartoons Free Animations
Images Pictures Pics of Animated Images Animations Web Pages for Webmaster Canada
graphics Free Comics Games and TV Series Animated Gifs
Keywords Cloudactresses adventure algebra aliments animalsanimated animates animearts bars beaches bears cartoons characters chinese christmas clothes colorscompuserve computer confectionery create danger day design disaster disneydownload fantasy fathers female file films flowers fonts food format free funnygames ghosts gif gifmaniagifs gifts graduation halloween histories holidayshoroscope html image images its just knights lakes landscapes letters like lovemessages mothers movement movies musical networks objects office oops people platesplay presentation ready romantic sale scarecrow scares science screensaversseries share signs smileys social space supplies teddy text thanksgiving use usedvacations video wallpapers war warriors web zodiac
Deprecated HTML TagsCongratulations Your page does not use HTML deprecated tags
HTML Page Size TestCongratulations Your HTML size is 1188 Kb and this is under the average web page size of 33 KbThis helps lead to a faster than average page load time
HTML CompressionGZIP TestCongratulations Your page is successfully compressed using gzip compression on your codeYour HTML is compressed from 7122 Kb to 1188 Kb (83 size savings) This helps ensure a faster loading web page and improved user experience
Page Cache TestIt does not appear that you are caching your pages Cached pages serve up static html and avoid potentially time consuming queries to your database It also helps lower server load by up to 80 Caching most visibly benefits high traffic pages that access a database but whose content does not change on every page view Common caching methods include Alternative PHP Cache Quickcache and jpcache Caching mechanisms also typically compress HTML further reducing page size and load time
HOW TO FIX
In order to pass this test you are advised to use a caching mechanism for your pages There are three methods which can be used to caching your web pages
1 Alternative PHP caching
- Alternative PHP Cache (APC) is an open source framework which caches data using intermediate PHP code Most web programmers who are familiar with the PHP programming language can easily set up Alternative PHP Cache for your site
2 Quickcache- Quickcache is a lightweight page caching solution which was formerly known as jpcache Quickcache caches the page output rather than compiling the PHP page making it a superior version of page caching to the Alternative PHP caching Quickcache can be quickly downloaded from their website and can reduce your page load time up to 80
3 WP Super Cache- If you have a Wordpress website WP Super Cache can be installed within seconds and without no programming knowledge
Flash TestYour website contains flash objects
Nested Tables TestCongratulations your page does not use nested tables This speeds up page loading time and optimizes the user experience
Image Expires Tag TestCongratulations Your webpage use Expires header for your images and the browsers will display these images from the cache
Doctype TestYour website has a doctype declaration ltDOCTYPE htmlgt
Frameset TestCongratulations Your webpage does not use frames
Site Loading Speed TestYour site loading time is around 2445 seconds and this is under the average loading speed which is 5 seconds
JS and CSS Minification TestIts important to send as few bytes of CSS and JS markup down the wire as possible Its not just about size though its also about the number of requests to get the bits In fact thats often more of a problem then file size
JS Minification TestYou have more than one JS file Try combining them into one in order to decrease the number of HTTP requests
MINIFIED JS FILEShttpassetspinterestcomjspinit_mainjs
httpplatformtwittercomwidgetsjs
httpsapisgooglecomjsplusonejs
httpconnectfacebookneten_USalljs
httpwwwgoogle-analyticscomgajs
httpwwwgoogletagservicescomtagjsgptjs
httpwwwgifmaniacarecjsjquery-143minjs
httppartnergoogleadservicescomgptpubads_impl_37js
httppagead2googlesyndicationcompageadshow_adsjs
httpplatformtumblrcomv1sharejs
httplogpinterestcomvia=http3A2F2Fwwwgifmaniaca2Fampguid=wcKRQKYrYqZTamptype=pidgetampsub=wwwampbutton_count=1ampcallback=PIN_1398953924932fcallback[1]
NOT MINIFIED JS FILEShttpwwwgooglecomcoopcsebrandform=cse-search-boxamplang=en
httpwwwgifmaniacarecjsvertical-alignjs
httpwwwgifmaniacarecjsjqueryeasing13js
httpwwwgifmaniacarecjsslider_gifmaniajs
httpwwwgifmaniacarecjsslider_gifmania_containerjs
httpwwwgifmaniacarecjsparallax_positionjs
httpwwwgifmaniacarecjsparallaxjs
HOW TO FIX
In order to pass this test you must minify all of your external JavaScript files For this task you can use an online JS minifier like YUI Compressor Closure Compiler or JSMin
CSS Minification TestYou have more than one CSS file Try combining them into one in order to decrease the number of HTTP requests
NOT MINIFIED CSS FILEShttpwwwgifmaniacareccsshomecss
httpfontsgoogleapiscomcssfamily=Jockey+Oneampsubset=latinlatin-ext
httpwwwgifmaniacareccssstylescss
httpfontsgoogleapiscomcssfamily=Jockey+Oneampsubset=latinlatin-ext
httpfontsgoogleapiscomcssfamily=Chewy
HOW TO FIX
In order to pass this test you must minify all of your external CSS files For this task you can use an online CSS minifier like YUI Compressor or cssminjs
URL Canonicalization Testhttpwwwgifmaniaca and httpgifmaniaca resolve to the same URL
Directory Browsing TestCongratulations Your server has disabled directory browsing
Libwww-perl Access TestYour server appears to allow access from User-agent Libwww-perl Botnet scripts that automatically look for vulnerabilities in your software are sometimes identified as User-Agent libwww-perl By blocking access from libwww-perl you can eliminate many simpler attacks Read more on blocking Libwww-perl access and improving your websites security
