Click here to load reader

RUOLI BIOLOGICI DELLE PROTEINE - [email protected] · PDF filePROTEINE DI DIFESA – Ig ed MHC ANTICORPI (Immunoglobuline) B-CELLS, T-CELLS (LINFOCITI con recettori MHC) ... delle cellule

  • View
    212

  • Download
    0

Embed Size (px)

Text of RUOLI BIOLOGICI DELLE PROTEINE - [email protected] · PDF filePROTEINE DI DIFESA – Ig ed MHC...

RUOLI BIOLOGICI DELLE PROTEINE

PROTEINE DI DIFESA Ig ed MHC

ANTICORPI

(Immunoglobuline)

B-CELLS, T-CELLS

(LINFOCITI con recettori MHC)

PEPTIDI ANTIMICROBICI

PROTEINE DEL COMPLEMENTO

NATURAL KILLER (CELLULE NK)

SISTEMA IMMUNITARIO

MONOCITI (MACROFAGI)

(NEUTROFILI, EOSINOFILI & BASOFILI) GRANULOCITI

IMMUNITA ACQUISITA O ADATTATIVA

IMMUNITA INNATA

RISPOSTA UMORALE

RISPOSTA MEDIATA DA CELLULE

Proteine prodotte dalle plasmacellule (LINFOCITI B attivati)

Produzione stimolata da molecole estranee allorganismo (NON-SELF) che possono

essere polipeptidi/proteine, polisaccaridi, acidi nucleici o altre molecole (ANTIGENE)

Le Ig riconoscono parti di queste molecole noti come DETERMINANTI ANTIGENICI

Ogni cellula B produce un solo tipo di Ig con una particolare specificit per un dato

determinante antigenico il repertorio di diversi Ig disponibili nelluomo > 1011.

Questa specificit deriva da una parte della sequenza primaria della molecola Ig (sito

recettoriale).

Gli anticorpi (Ig) si formano per SELEZIONE (dei prodotti di singoli geni) piuttosto che

per ISTRUZIONE (adattamento di Ig allantigene). Ma abbiamo un numero limitato di

geni (

Il clone di cellule B attivate produce e rilascia Ig solubili in quantit, che possono

riconoscere e legare lo stesso determinante antigenico riconosciuto dalla Ig

recettoriale, nei microbi o tessuti non-self che lo esprimono.

Le plasma cellule producono inizialmente un tipo di immunoglobulina noto come

IgM, poi avviene la commutazione di classe, e sono espresse IgG, IgA, IgD o IgE,

con specificit per lo stesso determinante antigenico ma diversi ruoli nellimmunit.

Dopo leliminazione dellinfezione, le plasmacellule muoiono, ma un certo numero di

cellule B corrispondente a quel clone persiste in circolazione (MEMORIA). Questo

fornisce una risposta pi rapida in futuro verso lo stesso agente infettante)

I LINFOCITI T sono attivati in maniera analoga ai linfociti B, ma forniscono una

RISPOSTA CELLULARE

Linfociti B Ig : risposta umorale efficace contro batteri, tossine batteriche e

virus in circolo

Linfociti T : efficaci contro cellule infette

Caratteristiche comuni dei linfociti B e T : SELETTIVITA e MEMORIA

Immunoglobuline e linfociti

IMMUNOGLOBULINE -

H HEAVY CHAIN = CATENA PESANTE

L LIGHT CHAIN = CATENA LEGGERA

C dominio CONSERVATO

V dominio VARIABILE

Strutture 1a e 4a

s s ponti disolfuro

L L

H H

C-term C-term

N

N

N

N-term

C C

V H V H

V L V L

C L C L

s

s

s

s

s

s

s

s

s

s

s s

s s

s s

s s

s s

s

s s

s

s s

s s s s

C 2 H

C 3 H

C 1 H C 1 H

C 2 H

C 3 H

A

L

H N

N

C

V H

V L

C L

C 1 H CDR

CDR

C

CDR = COMPLEMENTARITY DETERMINING REGION

(Regione ipervariabile)

A = ANTIGENE

s s

Papaina

Porzione

Fab

Porzione

Fc

oligosaccaride

Strutture 2a e 3 (esempio di domini strutturali)

Dominio conservato

1 2 5 7 4 6

3

3b 3c

CDR1 CDR3

CDR2

1

2 6 5 3 4 7

Dominio variabile

La diversit nel repertorio di Ig (> 1010 diverse molecole) dovuta a:

i) ricombinazione somatica di diversi frammenti genici che codificano per VCL e VCH

con numerose varianti per ciascun frammento genico ( 3x106 combinazioni)

ii) alternative splicing nelle catene VCL e VCH ( >108)

iii) diverse combinazioni di VCL con le VCH

iv) ipermutazione somatica delle regioni V (affinit per antigene aumenta di 1000 volte)

L = leader seq.; V = variable (~100 res.); D = diversity; J = joining (~13 res.) ; C = constant; MC = membrane coding; SC = Secretion coding

