View
218
Download
0
Category
Tags:
Preview:
DESCRIPTION
This is the March 2011 issue of University of Evansville's Crescent Magazine.
Citation preview
crescent
Bookworm CentralCentral provides an alternative to the stuffy libraries of old
$2.50
University of Evansville
magazine
College Culture Upfront
Major, MAJORProblems
Why all departments arent created equal
WHATS ON YOUR MIND?Getting up close and personal with social networking sites
March 2011 w uecrescentmagazine.com
Beyond the MIRRORCan you learn to love the skin youre in?
The POWER of Multi-taskingAtlas Allen carries his world on broad, steady shoulders
[ October 2010 ] Crescent Magazine 1
Bring this ad and receive a $5 bonus when you complete your fi rst donation!
General Requirements for Donating Plasma: 18-65 Years of Age Valid Picture ID Be in Good Health Proof of Social Security Number Proof of Current Residence Postmarked
You Could Earn Over $200 a Month!
Donate Plasma & Help
Save Lives! CALL
TODAY!
1810 N. First Avenue Evansville, IN 47710(812)463-6162
www.octapharmaplasma.com
[ February 2011 ] Crescent Magazine 1University of Evansville Alumni Association www.evansville.edu/alumni
R E A S U ERT
D I OT R A T I
&
N S
Every year on Founders Day, the Alumni Association recognizes alumni for their continuing commitment to the University of Evansville.
Congratulations to this years honorees: Celebrate
the Founding of
UE !
Upcoming Events to Remember
UE Birthday Party Feb. 18Founders Day Convocation and Awards Luncheon Feb. 20
February 10, 1854
The Universitys founders filed a certificate of incorporation with the State of Indiana establishing Moores Hill Male and Female Collegiate Institute. The name was shortened to Moores Hill College.
The school was chartered as Evansville College and the move to Evansville began.
February 17, 1919
February 17, 1967
With the signature of the Governor on this date, the name of the institution was changed to the University of Evansville.
Distinguished Alumnus Award Steve Harkness 70, retired president of Duke Energy Generation Services of Indianapolis, who endowed five scholarships, currently serves as a University trustee and chaired the presidential search committee.
Young Alumna Award Melissa A. (Guthrie) Wagler 04, Federal Government employee from Vienna, VA, who serves UE as a LEAGUE volunteer and mentor and numerous other worthy groups in her community ranging from Race for the Cure to Girl Scouts and Boy Scouts.
Edie Bates Volunteer Service Award Barbara Price 66, retired vice president of Health, Environment and Safety for Phillips Petroleum Company, who is a current trustee, mentor and past president of the Alumni Association Board of Directors. She endowed a scholarship and served as vice-chair for the presidential search committee.
Samuel Orr Honorary Alumna Award Laurel Vaughn, a retired teacher from Evansville. She is following in her parents footsteps with her incredible service to UE. She serves on Friends of UE Music board, Neu Chapel Society, Theatre Society and Purple Aces Club.
2 Crescent Magazine [ March 2011 ]
directors
[ THIS MONTHS ]
Theres an App for ThatTechnology does everything for us these days. It helps with homework, gives directions and can even blow out candles are you comfortable with that?
Wondering about Campus Crime and whats happening with Student Congress?visit uecrescentmagazine.com every week for updates
The award-winning LinC yearbook is
accepting applications for the 201112 academic year.
Editor-in-Chief Writing Editor Photo EditorCopy Editor DesignerSection AssistantsPhotographers
Pick up an application in Student Publications, second floor Ridgway or download an application from: uecrecentmagazine.com
Applications due April 4 in Student Publications
Questions? Contact tm2@evansville.edu
Still havent picked up your FREE copy of the
200910 LinC? Nows the time.
Students eligible for a FREE book
are those who were full time for both semesters
of the 200910 academic year.
It seems that nothing is private anymore. As technology advances, the world becomes smaller and there is no place to hide. But where do we draw the line? Why shouldnt you inform all of your friends on Facebook what you are doing every moment of the day or night? You just made a peanut butter sand-
wich. Good for you, champ.In this issue of Crescent Magazine, we will explore just how candid were be-
ing via websites like Facebook and Twitter, as outlets for our self-expression. How dependent we have become on technology as a whole, and how has that affected our need to express ourselves?
As more and more students are investing in laptops and smart phones, more of us are taking to the Internet to share every intimate or mind-numbingly mun-dane detail of our lives. We inform the social networking world of every move we make. You changed rooms? Time to change your status. But what happens when we share too much?
Most of us already know that parents, professors and potential employers can see everything we put out into the public domain, just by typing our names into Google. Some people make their social networking pages private but is that enough? Why take the extra effort to block someone or make a limited view pro-file, set just for them, when you could just censor yourself in the first place and avoid troublesome posts?
We are drawn to technology because it simplifies our lives. An app exists for al-most everything, so we can do most anything we did before and expend only half the effort. The phones and laptops keep getting smaller and more portable, which makes it that much easier for us to be attached to technology at all times. We dont have to wait until we get back to our rooms to update our statuses. All we have to do is whip out our phones and update them right in class. And if were all doing it if we all use our phones to calculate tips and look up driving directions then whats the problem?
The problem is figuring out what is too much. Once you have downloaded an app that will allow your phone to direct a gust of air at your birthday candles or blow the dust off your keyboard, have you become tech-savvy or just plain lazy? At the same time, sites such as Facebook and Twitter feed on our need to be the center of attention, and it seems these outlets have moved from being a margin-al part of our lives to being the center around which they revolve. Often we cant even have a conversation without bringing up a friends funny post or status or the latest YouTube video. If all mention of technology was taken out of our conversa-tions, what would be left? Anything?
Lets face it, our generation is about two things: spilling our guts and doing it the easy way. Certainly, the instant access to information provided by social net-working and other parts of the Internet has the potential to improve our lives, and the drawbacks do not yet seem to outweigh the benefit of convenience. Despite whatever concerns we may have, we continue to suck on the cold, robotic teat of mother technology it tastes so bittersweet. w
[ March 2011 ] Crescent Magazine 3
Sports
In the Know
Schitzengiggles
Through the Lens
Off the Wall
Janky vs. Juicy
Entertainment: Central Library
Beyond the Mirror
Whats on Your Mind?
Major, Major Problem
Food
Health & Science
Read with Passion
Fascinating People: Atlas Allen
Sports in Action
Campus Comment
The Lists
A Closer Look
Just the Facts
Crossword
w w w w
26
28
29
contentsMARCH 2011
uecrescentmagazine.com
4
6
9
10
11
12
14
19
23
24
30
32
32
On the Cover: Studying isnt the most exciting college pastime. Sophomore Caitlin Gilbert allows the time to pass a little quicker, making the task a little easier and more enjoyable by putting headphones in her ears to drown out the many sounds of the crowded Ridgway Center. Jessica Crihfield/Crescent Magazine
SLICEof life
31
25
16
8
HOW TO CONTACT US:
Address: 1800 Lincoln Avenue, Evansville, Ind. 47722
Phone: (812) 4882846
FAX: (812) 4882224
E-mail: crescentmagazine@evansville.edu
Marketing & Sales: (812) 4882221 and 4882223
Advertising E-mail: crescentadvertising@evansville.edu
Printer: Mar-Kel Quick Print, Newburgh, Ind.
CRESCENT MAGAZINE is UEs student magazine. It is writ-
ten, edited and designed by and for students, and distributed
seven times during the academic year. The magazine is funded
through advertising revenue and a subscription fee paid on be-
half of students by SGA. Circulation is 1,700. 2011 Student
Publications, University of Evansville.
Editorial Policy. Commentary expressed in unsigned edito-
rial pieces represent a consensus opinion of Crescent Magazines
Editorial Board. All other columns, articles and advertising are not
necessarily the opinion of the Editorial Board or other members
of the magazines staff.
Letter Submissions. E-mail your letters to crescentmaga-
zine@evansville.edu and write letter in the subject line. Cres-
cent Magazine welcomes letters from UE students, faculty, staff,
administrators and alumni, but material the Editorial Board re-
gards as libelous, malicious and/or obscene will not be published.
Letters should not exceed 400 words. For verification, letters must
include the authors name, year in school or title and e-mail ad-
dress. Crescent Magazine will not print anonymous letters or
those letters that cannot be verified. Letters may be edited for
length, style, grammar and spelling. They may also appear on
uecrescentmagazine.com.
EDITORIALWriting Director: Rachel SolavaWriting Editor: Brennan Girdler
Assignment Editor: Kristin BenzingerColumnists: Regan Campbell, Jon Harvey Contributing Writers: Elizabeth Crozier,
Joshua Garrett, Cassie Gutman, Jonathan Hall, Mindy Kurtz, Abby Sperry, Kate Wood
CREATIVEAssistant Creative Director: Amanda Topper
Photo Editor: Sunny JohnsonDesigner: Amanda Squire
Advertising Designers: Yolanda Alvarado, Ryan Cramer, Andrew Schulingkamp
Web Designers: Alyssa Key, Kristin Toney Contributing Photographers: Jessica Crihfeld,
Amy Rabenberg Website Consultant: James Will
Advertising Design Consultant: Melissa Weisman
EDITINGEditing Director: Lacey ConleyCopy Editor: Miranda Stinson
MARKETING & SALESMarketing & Sales Director: David Riedford
Marketing Liaison: Taylor Paquette
crescentMAGAZINE
w w w
4 Crescent Magazine [ March 2011 ]
[ SPORTS ]
The whole program
is great... I get out of
it what I put into it.