HOW TO FIX
In order to pass this test you must block the libwww-perl user-agent in your htaccess file
If your site is running on apache server you could put these lines in your htaccessafter RewriteEngine on line
RewriteCond HTTP_USER_AGENT libwww-perl RewriteRule acirceuroldquo [FL]
Server Signature TestYour server signature is on Turning off your server signature is generally a good idea from a security standpoint Read more on how to turn off server signature and improve your websites security
Server Apache2225 (Unix) mod_ssl2225 OpenSSL100-fips PHP5217
HOW TO FIX
By default the Apache webserver sends HTTP headers with some information about your server version operating system modules installed etc These informations can be used by hackers in order to exploit vulnerabilities (specially if you are running an older version) These information can be hidden or changed with very basic configurations Open Apacheacirceurotrades configuration file (httpdconf or apacheconf) and search for ServerSignature If you find it edit it to
ServerSignature OffServerTokens Prod
If you dont find it just add these two lines at the end of the file Note that after you modify the configuration file you must restart the Apache server
Plaintext Emails TestCongratulations Your webpage does not include email addresses in plaintext
Website IP CheckYour website ip address is 1447619203
IP Canonicalization TestYour sites IP 1447619203 does not redirect to your sites domain name This could cause duplicate content problems if a search engine indexes your site under both its IP and domain name
HOW TO FIX
In order to pass this test you must consider using a 301 re-write rule in your htaccess file so that your sites IP points to your domain nameIf your site is running on apache server you could put these lines in your htaccessafter RewriteEngine on line
RewriteCond HTTP_HOST ^XXXXXXXXXXXXRewriteRule () httpwwwyourdomaincom$1 [R=301L]
Note that you must proper format the first line using your IP (replace X characters with proper digits from your IP) and the second line using your domain name
Safe Browsing TestThis site is not currently listed as suspicious (no malware or phishing activity found)
Media Query Responsive TestYour website is not using media queries You should consider using this technique in order to implement responsive design functionalities
HOW TO FIX
Media queries allow you to style elements for specific devices (smartphones tablets desktop computers) by using attributes like width height resolution aspect ratio orientation or color By using media queries presentations can be tailored to a specific range of output devices without changing the content itselfExample
ltlink rel=stylesheet media=screen and (min-width 480px) and (max-width 960px) href=480-960css gt
lt-- OR --gtmedia screen and (min-width 480px) and (max-width 960px) header display none
An media rule specifies the target media types of a set of statements In the example above we are specifying the media type screen The max-width and min-width features are telling the browser that at any screen size larger than 480px but smaller than 960px hide any elements with id=header
Mobile Snapshot
Social Media CheckCongratulations your website is connected successfuly with social media using FacebookTwitter Google Plus Pinterest
Social Media ActivityYour website doesnt have any social media activity Search engines are increasingly using social media activity to determine which pages are most relevant for keyword searches In order to increase your page rank and to increase revenue generated through organic search you are adviced to increase your website social media engagement
Facebook Likes 2 Facebook Shares 3 Facebook Comments 0
No activity on Twitter
Google PlusOnes 1
No activity on Pinterest
HOW TO FIX
In order to increase the social media activity for your site you are advised to use some social networks plugins within your page Facebook Like Button Facebook Share Button Facebook Comments Twitter Button Google +1 Button Pinterest Button or AddThis Widget
httpwwwgifmaniaca
Animated Gifs of Cartoons and Movies Free Animated Gifs of Animated Cartoons Free Animations
Images Pictures Pics of Animated Images Animations Web Pages for Webmaster Canada
graphics Free Comics Games and TV Series Animated Gifs
Keywords Cloudactresses adventure algebra aliments animalsanimated animates animearts bars beaches bears cartoons characters chinese christmas clothes colorscompuserve computer confectionery create danger day design disaster disneydownload fantasy fathers female file films flowers fonts food format free funnygames ghosts gif gifmaniagifs gifts graduation halloween histories holidayshoroscope html image images its just knights lakes landscapes letters like lovemessages mothers movement movies musical networks objects office oops people platesplay presentation ready romantic sale scarecrow scares science screensaversseries share signs smileys social space supplies teddy text thanksgiving use usedvacations video wallpapers war warriors web zodiac
Deprecated HTML TagsCongratulations Your page does not use HTML deprecated tags
HTML Page Size TestCongratulations Your HTML size is 1188 Kb and this is under the average web page size of 33 KbThis helps lead to a faster than average page load time
HTML CompressionGZIP TestCongratulations Your page is successfully compressed using gzip compression on your codeYour HTML is compressed from 7122 Kb to 1188 Kb (83 size savings) This helps ensure a faster loading web page and improved user experience
Page Cache TestIt does not appear that you are caching your pages Cached pages serve up static html and avoid potentially time consuming queries to your database It also helps lower server load by up to 80 Caching most visibly benefits high traffic pages that access a database but whose content does not change on every page view Common caching methods include Alternative PHP Cache Quickcache and jpcache Caching mechanisms also typically compress HTML further reducing page size and load time
HOW TO FIX
In order to pass this test you are advised to use a caching mechanism for your pages There are three methods which can be used to caching your web pages
1 Alternative PHP caching
- Alternative PHP Cache (APC) is an open source framework which caches data using intermediate PHP code Most web programmers who are familiar with the PHP programming language can easily set up Alternative PHP Cache for your site
2 Quickcache- Quickcache is a lightweight page caching solution which was formerly known as jpcache Quickcache caches the page output rather than compiling the PHP page making it a superior version of page caching to the Alternative PHP caching Quickcache can be quickly downloaded from their website and can reduce your page load time up to 80
3 WP Super Cache- If you have a Wordpress website WP Super Cache can be installed within seconds and without no programming knowledge
Flash TestYour website contains flash objects
Nested Tables TestCongratulations your page does not use nested tables This speeds up page loading time and optimizes the user experience
Image Expires Tag TestCongratulations Your webpage use Expires header for your images and the browsers will display these images from the cache
Doctype TestYour website has a doctype declaration ltDOCTYPE htmlgt
Frameset TestCongratulations Your webpage does not use frames
Site Loading Speed TestYour site loading time is around 2445 seconds and this is under the average loading speed which is 5 seconds
JS and CSS Minification TestIts important to send as few bytes of CSS and JS markup down the wire as possible Its not just about size though its also about the number of requests to get the bits In fact thats often more of a problem then file size
JS Minification TestYou have more than one JS file Try combining them into one in order to decrease the number of HTTP requests
MINIFIED JS FILEShttpassetspinterestcomjspinit_mainjs
httpplatformtwittercomwidgetsjs
httpsapisgooglecomjsplusonejs
httpconnectfacebookneten_USalljs
httpwwwgoogle-analyticscomgajs
httpwwwgoogletagservicescomtagjsgptjs
httpwwwgifmaniacarecjsjquery-143minjs
httppartnergoogleadservicescomgptpubads_impl_37js
httppagead2googlesyndicationcompageadshow_adsjs
httpplatformtumblrcomv1sharejs
httplogpinterestcomvia=http3A2F2Fwwwgifmaniaca2Fampguid=wcKRQKYrYqZTamptype=pidgetampsub=wwwampbutton_count=1ampcallback=PIN_1398953924932fcallback[1]
NOT MINIFIED JS FILEShttpwwwgooglecomcoopcsebrandform=cse-search-boxamplang=en
httpwwwgifmaniacarecjsvertical-alignjs
httpwwwgifmaniacarecjsjqueryeasing13js
httpwwwgifmaniacarecjsslider_gifmaniajs
httpwwwgifmaniacarecjsslider_gifmania_containerjs
httpwwwgifmaniacarecjsparallax_positionjs
httpwwwgifmaniacarecjsparallaxjs
HOW TO FIX
In order to pass this test you must minify all of your external JavaScript files For this task you can use an online JS minifier like YUI Compressor Closure Compiler or JSMin
CSS Minification TestYou have more than one CSS file Try combining them into one in order to decrease the number of HTTP requests
NOT MINIFIED CSS FILEShttpwwwgifmaniacareccsshomecss
httpfontsgoogleapiscomcssfamily=Jockey+Oneampsubset=latinlatin-ext
httpwwwgifmaniacareccssstylescss
httpfontsgoogleapiscomcssfamily=Jockey+Oneampsubset=latinlatin-ext
httpfontsgoogleapiscomcssfamily=Chewy
HOW TO FIX
In order to pass this test you must minify all of your external CSS files For this task you can use an online CSS minifier like YUI Compressor or cssminjs
URL Canonicalization Testhttpwwwgifmaniaca and httpgifmaniaca resolve to the same URL
Directory Browsing TestCongratulations Your server has disabled directory browsing
Libwww-perl Access TestYour server appears to allow access from User-agent Libwww-perl Botnet scripts that automatically look for vulnerabilities in your software are sometimes identified as User-Agent libwww-perl By blocking access from libwww-perl you can eliminate many simpler attacks Read more on blocking Libwww-perl access and improving your websites security
HOW TO FIX
In order to pass this test you must block the libwww-perl user-agent in your htaccess file
If your site is running on apache server you could put these lines in your htaccessafter RewriteEngine on line
RewriteCond HTTP_USER_AGENT libwww-perl RewriteRule acirceuroldquo [FL]
Server Signature TestYour server signature is on Turning off your server signature is generally a good idea from a security standpoint Read more on how to turn off server signature and improve your websites security
Server Apache2225 (Unix) mod_ssl2225 OpenSSL100-fips PHP5217
HOW TO FIX
By default the Apache webserver sends HTTP headers with some information about your server version operating system modules installed etc These informations can be used by hackers in order to exploit vulnerabilities (specially if you are running an older version) These information can be hidden or changed with very basic configurations Open Apacheacirceurotrades configuration file (httpdconf or apacheconf) and search for ServerSignature If you find it edit it to
ServerSignature OffServerTokens Prod
If you dont find it just add these two lines at the end of the file Note that after you modify the configuration file you must restart the Apache server
Plaintext Emails TestCongratulations Your webpage does not include email addresses in plaintext
Website IP CheckYour website ip address is 1447619203
IP Canonicalization TestYour sites IP 1447619203 does not redirect to your sites domain name This could cause duplicate content problems if a search engine indexes your site under both its IP and domain name
HOW TO FIX