Sean Behensky
by Cassie Gutman
w
The 11 managers for the mens and womens basket-ball teams devote up to 35 hours a week to practices and games, traveling to away games as well.
did you know...
From pregame warm-ups to time-outs to tal-lying the final scores, more happens on the
basketball court than meets the eye. While the players warm up, managers make sure the locker room is clean, the water bottles are filled and ev-erything else is ready to go for the game. In order for the players to focus on the game, these extraordinary manag-ers take to the court before the clock even starts.
Sophomore Andy Hege-man, a manager for the mens basketball team, said he likes the focus to remain on the players.
Were not supposed to be in the spotlight or the center of attention, he said.
For the managers, its all about the team.
We make sure everything is set up so the players dont have to think about anything else, Hegeman said.
From filming the practices to running the clock, the man-agers take care of it all. They ensure the tapes of practices and games are sent to oppos-ing teams, they break down individual players statistics, they provide the players with towels and water on the side-lines and they even do the teams laundry.
Freshman Carissa Kepner, another manager for the mens team, explained that a manag-ers job begins long before the game does.
We have [warm-ups] in the morning, and after those I gather laundry and vacuum
the locker room, she said. In fact, the managers ar-
rive at Roberts Stadium two hours before each game starts to ensure that every-thing is ready. Kepner said the position can be so much work, its almost like a full-time job. And although the late-night laundry can in-trude upon her schedule, she still has time to finish her homework and spend time with her friends.
We divide the laundry, Kepner said. It lightens the load.
Even though she is used to the workload she also managed at her high school in Denver Kepner had to learn new skills to continue the job in college.
The upperclassmen have been really helpful, and we joke around a lot, she said. Theres support there be-cause were all friends.
And while Kepner is the only female manager for the mens basketball team, she said this does not affect how she interacts with the team or
her ability to perform tasks.Its not a place where
the guys make fun of me or treat me differently, she said. The team takes care of each other. I cant do ev-erything by myself, and neither can they.
This feeling of unity echoes with all the manag-ers. They work together to get the team ready for prac-tices and games, helping whomever they can.
Theres a sense of ac-complishment and respon-sibility that I really enjoy, Kepner said.
While freshmen like Kepner have been learning the ropes, senior Sean Be-hensky has held his posi-tion for three years.
The whole program is great, and I get out of it what I put into it, he said.
In his three years as a manager for the mens team, he has established close relationships with both players and coaches.
Hegeman explained that the upperclass managers sit behind the bench during the games, getting water and towels ready for time-outs and making sure the ac-tivity on the sidelines runs smoothly.
Thankfully, all their hard work does not go unnoticed by the coaches.
The coaching staff is very nice and cooperative. Theyve helped me with class and given recommen-dations for jobs and schol-arships, Behensky said.
The managers see ev-ery opportunity as a learn-ing experience, looking to the coaches for guidance and advice. Kepner said the coaches always stress the importance of being like a family.
With this mentality, managing the team is so much more than just an ex-tracurricular activity. For some, it is even a step to-ward a career in coaching.
Coaching is extremely important to me, Hegeman said. Its my work, and its my future. A sports management major, Hege-man hopes to someday be a head coach and knows that his job managing is critical to his plans.
Its definitely a full-time job, he said. The older I get, the more hours I put in.
For freshman Becca Lackey, a manager for the womens team, its all
the forcesBEHINDthe benchManagers behind the scenes get the Aces prepped, pumped and ready to play some serious hoops.
[ March 2011 ] Crescent Magazine 5
All-AmericanCar Wash
Show Student ID
for$2off any Package
805 S. Green River Road Near Sonic Drive-In
4 N. WeiNbach ave. 5 blocks North of Ue
&Uncle VinnyAce Purple The Aces of the best pizza,
stroms and enthusiasm in the world!
about the players improvement. I love seeing the women
progress as players, she said. Were only halfway through [the season], and I can already see a big improvement.
Lackey also played basketball in high school and enjoys seeing it played at the collegiate level.
But no matter how the manag-ers began and no matter how they plan to use their managing expe-rience in the future, they all un-derstand the importance their roles play in the success of the team. The managers spend count-less hours with their teams at practice, on road trips and during meals all of which bring them closer together.
Were all good friends, Be-hensky said. Ive known some since my small group, freshman year. He said that after some practices, the managers even like to shoot some hoops themselves.
Like any job, managing can prove to be difficult on top of homework and studying, but the managers all agree that their hard work pays off. And it shows in the high distinctions they have received.
Recently, Behensky was awarded an Athletic Equipment Managers Association scholar-ship, and he also received the Mark D. Kniese Scholarship as the top manager at UE.
I respect Sean so much, He-geman said. He is able to juggle so much on top of managing, and I really look up to him for that.
Mutual respect and countless hours together have created these ties among managers, which are visible on the court as well.
The managers get pumped up for the game just like the players do, and they love to watch a well-deserved victory after all their hard work.
I love the competition, He-geman said. The thrill of being with a collegiate athletic program is great, and we want to win just as much as the players. Were hurt just as badly when we lose. w
6 Crescent Magazine [ March 2011 ]
inflated and to drive the car at a steady speed. Accelerating too quickly can burn through gas much faster than driv-ing at a consistent speed.
Newer cars also have less of a chance for a mechanical breakdown, Ricketts said.
When choosing a vehicle to take to the beach, it is advised to pick the new-est make. According to fueleconomy.gov, traveling with luggage packed on the roof allows more space for passen-gers inside the car, permitting the vehi-cle to be of smaller size. Smaller vehi-cles mean better gas mileage, and better gas mileage means more money to spend on vacation.
Bowen gave three tips for efficiency. The first is maintaining your cars igni-tion system, which includes spark plugs and other hardware. He also recom-mends keeping the air filter up-to-date and keeping your tire pressure high.
Fueleconomy.gov suggests checking the air filter in your car before head-ing out on a long trip. A clogged air fil-ter can cause the engine to work harder, using more gas and costing more. OIL
We all know the idea of doing your own oil change can sound a little scary. While the process can be a messy one, it isnt as difficult as you might think. It just takes three easy steps.
For this project, youll need an oil filter, an oil recycle container, a funnel, new oil and a clean rag. Before you start, make sure the engine is off and completely cooled down. Put some-thing under the engine in case the oil spills.
The first step is to let the old oil out.
[ IN THE KNOW ]
Cars 101Tips and tricks for maintaining your car aimed at amateur grease monkeys.
w w w w
by Brennan Girdler, Cassie Gutman & Elizabeth Crozier
w w w wTHE BOTTOM LINE
Keep you car in check. Knowing standard maintenance is vital to stretching a tank of gas, keeping your engine healthy and staying safe.
With road trip season steadily approaching, it is important for drivers to be sure their cars are in good condition. Tires, gas, oil and coolant are four important parts of car care and wellbeing. By keeping these in check, those on the road can be sure they have safe and also affordable trips. TIRES
When it comes to vehicle safety, most drivers do not realize that their biggest danger could be right be-neath them. Tires are an essential part of every car they spin, they make you go and maintaining them is just as important as keeping your gas tank above E.
Wet roads? Ice? Snow? Tires are designed to handle these con-ditions, but because they are rub-ber, their treads deteriorate with ev-ery mile. One trick of the trade for checking your treads is the penny test. Most states consider tires legally worn when less than 2/32 of an inch of tread remains. By putting a pen-ny into the treads, drivers will know when their tires are too worn.
If Lincolns head is visible above the tread line, a driver can be at risk. According to Tirerack.com, if less than 4/32 inches of tread is left, a ve-hicle is in danger of hydroplaning or floating across puddles of water and losing traction.
To minimize tread-wear, it is im-portant drivers rotate their tires. Ac-cording to Tiresafety.com, doing this shifts the wear spots on the tires. It is recommended that tires be rotated every 5,000 to 7,000 miles.
Tire pressure can also be a good danger indicator. If tires are underin-flated, they can be overloaded by the weight of a car and can be ruined. Or if it is a hot day and they are overin-flated, tires are at risk of exploding.
Every vehicles user manual has
information regarding the recommend-ed pressure.
Kevin Bowen, owner of Bowen Auto Services, said tire pressure is vital because keeping tires full reduces roll-ing resistance. This can increase mile-age, but may have a negative ef-fect on the tires wear-expectancy. Bowen also recommended rotating tires every 5,000 to 7,000 miles or every other oil change.