In order to pass this test you must consider using a 301 re-write rule in your htaccess file so that your sites IP points to your domain nameIf your site is running on apache server you could put these lines in your htaccessafter RewriteEngine on line
RewriteCond HTTP_HOST ^XXXXXXXXXXXXRewriteRule () httpwwwyourdomaincom$1 [R=301L]
Note that you must proper format the first line using your IP (replace X characters with proper digits from your IP) and the second line using your domain name
Safe Browsing TestThis site is not currently listed as suspicious (no malware or phishing activity found)
Media Query Responsive TestYour website is not using media queries You should consider using this technique in order to implement responsive design functionalities
HOW TO FIX
Media queries allow you to style elements for specific devices (smartphones tablets desktop computers) by using attributes like width height resolution aspect ratio orientation or color By using media queries presentations can be tailored to a specific range of output devices without changing the content itselfExample
ltlink rel=stylesheet media=screen and (min-width 480px) and (max-width 960px) href=480-960css gt
lt-- OR --gtmedia screen and (min-width 480px) and (max-width 960px) header display none
An media rule specifies the target media types of a set of statements In the example above we are specifying the media type screen The max-width and min-width features are telling the browser that at any screen size larger than 480px but smaller than 960px hide any elements with id=header
Mobile Snapshot
Social Media CheckCongratulations your website is connected successfuly with social media using FacebookTwitter Google Plus Pinterest
Social Media ActivityYour website doesnt have any social media activity Search engines are increasingly using social media activity to determine which pages are most relevant for keyword searches In order to increase your page rank and to increase revenue generated through organic search you are adviced to increase your website social media engagement
Facebook Likes 2 Facebook Shares 3 Facebook Comments 0
No activity on Twitter
Google PlusOnes 1
No activity on Pinterest
HOW TO FIX
In order to increase the social media activity for your site you are advised to use some social networks plugins within your page Facebook Like Button Facebook Share Button Facebook Comments Twitter Button Google +1 Button Pinterest Button or AddThis Widget
- Alternative PHP Cache (APC) is an open source framework which caches data using intermediate PHP code Most web programmers who are familiar with the PHP programming language can easily set up Alternative PHP Cache for your site
2 Quickcache- Quickcache is a lightweight page caching solution which was formerly known as jpcache Quickcache caches the page output rather than compiling the PHP page making it a superior version of page caching to the Alternative PHP caching Quickcache can be quickly downloaded from their website and can reduce your page load time up to 80
3 WP Super Cache- If you have a Wordpress website WP Super Cache can be installed within seconds and without no programming knowledge
Flash TestYour website contains flash objects
Nested Tables TestCongratulations your page does not use nested tables This speeds up page loading time and optimizes the user experience
Image Expires Tag TestCongratulations Your webpage use Expires header for your images and the browsers will display these images from the cache
Doctype TestYour website has a doctype declaration ltDOCTYPE htmlgt
Frameset TestCongratulations Your webpage does not use frames
Site Loading Speed TestYour site loading time is around 2445 seconds and this is under the average loading speed which is 5 seconds
JS and CSS Minification TestIts important to send as few bytes of CSS and JS markup down the wire as possible Its not just about size though its also about the number of requests to get the bits In fact thats often more of a problem then file size
JS Minification TestYou have more than one JS file Try combining them into one in order to decrease the number of HTTP requests
MINIFIED JS FILEShttpassetspinterestcomjspinit_mainjs
httpplatformtwittercomwidgetsjs
httpsapisgooglecomjsplusonejs
httpconnectfacebookneten_USalljs
httpwwwgoogle-analyticscomgajs
httpwwwgoogletagservicescomtagjsgptjs
httpwwwgifmaniacarecjsjquery-143minjs
httppartnergoogleadservicescomgptpubads_impl_37js
httppagead2googlesyndicationcompageadshow_adsjs
httpplatformtumblrcomv1sharejs
httplogpinterestcomvia=http3A2F2Fwwwgifmaniaca2Fampguid=wcKRQKYrYqZTamptype=pidgetampsub=wwwampbutton_count=1ampcallback=PIN_1398953924932fcallback[1]
NOT MINIFIED JS FILEShttpwwwgooglecomcoopcsebrandform=cse-search-boxamplang=en
httpwwwgifmaniacarecjsvertical-alignjs
httpwwwgifmaniacarecjsjqueryeasing13js
httpwwwgifmaniacarecjsslider_gifmaniajs
httpwwwgifmaniacarecjsslider_gifmania_containerjs
httpwwwgifmaniacarecjsparallax_positionjs
httpwwwgifmaniacarecjsparallaxjs
HOW TO FIX
In order to pass this test you must minify all of your external JavaScript files For this task you can use an online JS minifier like YUI Compressor Closure Compiler or JSMin
CSS Minification TestYou have more than one CSS file Try combining them into one in order to decrease the number of HTTP requests
NOT MINIFIED CSS FILEShttpwwwgifmaniacareccsshomecss
httpfontsgoogleapiscomcssfamily=Jockey+Oneampsubset=latinlatin-ext
httpwwwgifmaniacareccssstylescss
httpfontsgoogleapiscomcssfamily=Jockey+Oneampsubset=latinlatin-ext
httpfontsgoogleapiscomcssfamily=Chewy
HOW TO FIX
In order to pass this test you must minify all of your external CSS files For this task you can use an online CSS minifier like YUI Compressor or cssminjs
URL Canonicalization Testhttpwwwgifmaniaca and httpgifmaniaca resolve to the same URL
Directory Browsing TestCongratulations Your server has disabled directory browsing
Libwww-perl Access TestYour server appears to allow access from User-agent Libwww-perl Botnet scripts that automatically look for vulnerabilities in your software are sometimes identified as User-Agent libwww-perl By blocking access from libwww-perl you can eliminate many simpler attacks Read more on blocking Libwww-perl access and improving your websites security
HOW TO FIX
In order to pass this test you must block the libwww-perl user-agent in your htaccess file
If your site is running on apache server you could put these lines in your htaccessafter RewriteEngine on line
RewriteCond HTTP_USER_AGENT libwww-perl RewriteRule acirceuroldquo [FL]
Server Signature TestYour server signature is on Turning off your server signature is generally a good idea from a security standpoint Read more on how to turn off server signature and improve your websites security
Server Apache2225 (Unix) mod_ssl2225 OpenSSL100-fips PHP5217
HOW TO FIX
By default the Apache webserver sends HTTP headers with some information about your server version operating system modules installed etc These informations can be used by hackers in order to exploit vulnerabilities (specially if you are running an older version) These information can be hidden or changed with very basic configurations Open Apacheacirceurotrades configuration file (httpdconf or apacheconf) and search for ServerSignature If you find it edit it to
ServerSignature OffServerTokens Prod
If you dont find it just add these two lines at the end of the file Note that after you modify the configuration file you must restart the Apache server
Plaintext Emails TestCongratulations Your webpage does not include email addresses in plaintext
Website IP CheckYour website ip address is 1447619203
IP Canonicalization TestYour sites IP 1447619203 does not redirect to your sites domain name This could cause duplicate content problems if a search engine indexes your site under both its IP and domain name
HOW TO FIX
In order to pass this test you must consider using a 301 re-write rule in your htaccess file so that your sites IP points to your domain nameIf your site is running on apache server you could put these lines in your htaccessafter RewriteEngine on line
RewriteCond HTTP_HOST ^XXXXXXXXXXXXRewriteRule () httpwwwyourdomaincom$1 [R=301L]
Note that you must proper format the first line using your IP (replace X characters with proper digits from your IP) and the second line using your domain name
Safe Browsing TestThis site is not currently listed as suspicious (no malware or phishing activity found)
Media Query Responsive TestYour website is not using media queries You should consider using this technique in order to implement responsive design functionalities
HOW TO FIX
Media queries allow you to style elements for specific devices (smartphones tablets desktop computers) by using attributes like width height resolution aspect ratio orientation or color By using media queries presentations can be tailored to a specific range of output devices without changing the content itselfExample
ltlink rel=stylesheet media=screen and (min-width 480px) and (max-width 960px) href=480-960css gt
lt-- OR --gtmedia screen and (min-width 480px) and (max-width 960px) header display none
An media rule specifies the target media types of a set of statements In the example above we are specifying the media type screen The max-width and min-width features are telling the browser that at any screen size larger than 480px but smaller than 960px hide any elements with id=header
Mobile Snapshot
Social Media CheckCongratulations your website is connected successfuly with social media using FacebookTwitter Google Plus Pinterest
Social Media ActivityYour website doesnt have any social media activity Search engines are increasingly using social media activity to determine which pages are most relevant for keyword searches In order to increase your page rank and to increase revenue generated through organic search you are adviced to increase your website social media engagement
Facebook Likes 2 Facebook Shares 3 Facebook Comments 0
No activity on Twitter
Google PlusOnes 1
No activity on Pinterest
HOW TO FIX
In order to increase the social media activity for your site you are advised to use some social networks plugins within your page Facebook Like Button Facebook Share Button Facebook Comments Twitter Button Google +1 Button Pinterest Button or AddThis Widget
JS Minification TestYou have more than one JS file Try combining them into one in order to decrease the number of HTTP requests
MINIFIED JS FILEShttpassetspinterestcomjspinit_mainjs
httpplatformtwittercomwidgetsjs
httpsapisgooglecomjsplusonejs
httpconnectfacebookneten_USalljs
httpwwwgoogle-analyticscomgajs
httpwwwgoogletagservicescomtagjsgptjs
httpwwwgifmaniacarecjsjquery-143minjs
httppartnergoogleadservicescomgptpubads_impl_37js
httppagead2googlesyndicationcompageadshow_adsjs
httpplatformtumblrcomv1sharejs
httplogpinterestcomvia=http3A2F2Fwwwgifmaniaca2Fampguid=wcKRQKYrYqZTamptype=pidgetampsub=wwwampbutton_count=1ampcallback=PIN_1398953924932fcallback[1]
NOT MINIFIED JS FILEShttpwwwgooglecomcoopcsebrandform=cse-search-boxamplang=en
httpwwwgifmaniacarecjsvertical-alignjs
httpwwwgifmaniacarecjsjqueryeasing13js
httpwwwgifmaniacarecjsslider_gifmaniajs
httpwwwgifmaniacarecjsslider_gifmania_containerjs
httpwwwgifmaniacarecjsparallax_positionjs
httpwwwgifmaniacarecjsparallaxjs
HOW TO FIX
In order to pass this test you must minify all of your external JavaScript files For this task you can use an online JS minifier like YUI Compressor Closure Compiler or JSMin
CSS Minification TestYou have more than one CSS file Try combining them into one in order to decrease the number of HTTP requests
NOT MINIFIED CSS FILEShttpwwwgifmaniacareccsshomecss
httpfontsgoogleapiscomcssfamily=Jockey+Oneampsubset=latinlatin-ext