Try to check each tires pressure every month. One quick, simple check can save a driver from a col-lision or decreased mileage not to mention pricy new tires. EFFICIENCY
As gas prices continue to climb, stu-dents are becoming more concerned with saving money on long drives and trips. Before gearing up for a road trip to the beach, check out your vehicle to make sure youre getting the best gas mileage you possibly can, so you get the most bang for your buck.
Tony Ricketts, D-Patrick general sales manager, suggests simply keep-ing your car maintained and updated both of which relate to mileage.
Anything can cause the fuel effi-ciency to drop, and good maintenance makes everything run smoothly, he said.
Ricketts also said to keep the tires
Anything can cause the fuel efficiency to drop, and good maintenance makes everything run smoothly.
Tony Ricketts
[ March 2011 ] Crescent Magazine 7
$cholar$hip$ available
Contact Daryl Buente 488-2295
Baseball qCross Country q Tennis qSwimming & Diving q
are needed for:
To do this, locate the drain plug on the bottom of the engine. Pull out the bolt-looking plug, and let the oil drain into the oil recycle container. Be sure to re-place the drain plug before moving on.
Next, you must replace the oil filter. To do this, first remove the old oil filter using a wrench and turn the filter coun-terclockwise until it is free. Be careful, because there may still be oil in the fil-ter, which could spill. Before putting in the new filter, lubricate the rubber gas-ket and fill the filter two-thirds of the way full with oil; then screw the filter back in place.
Finally, its time for the new oil. Take off the oil cap, located under the hood, and insert the funnel. Your car manual will provide information about how much oil your car holds, and it is recommended you add only three-fourths of that amount. Use the dipstick to check the oil and add more as needed until the tank is three-quarters full.
Oil changes should be done every 7,500 miles for cars that are handled well and receive regular maintenance. But because anyone can get a license,
and most drivers dont follow every rule of the road, it is best to change it every 3,000 miles.
COOLANTCoolant is an often-overlooked but essential part of keeping every car healthy. Before checking the coolant levels, make sure the engine is no lon-ger hot. Then pop the hood and check the levels.
According to automedia.com, cool-ant, or antifreeze, is designed to circu-late through the engine block to keep it from overheating. Bowen said its im-portant to change the coolant at least once a year, to cover the temperature range your vehicle will encounter.
Coolant is located in a clear plas-tic container, with measurements on the side to show the high and low levels. If its low, add more. Adding coolant is very easy.
Unscrew the cap on the coolant con-tainer, then add a 50/50 mix of cool-ant and water until it reaches the full line. You can combine the mixture yourself or buy a premixed jug. w
96%of UE Students
dont rely on luck,
they rely on
CM because its
8 Crescent Magazine [ March 2011 ]
these questions THREEI locked
eyes with
this mus-
tachioed
man,
and the
intensity
of his gaze
indicated
that he
knew I
was a
Canadian
trying to
escape to
America.
[ SCHITZENGIGGLES ] Sometimes the meaning of life is doing stuff that makes your mother threaten suicide. Sometimes its
something as simple as getting a facial tattoo.
w Regan Campbell, a senior creative writing major from Vincennes, presents his special brand of humor on lifes lighter moments.
wIt is fair to assume that each of us, at whichev-er level of education or life we may be stationed,
was at some time prone to be-having stupidly.
As a freshman in college, certain thoughts start circulat-ing in your head, spilling in like the voice of some alcohol-saturated god with only the best advice things like Oh man, Im going to have so much sex! and Hey, lets do some crazy shit this Spring Break!
Though I may pretend to be the paragon of maturity, these thoughts were at the fore-front of my mind four years ago, when some friends and I got it in our heads to depart on a Counter-Intuitive Spring Break, which had evolved into a road trip to Canada.
When something like this enters a young persons head, the mind becomes like a shiny, bright marble, reflecting only the genius of all things. So, we departed the following morning four of us, huddled togeth-er in a two-door Monte Carlo, which after six hours began to feel more like a giant, amphib-ious personnel carrier headed for the beaches of Normandy.
But our Private Ryan waited beyond the border of another land, and instead of Matt Da-mon, his name was Beer.
Windsor, the Canadian city across the river from Detroit, is a sluggish, colorless, probably cultureless imitation of Amer-ican cities. We spent the day trying to figure out how to pur-chase alcohol, eating Kentucky Fried Chicken and watching No Country for Old Men at a movie theater.
With all our objectives met,
we decided it was time to make the long drive home in one go.
It was night when we ap-proached the Can-American border, and the car in front of us passed through the queue in 10 seconds. Easy, some-body said.
We pulled up and presented all our forms of identification, and the guard began asking a series of questions about our stay, where we were from and the contents of the trunk.
Our driver was answering the questions quickly and hon-estly, but his nerves were catch-ing him. We were a carful of college kids who had driven up from southern Indiana to spend one day in Canada. It looked bad. None of us realized it until we were preparing for the pros-pect of having gloved fingers searching under our eyelids for prescription pills.
We listened as he started to introduce false paradoxes into our story. Then he stopped.
Who is he? he said. Why are you hiding his face? He meant me. I was seated with my face concealed by a fogged-up window. I leaned forward and said, Hello, here I am.
I locked eyes with this mus-tachioed man, and the intensi-ty of his gaze indicated that he knew I was a Canadian trying to escape to America. It was so intense, I was convinced it must be true and all my memories to date were artificial implants to keep the heat off my smugglers.
You are in school?Yes.What do you study?C-creative writingHis eyes darkened. What
do you write?
Fiction?How much would you
charge to do some typing for a person who wanted to set up a website?
Im Im sorry?He repeated himself slow-
ly and grimly, with bold, fear-some eye contact, watching my French Canadian mouth imitate the sounds of American words. He claimed he and his brother were opening a jewelry shop, and since English was his third language (Think about that I could really screw up your life right now), he wanted someone with an understand-ing of the language to make di-amonds easier to sell.
He wanted my e-mail ad-dress, and I sure as hell gave it to him. He chatted to us a while longer while he checked the validity of the address and then bid us adieu. We all breathed.
Somehow, this border-hop-ping Tom Clancy espionage was merely the beginning. A blizzard descended upon the Midwest as we worked our way south. I best remember the world turning white, the wind-shield coated with ice.
The drive lasted well into the morning, and when we ar-rived back at UE, there was a drawn-out, explosive confron-tation about the Cheez-Its I had accidentally ground into the floorboard.
It was one of the scenes from Stand by Me in which everyone starts screaming and crying for no real reason. Each of us could sense it we were alive, we loved each other dearly and it was time for each of us to find and settle down with a nice girl. And that, as they say, was that. w
[ March 2011 ] Crescent Magazine 9
[ THROUGH THE LENS ] A monthly look at campus happenings
t he Beatles, Spice Girls and Amy Winehouse provided much of the inspiration for this years British Invasion-themed Musical Madness, where eight teams danced and sang to prove who was campus royalty.
Zeta Tau Alpha and Sigma Phi Ep-silon were named the winners of the annual competition, with freshman Kenzie Sweeney of Zeta and sopho-more Collin Jones of Sig Ep named best actress and actor. Sophomore Sam Rodriguez of Phi Gamma Del-ta and junior Cassandra Snelling of Alpha Omicron Pi were named out-standing directors.
Participants and audience alike had a smashing good time while rais-ing money for the local Ronald Mc-Donald House. w
Musical MadnessJan. 2223
Simply Smashing
Sophomore Collin Jones sings about how he is losing a friend to an addiction as part of the Sigma Phi Epsilon and
Zeta Tau Alpha skit. Sunny Johnson/Crescent Magazine
Reconnecting with her boyfriend from England brings sheer excitement to Jean-ie, played by freshman Bailey Wellspring, and her friends, senior Susan McKinley and freshman Liz Hoppensteadt. Amy Ra-benberg/Crescent Magazine
Amid the crazy first practice of the Glee Club, freshman Kate McKnight sings along as she is sorted into a Har-ry Potter house during the Chi Omega and Phi Gamma Delta skit. Sunny Johnson/Crescent Magazine
10 Crescent Magazine [ March 2011 ]
FISHING FOR TROUBLE Take a trip to your local pet store and pick out a fish that is vicious and gross. From there on, the prank mostly takes care of itself. Put the fish in its new porce-lain home, and dont forget to feed it. Wait for the restroom stall door to latch then, a moments shuffling, a scream. (Note: We do not condone animal cruelty, fake fish work wonders, too.)
(jokesprank.com)
Possession of Airguns
In Nome, it is illegal to carry or discharge an airgun, bow and arrow or slingshot within city limits.
ak
Rolling or Throwing Rocks
In Boulder, ironically, no one shall roll, throw or move rocks on any public prop-erty unless authorized to do so.
co
Airplane Operation
It is unlawful to have physical control of an aircraft if you have 500ths of 1 percent or more alcohol in your body fluids.
ne
Unauthorized Ordering
It is unlawful to place an order for goods to be delivered to another person without his or her consent.
la
Overtaking on the Left
A driver passing on the left shall give a timely, audible signal before overtaking another vehicle at a safe distance.
ri
Improper Language
In Cumberland, profane or indecent lan-guage or behavior in a park, playground or adjoining sidewalks is prohibited.
md
Oddlaws
Next of SwimPeople take drastic
measures to pay their bills, but when
one English town decided to heat
its swimming pool using the discharge
from a crematorium. Some agreed it
made sense to be going green but that this case pushed the boundaries a bit far.