httpwwwgifmaniacareccssstylescss
httpfontsgoogleapiscomcssfamily=Jockey+Oneampsubset=latinlatin-ext
httpfontsgoogleapiscomcssfamily=Chewy
HOW TO FIX
In order to pass this test you must minify all of your external CSS files For this task you can use an online CSS minifier like YUI Compressor or cssminjs
URL Canonicalization Testhttpwwwgifmaniaca and httpgifmaniaca resolve to the same URL
Directory Browsing TestCongratulations Your server has disabled directory browsing
Libwww-perl Access TestYour server appears to allow access from User-agent Libwww-perl Botnet scripts that automatically look for vulnerabilities in your software are sometimes identified as User-Agent libwww-perl By blocking access from libwww-perl you can eliminate many simpler attacks Read more on blocking Libwww-perl access and improving your websites security
HOW TO FIX
In order to pass this test you must block the libwww-perl user-agent in your htaccess file
If your site is running on apache server you could put these lines in your htaccessafter RewriteEngine on line
RewriteCond HTTP_USER_AGENT libwww-perl RewriteRule acirceuroldquo [FL]
Server Signature TestYour server signature is on Turning off your server signature is generally a good idea from a security standpoint Read more on how to turn off server signature and improve your websites security
Server Apache2225 (Unix) mod_ssl2225 OpenSSL100-fips PHP5217
HOW TO FIX
By default the Apache webserver sends HTTP headers with some information about your server version operating system modules installed etc These informations can be used by hackers in order to exploit vulnerabilities (specially if you are running an older version) These information can be hidden or changed with very basic configurations Open Apacheacirceurotrades configuration file (httpdconf or apacheconf) and search for ServerSignature If you find it edit it to
ServerSignature OffServerTokens Prod
If you dont find it just add these two lines at the end of the file Note that after you modify the configuration file you must restart the Apache server
Plaintext Emails TestCongratulations Your webpage does not include email addresses in plaintext
Website IP CheckYour website ip address is 1447619203
IP Canonicalization TestYour sites IP 1447619203 does not redirect to your sites domain name This could cause duplicate content problems if a search engine indexes your site under both its IP and domain name
HOW TO FIX
In order to pass this test you must consider using a 301 re-write rule in your htaccess file so that your sites IP points to your domain nameIf your site is running on apache server you could put these lines in your htaccessafter RewriteEngine on line
RewriteCond HTTP_HOST ^XXXXXXXXXXXXRewriteRule () httpwwwyourdomaincom$1 [R=301L]
Note that you must proper format the first line using your IP (replace X characters with proper digits from your IP) and the second line using your domain name
Safe Browsing TestThis site is not currently listed as suspicious (no malware or phishing activity found)
Media Query Responsive TestYour website is not using media queries You should consider using this technique in order to implement responsive design functionalities
HOW TO FIX
Media queries allow you to style elements for specific devices (smartphones tablets desktop computers) by using attributes like width height resolution aspect ratio orientation or color By using media queries presentations can be tailored to a specific range of output devices without changing the content itselfExample
ltlink rel=stylesheet media=screen and (min-width 480px) and (max-width 960px) href=480-960css gt
lt-- OR --gtmedia screen and (min-width 480px) and (max-width 960px) header display none
An media rule specifies the target media types of a set of statements In the example above we are specifying the media type screen The max-width and min-width features are telling the browser that at any screen size larger than 480px but smaller than 960px hide any elements with id=header
Mobile Snapshot
Social Media CheckCongratulations your website is connected successfuly with social media using FacebookTwitter Google Plus Pinterest
Social Media ActivityYour website doesnt have any social media activity Search engines are increasingly using social media activity to determine which pages are most relevant for keyword searches In order to increase your page rank and to increase revenue generated through organic search you are adviced to increase your website social media engagement
Facebook Likes 2 Facebook Shares 3 Facebook Comments 0
No activity on Twitter
Google PlusOnes 1
No activity on Pinterest
HOW TO FIX
In order to increase the social media activity for your site you are advised to use some social networks plugins within your page Facebook Like Button Facebook Share Button Facebook Comments Twitter Button Google +1 Button Pinterest Button or AddThis Widget
In order to pass this test you must minify all of your external JavaScript files For this task you can use an online JS minifier like YUI Compressor Closure Compiler or JSMin
CSS Minification TestYou have more than one CSS file Try combining them into one in order to decrease the number of HTTP requests
NOT MINIFIED CSS FILEShttpwwwgifmaniacareccsshomecss
httpfontsgoogleapiscomcssfamily=Jockey+Oneampsubset=latinlatin-ext
httpwwwgifmaniacareccssstylescss
httpfontsgoogleapiscomcssfamily=Jockey+Oneampsubset=latinlatin-ext
httpfontsgoogleapiscomcssfamily=Chewy
HOW TO FIX
In order to pass this test you must minify all of your external CSS files For this task you can use an online CSS minifier like YUI Compressor or cssminjs
URL Canonicalization Testhttpwwwgifmaniaca and httpgifmaniaca resolve to the same URL
Directory Browsing TestCongratulations Your server has disabled directory browsing
Libwww-perl Access TestYour server appears to allow access from User-agent Libwww-perl Botnet scripts that automatically look for vulnerabilities in your software are sometimes identified as User-Agent libwww-perl By blocking access from libwww-perl you can eliminate many simpler attacks Read more on blocking Libwww-perl access and improving your websites security
HOW TO FIX
In order to pass this test you must block the libwww-perl user-agent in your htaccess file
If your site is running on apache server you could put these lines in your htaccessafter RewriteEngine on line
RewriteCond HTTP_USER_AGENT libwww-perl RewriteRule acirceuroldquo [FL]
Server Signature TestYour server signature is on Turning off your server signature is generally a good idea from a security standpoint Read more on how to turn off server signature and improve your websites security
Server Apache2225 (Unix) mod_ssl2225 OpenSSL100-fips PHP5217
HOW TO FIX
By default the Apache webserver sends HTTP headers with some information about your server version operating system modules installed etc These informations can be used by hackers in order to exploit vulnerabilities (specially if you are running an older version) These information can be hidden or changed with very basic configurations Open Apacheacirceurotrades configuration file (httpdconf or apacheconf) and search for ServerSignature If you find it edit it to
ServerSignature OffServerTokens Prod
If you dont find it just add these two lines at the end of the file Note that after you modify the configuration file you must restart the Apache server
Plaintext Emails TestCongratulations Your webpage does not include email addresses in plaintext
Website IP CheckYour website ip address is 1447619203
IP Canonicalization TestYour sites IP 1447619203 does not redirect to your sites domain name This could cause duplicate content problems if a search engine indexes your site under both its IP and domain name
HOW TO FIX
In order to pass this test you must consider using a 301 re-write rule in your htaccess file so that your sites IP points to your domain nameIf your site is running on apache server you could put these lines in your htaccessafter RewriteEngine on line
RewriteCond HTTP_HOST ^XXXXXXXXXXXXRewriteRule () httpwwwyourdomaincom$1 [R=301L]
Note that you must proper format the first line using your IP (replace X characters with proper digits from your IP) and the second line using your domain name
Safe Browsing TestThis site is not currently listed as suspicious (no malware or phishing activity found)
Media Query Responsive TestYour website is not using media queries You should consider using this technique in order to implement responsive design functionalities
HOW TO FIX
Media queries allow you to style elements for specific devices (smartphones tablets desktop computers) by using attributes like width height resolution aspect ratio orientation or color By using media queries presentations can be tailored to a specific range of output devices without changing the content itselfExample
ltlink rel=stylesheet media=screen and (min-width 480px) and (max-width 960px) href=480-960css gt
lt-- OR --gtmedia screen and (min-width 480px) and (max-width 960px) header display none
An media rule specifies the target media types of a set of statements In the example above we are specifying the media type screen The max-width and min-width features are telling the browser that at any screen size larger than 480px but smaller than 960px hide any elements with id=header
Mobile Snapshot
Social Media CheckCongratulations your website is connected successfuly with social media using FacebookTwitter Google Plus Pinterest
Social Media ActivityYour website doesnt have any social media activity Search engines are increasingly using social media activity to determine which pages are most relevant for keyword searches In order to increase your page rank and to increase revenue generated through organic search you are adviced to increase your website social media engagement
Facebook Likes 2 Facebook Shares 3 Facebook Comments 0
No activity on Twitter
Google PlusOnes 1
No activity on Pinterest
HOW TO FIX
In order to increase the social media activity for your site you are advised to use some social networks plugins within your page Facebook Like Button Facebook Share Button Facebook Comments Twitter Button Google +1 Button Pinterest Button or AddThis Widget
If your site is running on apache server you could put these lines in your htaccessafter RewriteEngine on line
RewriteCond HTTP_USER_AGENT libwww-perl RewriteRule acirceuroldquo [FL]
Server Signature TestYour server signature is on Turning off your server signature is generally a good idea from a security standpoint Read more on how to turn off server signature and improve your websites security
Server Apache2225 (Unix) mod_ssl2225 OpenSSL100-fips PHP5217
HOW TO FIX
By default the Apache webserver sends HTTP headers with some information about your server version operating system modules installed etc These informations can be used by hackers in order to exploit vulnerabilities (specially if you are running an older version) These information can be hidden or changed with very basic configurations Open Apacheacirceurotrades configuration file (httpdconf or apacheconf) and search for ServerSignature If you find it edit it to
ServerSignature OffServerTokens Prod
If you dont find it just add these two lines at the end of the file Note that after you modify the configuration file you must restart the Apache server
Plaintext Emails TestCongratulations Your webpage does not include email addresses in plaintext
Website IP CheckYour website ip address is 1447619203
IP Canonicalization TestYour sites IP 1447619203 does not redirect to your sites domain name This could cause duplicate content problems if a search engine indexes your site under both its IP and domain name