Check Your KnotAdam Potter didnt want to fly, but when he fell down the eastern slope of Sgurr Choinnich Mor, he didnt have a choice. Miraculously, the slope slowed his fall enough that he survived, and when a rescue helicopter arrived they found him in shock, stand-ing up and checking his map.
of the
by james macleod Information provided by dumblaws.com
MACLE
ODVIS
ION
[ OFF THE WALL ]
Midori Melon Ball DropSt. Patricks Day is nearly upon us, and what better way to honor the Irish than with a recipe for green cocktails? About.com says Midori melon liqueur is perfect for giving your beverage that rich emerald color without using other non-food ingredients or dye. Start by rimming your glass with sugar. Pour all ingredients into a shaker with ice, shake and then strain into your glass. Add a melon ball for a garnish, or if you want to be festive, cut your melon into the shape of a shamrock.
Ingredients:2 oz Midori melon liqueur
1 oz citrus vodkaSplash of lemon juice
I just got a citation for
peeing in a flowerpot.
Its going on my fridge.
Apparently Safety
& Security doesnt
support my efforts to
beautify the campus.
UE TFLN
[ December 2010 ]
leastcommonmultiple
t
Today, were going to talk about the Wheatstone Bridge. It doesnt have anything to do with wheat or stone its just
some dude that invented this thing.David Fentress, physics lab supervisor
w w w wPROFTIFICATING
WERE CELEBRATING WHAT...
w
NatioNal Umbrella moNth As springtime showers start to fall, go singin in the rain with your umbrella and galoshes.
ww
DolphiN awareNess moNth While our Glee friend doesnt have respect for them, we know theyre more than just gay sharks.
hoNor society aware-Ness moNth For all those moms with the my child is an honor student sticker on the backs of their vans.
Just a few of our favorite things
Have an AffairAccording to a recent study, men are twice as likely to stay with girlfriends who cheated on them with other women than those who cheated with other men. Women, the study concluded, more fre-quently object to continuing a relationship after their partners ho-mosexual affair.
Valentines Day FlopIf your cheap roses and Herseys Kiss failed to please your Valen-tine, you may have set your sights a little low. A Japanese accessory company released a chocolate-themed, partially edible car. For only $28,871, you could have shown your date how sweet they really are.
Dolly for DinnerAfter a 20-year ban on haggis in the U.S., the Scots are begging for access to a potentially lucrative American market. The Scottish Rural Affairs Secretary said its time to allow imports to resume. This iconic lung-based food could be yours soon. compliments of telegraph.co.uk
Janky
w
Theres nothing like a game of chess to make you feel sophisti-cated. And nothing shouts class like 186 carats of diamonds. The Royal Diamond Chess Set, created by French artist Bernard Maquin, is truly a marvel. And beauty like this is not made overnight; it is reported that Maquin spent over 4,500 hours working on this piece. The dazzling board game is crafted from 14-carat white gold and adorned with 9,900 black and white diamonds.
According to most-expensive.net, this set can be yours for $500,000. Good thing chess is
more about brains than brawn
wouldnt want to
chip a rook.
70percent of people driving on a highway this second
are speeding.
.150calories an hour can be burned by banging your head against a wall.
85million tons of paper are used in the United
States every year.
9The billionth digit of pi.
81/2years.
The amount of time you would have to yell to produce enough
sound energy to heat a cup of coffee.
www.dumbfacts.com/facts/directory-of-facts/statistics/random/
vs.
Janky: Taco Bell Beef Ev-eryone is well aware of the scandal surrounding the contents of Taco Bells beef. While it is suspicious enough that the meat contains 88 percent USDA inspected, not approved, beef, it is even more trou-bling to hear of the other ingredi-ents. Silicon dioxide also known as sand anyone?
Juicy: Ethically Treated Beef Besides the peace of mind of know-ing it is actually meat, you can do our animal brethren a little service. This doesnt mean you need go out and join the ranks of PETA, just that you like your meat products treated with some care.
Janky: Cougars and Panthers These animals need to stay in the wild. Dont try to say that love knows no age; a 50-year age gap is definitely something you will notice.
Juicy: Staying within a Decade If you are looking for someone a little older or younger, then at least try and keep your prospects to an age no more than 10 years different from your own. Dont rob the cradle or the grave, for that matter.
Janky: Bodily Fluid Inspired Fragrances Lady Gagas new scent is in the making and is said to have been inspired by the wonder-ful scents of blood and semen. And Gaga isnt the only one who finds inspiration from bodily fluids. Rad Houranis fragrance Adolescence is supposed to smell like a mix of baby powder and semen. Ah, the happy scents of our teenage years.
Juicy: Anything Else To each their own, but still lets avoid covering up our perspermation with spermfumes and pick any other scent in the world. What happened to the days of sandalwood and lavender?
12 Crescent Magazine [ March 2011 ]
[ ENTERTAINMENT ]
Our mission is to promote read-ing, lifelong learning, cultural initia-tives and economic vitality, said Amy Mangold, marketing and communica-tions manager for the Evansville Van-derburgh Public Library System. We also want our libraries to be a pub-lic space for everyone to gather, an in-viting space for just hanging out or for taking a class.
The EVPLS has noticed that the 1830 age group tends to stay away from the library. Since this discovery, those at the library have been doing their best to capture more of that audience. As part of a business constantly searching for new ways to draw in a crowd, they must be doing something right.
Located in a new and up-to-date building just down Walnut from cam-
pus, Central offers stu-dents a chance to fall in love with their city library.
Senior Devin Chambers is a fan, and said UEs library is useful for conduct-
A place that offers more than just fiction is raising the bar for libraries
by Kate Wood
ing scholarly research but that Central is the place for everything else.
She enjoys Centrals DVD rental section, which allows her to check out recently released movies without hav-ing to spend any money at all.
Theres no need to pay however much at Blockbuster or Family Video for one night when you can get it free at the library for five nights, Cham-bers said.
Mangold said this is one of Cen-trals best features because students on a tight budget can still get what they want of the media, not only DVDs, but also CDs, downloads and online data-bases as well.
But Central goes beyond just books and media and offers classes that ap-peal to a variety of interests. There are computer classes for everything from Flickr to photo editing. The Mesker Park Zoo Lecture Series brings in out-side speakers from different organi-zations to talk about animals. And en-vironmental classes are available for those interested in learning more about preserving the Earth.
Central also has a number of
groups. The Banned Books Club meets Sundays at Penny Lane to discuss banned books and why they were banned. There is also a classic film club that meets once a month on Thursdays. Otona no Otaku, for anime and manga fans, meets Monday nights, and culture nights are Tuesdays. A full schedule of events is available on EVPLs website.
We now have a greater variety of programs to serve as many people as we can, and what people really like is our programs are free, Mangold said.
Centrals aim to enhance the com-munity has led to partnerships with the
Central Library 200 S.E. Martin Luther King Jr. Blvd.9 a.m.9 p.m. MondaysThursdays 9 a.m.6 p.m. FridaysSaturdays 1 p.m.5 p.m. Sundays
Books, movies, music, live performances, clubs and special-inter-est classes are all great means of entertainment. Yet even with ad-vances in technology and growing multimedia sources, there is rarely ever a single place that can satisfy a citys entertainment needs. Central Library is trying to change that.
[ March 2011 ] Crescent Magazine 13
Evansville Literacy Coalition, USIs The Big Read, WNIN, Homeless Youth Coalition and homebound servic-es for the disabled.
Perhaps the biggest event Central or-ganizes is the One Book, One Com-munity program, where one book is chosen for everyone in the communi-ty to read and then several discussion panels are held and finally the author is brought in to talk about the book.
The goal is to reach out to and pro-vide for every member of the commu-nity, especially students. Central is ac-cessible enough that students dont even have to enter the building to find what they need. The library has a set-up where students can be instant mes-saged, called, e-mailed or even texted
through the Text a Librarian feature. Central has also made it easy for stu-
dents from outside the Evansville area to get a library card. All students need to do is bring in their university ID and fill out an application, and they will be issued student cards. The student card is good at any EVPL location and is ac-tive for the remainder of time the card-holder is a student.
Even if you dont want a library card, Central is still an inviting place to study, with the Cup & Chaucer Cafe, free wireless, big comfy chairs, a large selection of online resources and jour-nals and plenty of experts to answer re-search questions.
Senior Nick Wenz said Central is one of the nicer things about Evans-ville, much nicer than he ever expect-ed it to be.
Central was certainly a building
built with the custom-er in mind, and every-thing is in good con-dition because the facility has been used for only five years.
Central used to be located on S.E. Fifth Street, where the Childrens Mu-seum of Evans-ville is now housed, but as attendance in-creased, things became cramped. The current location has doubled its square footage and its attendance. Dai-ly visits to the library have increased each year. Last year alone, the EVPLS had 1.8 million visits.
Along with its growing patron-age, the library has grown technological-ly. The library has in-creased wireless In-ternet access, added more public comput-ers and bulked up its e-book collection. The EVPLS is even taking care to keep up with the most recent up-
grades in digital formats. Despite all its offerings of digi-
talized media, Central breaks the ste-reotype of the cold, impersonal automated service with its inviting at-mosphere. Mangold pointed out that Central has a certain ambience, almost a Barnes & Noble feel, without the price tag.
Junior Danielle Kegley recently ob-tained a library card and is incredi-bly satisfied with the facility. She loves how the building is spacious, without sacrificing comfort or a personal touch, which she credits to the friendly and helpful staff.
Above all, she said she enjoys how exciting visiting a library can be no longer a boring trip to a stuffy dungeon of books housed in a cold environment, but an adventure in all areas of enter-tainment and learning. w
Sunny Johnson/Crescent
From the shelves of neatly packed books, to the spacious lobby ar-eas of intricate art and even a quiet coffee shop for those who need a quick pick-me-up, Central Library brings comfort and convenience to-gether in one building.
14 Crescent Magazine [ March 2011 ]
[ BODY IMAGE ]
By Kristin Benzinger & Jon Hall
BEY Othe
MIRROR ND
As much as wed like to think our physical appearance isnt important, often how we look really does make a dif-
ference. With all the pressures from friends, family, peers and society, its no wonder we can get to be so insecure.
For junior Hatti Johnson, pressures concerning her size have played a sig-nificant role in shaping who she is to-day. When Johnson was in middle school, she was considered overweight.
Her parents were constantly after her, saying she should work out and lose the weight. Johnson said her father was concerned because diabetes runs in her family, and he wanted her to stay healthy. When it came to her mother, though, this did not seem to be the case.
With my mom, it was more for looks, Johnson said. They (my par-ents) made me feel really bad.
Today, Johnson is at a better place with her body and says she feels con-fident being the woman she is. But we are not all lucky enough to be comfort-able in our own skin. We want our out-er appearances to reflect who we are on the inside. We all want to be the people we are in our heads.
[Body image] really has to do with the way you view yourself, said Jes-sica Zellers, health education coordi-nator. Its more how you feel, not so much what you see in the mirror.
This is true for men and women. And though body image seems to be more of a problem for women, many men struggle with it as well. In a 1997 survey conducted by Psychology To-
day, 43 percent of men indicated they were unhappy with their overall appear-ance. And these dissatisfactions have increased as the pressure to obtain an ideal body continues to bombard them. Society tells men that they need to be tough and muscular, so its no surprise that more men are feeling inadequate.
Im jealous of the physiques I see in [movies like] 300, senior Wes Kirk said. I think a lot of guys want the big biceps or the six-pack.
He recalled feeling unhappy with his body near the end of high school. Since then he has been striving to make his body perfect by his standards, at least keeping motivated with the help of a workout partner and strenuous hobbies like rock climbing.
Id like to impress, Kirk said. I think [my body is] adequate, but I still strive to make it better.
Body image does not develop over-night, nor is it constant. Many things around us contribute to how we see ourselves. And while body image is something personal and is specific to each person and their own set of influ-ences, no one is immune to the culture.
I think as strong as you may be, [societal pressures are] very promi-nent, freshman Shelby Phelps said. Youre going to want to follow a trend.
On TV and in magazines we are shown models and actors who sport a specific body type. In her book Body Image, Sarah Grogan notes that these men are likely to be average-sized, but toned, and the women are underweight.
I think our culture does us a huge disservice, said John Felton, assis-tant professor of psychology. The cul-ture consumes people; they get sucked into it.
He explained that this continu-al portrayal of unrealistic body types makes it hard for real people to feel as though they measure up. He ex-plained that while some people may de-cide to change the way they look to live healthier lifestyles, the issue of appear-ance still comes into play.
Am I going to be attractive to oth-er people? Felton asked. Unfortu-nately I think thats at the top of the list for many people. Look at how were raised and socialized in our culture.
So how do we avoid this trap of be-coming obsessed with the physical? We all want to attract potential partners, and an important part of a romantic re-lationship is appreciating a significant others appearance and features.
We all want to be healthy and to look good. In the end, developing a healthy body image is about balance and motivation.
For example, making changes be-cause you choose to, rather than be-cause you feel you should, is key. This, in of itself, should be liberating.
Johnson said that, despite the weight issues of her youth, she is happy with the way she looks now.
Now that Im older, I understand that I want to be a role model, she said. My brother is overweight, and maybe if he sees me living a healthy lifestyle, it will help out.
In a society focused on the aesthetic, how can you arrive at a clear image of yourself?Its time to break the chains of the ideal and learn to love your body.
[ March 2011 ] Crescent Magazine 15
By finding proper motivation a healthier lifestyle and modeling for her brother Johnson was able to become more self-secure. This sort of positive motivation can come from anywhere.
Phelps spoke about how important it is to find those who inspire you. She said Beyonce is an influence because she packs talent and intelligence inside a curvaceous, womanly body.
In addition, taking the time to reflect on how you feel in your body is para-mount in developing a positive self-im-age. It is essential to rise above social and cultural pressures and sort out what your own goals entail.
I think a lot of it can start with fo-cusing on the things your body can do, Zellers said. The gift you have is a strong, healthy body. It does mean treating your body with a little respect.
Developing a more positive body image will help you throughout your life. Zellers believes college is the time we have the luxury of being selfish.
[Take] this opportunity in college to make changes about how you feel, she said. This is a time where you can
be focused on yourself. This is the per-fect time to do some of that self-explo-ration.
And if you do set out to make phys-ical changes, it is important that you really understand what is a healthy weight for your stature and body type. While tools such as the Body Mass In-dex can be useful for telling you target weights for your height, there are a few things you need to consider.
First, according to the National In-stitutes of Health website, in order to be considered a healthy weight, a per-sons BMI must be between 18.5 and 24.9. But for each height, there is a 30- to 35-pound variation within the target BMI. What this means is that not ev-eryone should shoot for a 18.5 BMI, because that might not be a healthy weight for every body as people vary in build and frame.
Another thing to consider is that change takes time. Hard-and-fast plans to alter your appearance are less likely to be successful than those focused on meeting long-term, attainable goals.
It has everything to do with setting
small goals for yourself in the begin-ning, Zellers said. Once you are con-tent with those, then you can start the bigger things.
She explained that the result of smaller goals will be longer-lasting positive changes, which will then boost your confidence. And when you feel good about your body, that satisfaction will radiate to others.
Freshman Julie Clark believes the road to a positive body image begins with finding something you love about your body.
I love the arches of my feet, she said. That nice curve at the bottom of my foot just makes me happy.
Whenever she is feeling self-con-scious, she just thinks of her arches and feels better immediately.
Everyone should be able to love the skin theyre in whether that means a little self-sprucing is necessary or just a reality check and motivational rework-ing. Keep in mind a healthy body im-age is more than a number on a scale.
Do something that makes you feel great about your body, Clark said. w
16 Crescent Magazine [ March 2011 ]
[ TECHNOLOGY ]
Whats on Your Mind?
Y ou are part of the third largest nation on the planet an online nation composed of 600 million Facebook users, according to SocialBakers.com. And if you arent an ac-tive Facebook member, then on at least one occasion youve probably been left out, lost contact with a friend abroad or missed being invited to an event created on Facebook.
The surge of online users over the past few years has helped form a community where friends and family are just a click away. You can view photos of your aunts new dog, you can post an inside joke on your roommates wall even as she sits next to you and you can use your status updates to proclaim ev-ery emotion from the mundane to the intimate.
But with all these outlets of expression, we seem to be asking the question Is there nothing I wont share? Amazingly, there does appear to be limits. In a recent Crescent Magazine online poll, 65 per-cent of respondents said they are selective with the content they post.
But from your political orientation to the tagged party photos from Saturday night, everything is viewable. Facebooks Friendship page enables us to view interactions between two users: photos in which they are both tagged, events theyve attend-ed together and the date their friendship became Facebook official.
And with more than 200 million users current-ly accessing Facebook via cell phones, keeping the world updated on everyones every move has be-come even easier. Going hand-in-hand with mobile updates is the Places application, which pinpoints your exact location using GPS satellites and posts it for everyone to read.
Facebook is like Vegas, said Mari Plikuhn, as-sistant professor of sociology. What happens there
In a sea of status updates, who is reading yours? How Facebook and Twitter have become virtual billboards of personal information.
by Mindy Kurtz & Rachel Solava
stays there; that stuff never goes away.Its important to keep this in mind when you use
Facebook, Twitter and other Internet outlets to ex-press yourself.
The technology made it possible and available to express ourselves and share, Plikhun said. Its naturalized it.
Margaret Stevenson, assistant professor of psy-chology, asserts that weve always had this innate need to share, but now we have new ways to ex-press and channel it through technological outlets, making these personal thoughts, actions and reflec-tions accessible to the entire Internet audience.
You dont need a notebook to journal anymore just choose the note app, sophomore Grace Yeary said.