HOW TO FIX
In order to pass this test you must consider using a 301 re-write rule in your htaccess file so that your sites IP points to your domain nameIf your site is running on apache server you could put these lines in your htaccessafter RewriteEngine on line
RewriteCond HTTP_HOST ^XXXXXXXXXXXXRewriteRule () httpwwwyourdomaincom$1 [R=301L]
Note that you must proper format the first line using your IP (replace X characters with proper digits from your IP) and the second line using your domain name
Safe Browsing TestThis site is not currently listed as suspicious (no malware or phishing activity found)
Media Query Responsive TestYour website is not using media queries You should consider using this technique in order to implement responsive design functionalities
HOW TO FIX
Media queries allow you to style elements for specific devices (smartphones tablets desktop computers) by using attributes like width height resolution aspect ratio orientation or color By using media queries presentations can be tailored to a specific range of output devices without changing the content itselfExample
ltlink rel=stylesheet media=screen and (min-width 480px) and (max-width 960px) href=480-960css gt
lt-- OR --gtmedia screen and (min-width 480px) and (max-width 960px) header display none
An media rule specifies the target media types of a set of statements In the example above we are specifying the media type screen The max-width and min-width features are telling the browser that at any screen size larger than 480px but smaller than 960px hide any elements with id=header
Mobile Snapshot
Social Media CheckCongratulations your website is connected successfuly with social media using FacebookTwitter Google Plus Pinterest
Social Media ActivityYour website doesnt have any social media activity Search engines are increasingly using social media activity to determine which pages are most relevant for keyword searches In order to increase your page rank and to increase revenue generated through organic search you are adviced to increase your website social media engagement
Facebook Likes 2 Facebook Shares 3 Facebook Comments 0
No activity on Twitter
Google PlusOnes 1
No activity on Pinterest
HOW TO FIX
In order to increase the social media activity for your site you are advised to use some social networks plugins within your page Facebook Like Button Facebook Share Button Facebook Comments Twitter Button Google +1 Button Pinterest Button or AddThis Widget
HOW TO FIX
In order to pass this test you must consider using a 301 re-write rule in your htaccess file so that your sites IP points to your domain nameIf your site is running on apache server you could put these lines in your htaccessafter RewriteEngine on line
RewriteCond HTTP_HOST ^XXXXXXXXXXXXRewriteRule () httpwwwyourdomaincom$1 [R=301L]
Note that you must proper format the first line using your IP (replace X characters with proper digits from your IP) and the second line using your domain name
Safe Browsing TestThis site is not currently listed as suspicious (no malware or phishing activity found)
Media Query Responsive TestYour website is not using media queries You should consider using this technique in order to implement responsive design functionalities
HOW TO FIX
Media queries allow you to style elements for specific devices (smartphones tablets desktop computers) by using attributes like width height resolution aspect ratio orientation or color By using media queries presentations can be tailored to a specific range of output devices without changing the content itselfExample
ltlink rel=stylesheet media=screen and (min-width 480px) and (max-width 960px) href=480-960css gt
lt-- OR --gtmedia screen and (min-width 480px) and (max-width 960px) header display none
An media rule specifies the target media types of a set of statements In the example above we are specifying the media type screen The max-width and min-width features are telling the browser that at any screen size larger than 480px but smaller than 960px hide any elements with id=header
Mobile Snapshot
Social Media CheckCongratulations your website is connected successfuly with social media using FacebookTwitter Google Plus Pinterest
Social Media ActivityYour website doesnt have any social media activity Search engines are increasingly using social media activity to determine which pages are most relevant for keyword searches In order to increase your page rank and to increase revenue generated through organic search you are adviced to increase your website social media engagement
Facebook Likes 2 Facebook Shares 3 Facebook Comments 0
No activity on Twitter
Google PlusOnes 1
No activity on Pinterest
HOW TO FIX
In order to increase the social media activity for your site you are advised to use some social networks plugins within your page Facebook Like Button Facebook Share Button Facebook Comments Twitter Button Google +1 Button Pinterest Button or AddThis Widget
Mobile Snapshot
Social Media CheckCongratulations your website is connected successfuly with social media using FacebookTwitter Google Plus Pinterest
Social Media ActivityYour website doesnt have any social media activity Search engines are increasingly using social media activity to determine which pages are most relevant for keyword searches In order to increase your page rank and to increase revenue generated through organic search you are adviced to increase your website social media engagement
Facebook Likes 2 Facebook Shares 3 Facebook Comments 0
No activity on Twitter
Google PlusOnes 1
No activity on Pinterest
HOW TO FIX
In order to increase the social media activity for your site you are advised to use some social networks plugins within your page Facebook Like Button Facebook Share Button Facebook Comments Twitter Button Google +1 Button Pinterest Button or AddThis Widget
Recommended