Its become more and more obvious how much we prefer our online communication to face-to-face interactions, and our obsession with self-disclosure has morphed into a dependency on Facebook and Twitter. What drives us to post confessional statuses or notify our friends that were eating a banana?
Anthony Beavers, professor of philosophy, attri-butes this urge to narcissism and says receiving re-sponses is exciting because this need for a smid-geon of spotlight is affirmed.
Im the center of attention, and I get to control the conversation, he said.
While some post and tweet for self-absorbed reasons, another desire is at work motivating us to spend hours online, increasing the popularity of Facebook.
Its the instant gratification of learning informa-tion about others and sharing our information in re-turn, Plikuhn said.
16 Crescent Magazine [ March 2011 ]
[ March 2011 ] Crescent Magazine 17
Information provided by SocialBakers.com, HuffingtonPost.com, WebMonitoring.com and Facebook.
Top 5 T
witter
users (by number of followers)
1. Ashton Kutcher2. Britney Spears3. Ellen DeGeneres4. Barack Obama5. Lady Gaga
There are more than 00 million Active users
currently accessing Facebook
through their mobile devices.
101
1 p.m
. is the m
ost
active h
our on Twitter.
10
9
11 12
People that use Facebook on their mobile devices are twice as active on Facebook than non-mobile users.
Senior Elise LeBrenton said we want to know what everyone else is doing; its a need to stay in-formed. But its more than just the latest gossip. She checks her Twitter once an hour for updates from CNNs blog.
Im more likely to stay up on news because it pertains more to me, she said. Its news I have a personal connection with.
Stevenson said we all want individualized touch-es, while maintaining a sense of belonging.
We find value in knowing at least one friend will read our latest update, and our idea of communi-ty is affirmed when we can bond over common in-terest pages. For example, you might discover that you and 11 million others are fans of Michael Jack-son, or you could join groups focusing on common-alities such as I like sleeping in on the weekends and I will go out of my way to step on a leaf that looks particularly crunchy. Theres no limit to the ridiculousness of your statement someone out there feels the same.
We also like to let our online circle know when were in pain. From bad days to breakups to the death of a loved one, our Facebook and Twitter posts are saturated with emotion. Tamara Wandel, associate professor of communication, explained that Facebook isnt just a way to express silliness or mundane information, but a way to reach out when we want to share sympathies.
For college students, the issue of bereavement is critical, she said. The aftermath of the April 2007 Virginia Tech massacre left the nation wanting to support those impacted. Facebook became a vir-
registered users.
Twitter now has
The average user clicks the button on nine pieces of content per month.
like
About
70%
of Fac
ebook use
rs live outside of the U.S.
To
p Facebook Likes 1.Texas Hold Em2.Facebook3.Farmville4.Michael Jackson5.Lady Gaga
The average user spends 55 minutes on Facebook every day.
Approximately 55 million status updates are made each day.
Twitter users are, in total, tweeting an average of 55 million tweets a day.
Information provided by SocialBakers.com, HuffingtonPost.com, WebMonitoring.com and Facebook.
24% of Twitter users have zero followers.
50% of active Facebook users log in daily.
18 Crescent Magazine [ March 2011 ]
tual memory wall, which allowed peo-ple to connect in shared sorrow.
Something as minor as a status up-date can show the virtual world glimps-es of a persons real plight.
Its almost sort of shocking what people post deeply per-sonal messages about be-ing depressed or bad breakups, Stevenson said.
Yeary believes some people share too much in-formation, particularly if they are feeling passive-aggressive.
Theyll put a quote about how strong they are if theyre in a fight, she said. I dont see the need. Just say it to my face.
But saying it to some-ones face poses risks that saying it online does not. The anonymity the com-puter screen provides makes us bold-er, gives us feelings of invincibility and self-confidence. It makes it easier to say something uncomfortable to a friend and can give you the courage you were lacking to talk to your crush.
The Internet allows you to be the person you really are, Plikuhn said. You share a lot of things that you wouldnt stand up in a crowd and say.
But with whom are we sharing all this information? We now measure friendships and relationships according to Facebook, something that has drasti-cally altered our social culture.
The definition of a friend is com-pletely different now, and the lines of closeness are blurred. Plikuhn point-ed out the irony that one can have 800 Facebook friends but no one to hang out with on Friday night. For the avid Facebook user, the distinction between Facebook friends and real friends is quite clear.
You have real friends who you eat lunch with, Yeary said. Then the next layer are friends who you can text be-cause youre close enough to have their phone numbers. Facebook friends are sometimes legitimate friends.
But most of us have accepted a friend request from someone we rarely speak to on campus. Has the size of our friend list become a popularity contest?
Sometimes youre friends on Face-book so you can creep on them, Yeary said.
But what causes us to make the tran-sition from adding people we know to adding as many people as we can
and then forgetting about them? Beavers believes its in the deception of the newsfeed.
It shows you what your most active friends are doing, so you forget who all is in your friends list, he said.
Narrowing the scope of friends displayed in your newsfeed creates a false sense of security; maybe youve forgotten that a cer-tain professor, co-worker or boss can see all of your content. This also redefines the word private.
I would not trust anything I put on Facebook to be private anymore, Bea-vers said.
Due to the upgrades Facebook has made, some of the settings you orig-inally set as private may have been changed back to public. As people are becoming increasingly aware of these privacy loopholes and the setbacks to posting truly personal information, the trend of double profiles has emerged.
One profile uses your real name, showing the sterilized version of your-self to prospective employers or oth-er prying eyes. The second one is under an alias where you can share the real you with only the closest of friends.
This takes away from the initial purpose of social networking, Plikuhn said.
But with everyone taking these ex-tra measures and constantly covering their online tracks, is Facebook going to last?
Regardless what the newest and niftiest techy tool is, people around the world are going to demand instant grat-ification when it comes to communica-tion, Wandel said. Right now, [more than] 700 billion minutes a month are spent on Facebook. Like it or not, and as wild as it sounds, that type of on-line communication is only going to in-crease. w
Right now, [more
than] 700 billion
minutes a month are
spent on Facebook.
Like it or not, and
as wild as it sounds,
that type of online
communication
is only going
to increase.TamaraWandel
[ March 2011 ] Crescent Magazine 19
[ ACADEMICS ]
Departments and majors are divided not just by their content, how and what they teach, but also by how UE supports them.
problems
major by Brennan Girdler & Joshua Garrett
This is the first in a two-part series where Crescent Magazine examines academic depart-ments on campus. It seems some areas receive a great deal of support from UE and others, not as much. But why? By investigating what makes a major prominent and why certain ones are what we are calling, alpha majors CM learned from administrators, faculty and students that there are dozens of factors that go into making a depart-ment or major great, which could consequent-ly work against other disciplines.
BIG QUESTIONSWhen you look at a college, program or de-
partment at UE fine arts, for example what comes to mind? Visual communication design, music therapy or theatre?
In December 2010, there were 29 visual com-munication design majors, 37 music therapy ma-jors and 154 theatre majors. So does size make the program? Or is it all the bells and whistles a department has to offer? It is actually a combina-tion of both, complicated by other factors, such as budget and demand.
But when it comes to students majors how fair can it be? There are several departments at UE that appear to be leveraged, turned into sell-
ing points for the university and allocated or giv-en more resources and support. But not every student is a mechanical engineering or physical therapy major. So where does that leave those who dont have an alpha major?
THE PECKING ORDER
There are 22 different departments vying for university assistance, but these resources arent divided in 22 equal shares.
There is a pecking order, said department Chair Mark Shifflet, associate professor of com-munication. Each department does what it can to take advantage of the schools resources.
Everybody wants the money, and one of the bigger factors in determining the budget is the demand of that particular department and which areas UE is looking to beef up to attract poten-tial students. But enrollment across departments isnt static (anything but). Students are interest-ed in different things at different times, which makes allocating resources difficult.
Registrar Amy Brandebury said that interest in many of the niche departments is cyclical.
Archeology is a unique program, and it spikes whenever a new Indiana Jones movie comes out, she said.
[ March 2011 ] Crescent Magazine 19
20 Crescent Magazine [ March 2011 ]
The same effect oc-
curs within the business depart-
ment not many students want to go
into marketing when the economy is tanked. At times like these, in-
stead of specialized fields, like marketing, students in these situations lean more to-wards generalized fields that offer versatile skill sets.
Strong writing is going to be an important thing to have, Shif-flet said. Writing skills are always in high demand.
But majors like communication and psychology teach what Shif-flet calls marketable skills, which of-fer a wide range of career opportu-nities. Though, it would appear that these majors are not getting the sup-port they need for them to become primary majors.
Dianne Oliver, associate professor of religion and chair of the philosophy and religion department, said phi-losophy and religion are not majors that many prospective students know about, perhaps because they may im-mediately seem unmarketable. The 50 students in the department study-ing philosophy and religion are most-ly those who transferred in from oth-er departments.
Susan Kupisch, vice president for Academic Affairs, said UE tries to of-fer programs and majors that will be beneficial to current students, attrac-tive to prospective students and lu-crative to graduating students. Af-ter all, having a good alumni base is the goal of any university.
Like library science, who thinks about [library science] when theyre a freshman? she said. But there are lots of career op-tions for it.
Kupisch said UE leverages marketable areas that are in high demand in the job market. But by building up, or enhancing, these potentially hot majors, this lever-aging creates a teeter-totter ef-fect that forces others down.
Mechanical engineering, exercise sci-ence, psychology these three areas are emphasized to entice potential freshmen with their prestigious faculty, wealth of re-sources and high university accreditation.
Shifflet said these departments have a lot to offer their students, but UEs wallet isnt bottomless, and having a few dominant majors with a higher allowance leaves only so much for the rest.
BELLS AND WHISTLES
That said, more money doesnt mean ev-ery faculty member in the theatre program has a Porsche in his or her garage putting on productions isnt cheap.
UE as a whole runs very lean, said Ray Lutgring, professor of chemistry. Every uni-versity always needs more.
The communication department has long been searching for a new faculty mem-ber who is aware of how social media and technology have changed journalism and are well-versed on the subjects. Brandebury said student demand is high for such a fac-ulty member who can teach these areas, but finding and hiring one that fits this de-scription can affect the entire departments curriculum in the long term.
At a school this size, the strength of your curriculum is directly related to the strengths and weaknesses of your individual faculty, Shifflet said.
Having strong faculty in a department is important to students in that area. But art only has three full-time professors, one of whom focuses solely on the visual commu-nication design curriculum. That leaves two professors to handle several general educa-tion courses and major specific ones.
Lots of departments run into similar problems when it comes to general educa-tion courses double dipping into their re-sources. But some departments have very little interaction with others.
Junior Nick Seibert, a music manage-ment major, said he felt the music depart-ment is a selling point for UE, but isnt treat-ed like one.
We play at big events like inauguration, basketball games and graduation, he said. Campus uses us a lot, but most of our funding comes from other endowments.
The music department, for example, has to outsource to Friends of UE Music, a supporting network of parents and alum-ni. Seibert said the music department has
lost four or five professors over the past few years, who have yet to be replaced. The de-partment also has a number of specialized adjuncts, but they are not the ones on the fliers that Admission sends to prospective students.
Strong professors and private instruc-tors are recruitment tools for music, he said.
Shifflet said communication has about 90 majors with only four full-time faculty. Like art, these four professors teach a slew of public speaking courses, communication- specific courses and other general educa-tion courses.
Philosophy and religion, on the other hand, has six full-time professors and 50 students.
We do serve [lots of] other students, Oliver said. We offer lots of gen eds.
Departments like music, philosophy and religion and communication are important to UE because of what they offer, but it ap-pears they arent getting the monetary sup-port needed to become a part of UEs main
selling points. A lot of these non-alpha ma-jors are in departments most liberal arts colleges offer. Lutgring emphasized that one of the main reasons students come to UE for engineering is because of the liberal arts background, but not all majors can take ad-vantage of that aspect.
These majors are rarely in the spotlight in the way that business, physical therapy or theatre often are, which causes some stu-dents to wonder how much their majors are actually worth to UE.
NOTE: The April issue of Crescent Maga-zine will feature more on this topic and will explore how students, faculty and admin-strators feel about the unbalanced nature of majors, and how and why some bells and whistles are more polished than others. w
20 Crescent Magazine [ March 2011 ]
Each department
does what it can to
take advantage of the
schools resources.
Mark Shifflet
[ March 2011 ] Crescent Magazine 21
of UE students say that alcohol
is not very important to their campus social lives.
96 %
Fall 2009 UE Social Norms Survey Sponsored by UE Health Education
Spring 2012 Application Deadline:
March 4th, 2011
Study Abroad Office SOBA 261 8124881085
Contact us for updates on UE Summer Programs Abroad
22 Crescent Magazine [ March 2011 ]
1924 E. Morgan Ave. Evansville, IN 47711 4254422FREEDelivery to UEs Campus!
Weve hoisted our sails & were headed your way!
In hopes your cough wont blow us away,
Weinbach Shopping Center corner of Weinbach and the Lloyd
Hungry? For home cooked food?
10%discountwith student ID
R E A S U ERT &
D I OT R A T I N S
University of Evansville Alumni Association www.evansville.edu/alumni
Answers: 1. C Scholarships come from people -- people who love UE and are interested in the success of our students!
2. B Yes, it takes over $127 per minute to run the University. Just one reason why its so important for people to GIVE to UE!
3. F Among other things, the Annual Fund pays for many operating expenses on campus; imagine if these things were not paid
for! Another reason for giving to UE!
When YOU are an ALUM, your support of UE will be appreciated.
Have you thanked a
donor?1. Where do scholarships come from? a. A money tree b. Government funds c. Alumni, friends and parents of UE
How Much Do YOU Know About UE?
2. How much money does it take to run UE for one minute? a. $11.49 b. $127.58 c. $57.33
Snyder Lecture Series: Max Weinberg March 30International Speaker Series: Carlos Gutierrez April 7UE African-American Alumni Annual Meeting April 9Harlaxton 40th Anniversary Reunion April 1516
Upcoming Events to Remember
3. What does the Annual Fund pay for on campus? a. Electricity b. Cable TV c. Wireless Internet d. Financial Aid e. Paper Towels f. All of the Above
607 N. Main St. (six blocks north of the Lloyd Expwy.)
For Reservations or Carry Out (812) 4283004
Daily Lunch & Soup Specials
Open: Mon.Fri. 11 a.m. Sat. 4 p.m.
Celebrating 25 years
Its delightful...
Its delicious...
Its...
A friendly welcome fromDan (UE 74) &
Jovanni (UE 07) DiLegge
Celebrating 25 Years
Pasta, Beef, Chicken, Seafood
[ March 2011 ] Crescent Magazine 23
sweetTOOTHby Abby Sperry
[ FOOD ]
When the urge for something dessert-like hits, it wont go away. Here are some places that satisfy that sweet tooth.
ThePiePanisafamilyrestaurantthatoffers21dif-ferenttypesofpie,alongwithbreakfast,lunchanddinneren-trees.Nothingcostsmorethan$10.En-joyfresh-bakedpiewithwhippedcream,icecreamorched-darcheese.905 North Park Drive 8124252261
TheDonutBankisalocalbakerywithdelicioustreats,suchasdonuts,cookiesandmuffins.Theirflavoredcoffees,in-cludingPeanutBut-terCupMochaandtheSnickersLatte,canbepurchasedhotoriced.1200 Lincoln and 1950 Washington Ave. 8124024111
LicsDeliandIceCreamoffershome-madeicecream,aswellascakes,cookiesandsand-wichesservedonfreshlybakedbread.Customersarewel-cometodineinorpurchaseaquarttotakehome.4501 Lincoln and 2001 Washington Ave. 8124773131
Rightaroundthecorner,JeannesGelatoservesavarietyofflavorsofgelatoandsorbetto,aswellascakes,paninis,soupsandcoffee.Jeannesmakesfreshgelatoeverydayandwillevenmixyourfavoriteflavors.2003 Lincoln Ave. 8124798272
Offeringavarietyofcandiesformorethan50years,MikeLibsistheplacetobeforthechocolateconnoisseur.Avail-ableforpurchasebythepound,theirfudge,candybarsandpecanflipoversmaketheperfectsnackorgift.864 S. Green River Rd. 8124248750
GRAB A SLICE
SWEETS ARE astapleineveryculturetheverywordorigi-natingfromtheArabicqandi,meaningsome-thingmadewithsugar.Sweetshaveevolvedfromfruitsandnutsrolledinsugartothewidevarietynowfoundinconve-niencestoresandconfection-ariesalike.
You really dont have to be member of the Greek community to enjoy this satisfying pizza.
GREEKS PIZZERIA 240 S. Green River Road 8124024733
MOLTENCHOCOLATE:Whetheritsforaspecialcelebrationorapick-me-upafterabadday,chocolatecakeissimplyastaplewhenitcomestosweets.
With its soothing atmosphere and friendly service, Greeks Pizzeria offers good times for all. There, each order is made fresh, and each pizza is rolled with hand-tossed dough and topped with a unique sauce that is nei-ther too spicy nor sweet.
Greeks crust is both light and crunchy, so that it does not detract from the flavorful sauce and the melty cheese. The restaurant offers a variety of toppings from the classic pepperoni to anchovies with feta cheese for the more exotic palate so that everyone can create a pizza they love. There is also very little grease on their pizza, so that you can taste and enjoy what toppings you have chosen.
Greeks provides three different size options. Pur-chase a small, measuring nine inches, or a medium piz-za at 12 inches. Splurge on an extra-large pie at a whop-ping 16 inches. For around $6, you can purchase a small cheese pizza, or add your favorite toppings for 96 cents each. The mouth-watering slices are good enough to share if youre willing and the extra-large can feed up to five people.
In addition to pizza, the restaurant serves a variety of salads, sandwiches, calzones, soups, pasta and appetizers the most popular of which being their garlicky cheese bread. And with their daily specials, Greeks prices ap-peal to the penny-pincher in all of us. Whether its out with friends or dinner on the go, Greeks is the place for some delicious food at a reasonable price. w
24 Crescent Magazine [ March 2011 ]
health&scienceRemember your Vision This Month
Everyone is aware that people who sit in front of a computer for long periods of time often encounter a variety of uncomfortable body aches. The American Op-
tometric Association reports that headaches, neck strain, backaches and wrist pain are common ailments, but the most prevalent symptoms of prolonged computer use eyestrain, blurred vision and dry eye are often over-looked. In fact, eye and vision problems are the most fre-quently reported health problems among computer users. Sitting at a computer generally causes a person to look straight ahead for long stretches of time, and working in
a dry environment causes you to blink less often. These factors can lead to vision problems. Additionally, computer use requires specific vision skills, which add further demands to the visual system and contribute to eye and vision discomfort.
While decreasing time spent at a computer may not be an option, there are ways to maximize healthy vision for comfortable use of the computer. The AOA recom-mends that you have a regular comprehensive eye exam and wear glasses that are specifically designed to function comfortably at the computer. Rest the eyes, blink forcefully, use a humidifier or instill artificial tears.
Breast Implants May Cause CancerWomen with breast implants may have something other than plunging necklines to wor-
ry about, says CBS News. According to federal health officials, there may be a link between implants and an extremely rare form of cancer called anaplastic large cell lymphoma. The lymphoma is an aggressive form of cancer, and patients survival varies widely between dif-ferent varieties of the disease. Thats the bad news. The good news is the chance of having this form of cancer is very slight, implants or not.
Physical Activity Linked to PoliticsHow is going for a jog like voting for president? According to ScienceDaily.com, physical
activity and political activity are two sides of the same coin, at least as far as our brains are concerned. Scientists found that people who live in more active states are also more like-ly to vote. And in an experiment, volunteers who were exposed to active words such as go and move said they were more likely to vote than did people who saw words like relax and stop.
Trans Fats Make You Depressed According to TIME Magazine, a study in Spain suggests that consuming trans fats can
increase the risk of ones developing depression. The study tracked the lives of more than 12,000 college graduates who had not been diagnosed with depression in the past six years. Every two years, participants had to fill out a survey. By the end of the study, 657 students reported suffering from depression. It has also been found that increased con-sumption of trans fats increases ones risk for heart disease. Patients with heart disease also report an increased incidence of depression. While a carton of chocolate ice cream may relieve sadness now, it may only increase our risk of developing depression later.
Hand Gestures Improve Problem SolvingMany of us find that using our hands when we talk is natural. According to ScienceDaily.
com, a recent study published by the American Psychological Association suggests that talk-ing with our hands also helps us to solve complex problems. Subjects presented with prob-lems actually used more hand gestures as those problems grew more complex, and sub-
jects who were encouraged to use hand gestures outperformed those who were forbidden to do so. According to the study, hand gestures actually increase our spatial visualization and problem solving skills. Just as gestures help to ex-plain an idea or emphasize a story, they can be employed to help explain a prob-lem in engineering or mathematics.
Alternative Energy SourcesIf someone told you there was a way
you could save 2.53 million lives a year and simultaneously halt global warming, reduce both air and water pollution and develop secure, reliable energy sourc-es nearly all with existing technolo-gy and at costs comparable to what we spend on energy today why wouldnt you do it?
According to a new study coauthored by Stanford researcher Mark Z. Jacob-son, we could accomplish all that by converting the world to clean, renewable energy sources and forgoing fossil fuels, reports ScienceDaily.com.
Based on our findings, there are no technological or economic barriers to converting the entire world to clean, re-newable energy sources, said Jacob-son, a professor of civil and environ-mental engineering. It is a question of whether we have the societal and politi-cal will.
BIZARRITIESGoogle Maps has charted just about
every traffic artery you could ever want to locate, but what if the thruway youre looking for isnt on any road atlas?
According to Popsci.com, in order to help you tell your auxiliary artery from your common carotid, Google has created a searchable guide for the human body that lets you zoom, scroll and search for every muscle, gland, nerve, bone or organ in our common physiology.
As far as handy online apps go, Body Browser is pretty neat; a sliding scroll bar allows you to peel away layers of the body, starting at the skin and moving down through the muscles, bone and or-gans to the cardiovascular and nervous systems. It allows you to zoom in tight, and with nice resolution, to get the name of a specific part. w
[ March 2011 ] Crescent Magazine 25
LIMELIGHT, LIMEWIRE Once upon a time,
movie rent-
als at least
forced
people to
drive their
lethar-
gic selves
to the
Block-
buster.
The Internet and other conveniences have brightened our lives with an influx of new information. But this information has dammed up the flow of the live arts.
w Jon Harvey, a senior theater management major from Chesapeake, Va., weighs in on the issues affecting students today.
wThe Internet is here to stay. We are saturated in it; we can access it everywhere. The tidal wave of infor-
mation provided by the Internet brings everything instantly to our fingertips and has inspired in us a need for immediacy a need that has become the silent killer of the arts.
Online, anyone can purchase, and even steal, songs on an indi-vidual basis. You no longer have to buy an entire album to hear that one favorite. As a result, sales of albums hard copy and dig-ital have dropped 14 percent, according to Billboard.com. In contrast, sales of the digital sin-gle have jumped 27 percent. If we as a generation refuse to pur-chase a Ke$ha album for more than $10, live music doesnt stand a chance.
Thanks to the Internet, it is now much easier to access vid-eo content as well. Once upon a time, movie rentals at least forced people to drive their lethargic selves to the Blockbuster. Now, you dont even have to leave your living room to get a movie. Net-flix doesnt just deliver to your mailbox; it streams straight to your computer as well.
And as the Internet offers nu-merous sources for free mov-ie and music downloads, a grow-ing number of people are shocked to hear their friends still pay for their entertainment at all. This at-titude hurts more than the sales of DVDs and albums. Live enter-tainment suffers as well.
These days, those who per-form in professional orchestras and choirs do so for a shrink-
ing audience. Too often, we would rather search videos on-line than leave the comfort of our homes, travel to the opera house, arrive on time and hear only a few songs we know. Millions of peo-ple watch live concerts on You-Tube, but only a handful follow and actively support the live arts in their communities.
Those who avoid trips to the theater often claim they do so be-cause they cannot afford the tick-ets. But in just the Tri-State area, there are a dozen places where you can see a show for no more than the cost of a movie. In most cities, ticket prices never increase by more than 1 percent, accord-ing to Danny Newman, writer of Subscribe Now!
Decreasing interest in the arts is also likely a result of todays obsession with reality TV. When we watch reality shows we are re-minded that it does not take talent to become rich and famous. Those who go so far as to audition for spots on these shows stand a chance of winning thousands of dollars, if not a million.
Shows like The Real World offer no prize other than fame, but fame is enough to fasci-nate us. Thus it seems the lazy those who favor convenience over value have divided them-selves into two sets: those who want fame and those who want to watch the famous.
And if entertainment has been reduced to watching the famous or taking part for the sake of per-sonal gain, should those com-mitted to creating real art just quit? While on
TV, contestants compete for matches and strangers squab-ble in a house, true perform-ers leave their blood, sweat and tears on the stage. So why should patrons abandon the ease of their computers and TV sets? If a performers pas-sion is not enough to make us leave the comfort of our homes, the economic benefit must be.
Every dollar spent on a per-forming arts ticket in a commu-nity generates $5 to $7 addition-al dollars for the local economy, said Ben Cameron, an arts admin-istrator in New York City. Baby-sitters, restaurants, gas stations, fabric stores and lumber and steel yards all thrive on the business generated by live entertainment. Every night a show plays is a mini-stimulus for the community.
As citizens, we must pro-mote the arts. Its important that we speak out when government officials put them in danger, as Gov. Mitch Daniels did when he slashed $300 million from the In-diana arts budget.
Im not saying you should do away with your Netflix subscrip-tion and throw your computer out the window; but if a musi-cian is giving a concert or a play is running, you should go. Youre supporting not only the performers who have worked so hard to put it together but also the local economy. Keep in mind that what is most convenient is not always best. w
[ READ WITH PASSION ]
26 Crescent Magazine [ March 2011 ]
[ FASCINATING PEOPLE ]
Atlas Allens father first handed him a set of free weights when he was in the fifth grade. At
the time, the Chicago native admits, he had no idea why. In high school, his peers used to
kid that he would be a famous wrestler one day, but Allen knew that wasnt really his des-
tiny. Instead of following the path predicted by those friends, he went to ITT and graduated
with his associates degree in electronic engineering.
the
For many years, Allen worked in his chosen profession, but his impos-ing size found him working nights as a bouncer at various nightclubs and bars. And through it all, Allen retained his passion for physical excellence. In his early 20s, he and a few of his buddies participated in an amateur weightlifting portion of the Arnold Classic.
Though he never thought he would win, he beat the competition and wears his prize necklace a small replica of his medal every day as a reminder.
But electronic engineering and free-lance weightlifting werent making him happy, so at 36, he decided to return to school.
Recommended