VL CL

VH CH1 CH

2 CH3

(k o l)

Il numero di segmenti pertinente ad un individuo, e varia in diversi individui (polimorfismo genetico)

1 1

Struttura molecolare

Fab

Fab legame

antigene

Fab Fc

funzioni

effettrici

oligosaccaride

Sito di legame per lantigene

Sito di legame per lantigene

I diversi tipi di immunoglubuline che differiscono nella composizione delle CH

(5 diversi isotipi, G,M,A,D e E e 4 subclassi per le IgG)

Gli isotipi variano per tipo di CH e numero di catene, ponti disolfuro e glicosidazione

I linfociti B esprimono inizialmente le IgM e successivamente, per un processo noto come

isotype switching (commutazione di classe) esprimono uno degli altri isotipi

La composizione dei domini CH conferisce specializzazione funzionale alle Ig

Diversi tipi di Ig

g

IgG (monomeriche)

Siero

~ 80%

m

IgM (pentameriche)

precoci

~ 10%

IgA (mono/di/

trimeriche)

secrezioni

esterne

~ 10%

(lacrime, saliva,

mucose)

a

e

IgE (monomeriche)

antiparassitarie

< 0.02%

(reaz. allergiche)

= oligosaccaride

d

IgD (monomeriche)

(?) recettore

< 0.2%

poich le molecole di IgG hanno 2 siti

di legame per lantigene, possono

formare legami crociati unendo

assieme antigeni polivalenti

Gli Ig formano legami multipli con antigeni polivalenti

attivazione linfocita B

I recettori sui linfociti B sono molecole tipo IgM modificate

con un dominio di ancoraggio per la membrana. Un

antigene polivalente causa loligomerizzazione di recettori

sulla superficie che innesca il segnale di attivazione

produzione IgM

Isotype swithcing

MHC (complesso maggiore distocompatibilit)

Le MHC di classe I presentano frammenti di proteine citoplasmatiche sulla superficie

delle cellule (meccanismo taglia ed esponi), incluso frammenti di eventuali patogeni

intracellulari

CELLULA T

KILLER

(recettore

cellula T) TCR

CD8

1) perforine

2) granzimi

3) apoptosi

Struttura Delle MHC

Le MHC sono formate da quattro domini extracellulari, uno

transmembrana ed uno intracellulare

Il sito di legame per lantigene una piattaforma recintata, formata

da un -foglietto e 2 a-eliche

Peptidi di 8-10 residui si legano in forma estesa, ancorati da due

residui alle estremit (possono presentare milioni di frammenti

diversi)

MHC-I e la presentazione dellantigene in cellule infette

MHC-I e linfociti-T killer

MHC di classe II e le cellule presentanti lantigene (antigen presenting, APC)

Le MHC di classe 2 presentano

antigene sulla superficie di cellule

fagocitanti (APC)

CELLULA T

HELPER

CD4

citochine

altri linfociti

13-18 residui

endocitosi

fagocitosi

Una particella estranea fagocitata da macrofagi e cellule dendritiche

Una proteina estranea legata al recettore sulla superficie di linfociti-B

Cellule presentanti lantigene (APC)

Linfociti B fagociti: macrofagi / cellule dendritiche

MHC-II e linfociti-T helper

KNGDSGGPGTNEDK

SNEDGKKKSGNPGNVD

determinanti

antigenici

epitopo

continuo

epitopo

discontinuo

Anticorpi come strumenti di ricerca

idrofobico polare

Indovina il determinante antigenico

MVRGITVLAAVALMVGANNIPKLVPDDHYVNRVVGGQEAEE

GSAPYQVSLQVALWGHNQGGSILSERWVLTAAHCLVGTDAE

ELEVLVGTNSLKEGGQRYKADKLLYHSRYNSPQFHNDIGLV

RLATPIKFSSTVKSIEYSENVVPVNATVRLTGWGRTSAGGS

VPTKLQTIDLRTLSNEDGKKKSGNPGNVDIGHVVTLTRTGE

GAKNGDSGGPGTNEDKVIGVVNFGVPCALGYPDGFARVSYY

HDWIRTTIRNN

MVRGITVLAAVALMVGANNIPKLVPDDHYVNRVVGGQEAEE GSAPYQVSLQVALWGHNQGGSILSERWVLTAAHCLVGTDAE ELEVLVGTNSLKEGGQRYKADKLLYHSRYNSPQFHNDIGLV RLATPIKFSSTVKSIEYSENVVPVNATVRLTGWGRTSAGGS VPTKLQTIDLRTLSNEDGKKKSGNPGNVDIGHVVTLTRTGE GAKNGDSGGPGTNEDKVIGVVNFGVPCALGYPDGFARVSYY HDWIRTTIRNN

Produzione di anticorpi

Antigen prediction

SPPS

Link to carrier (e.g. albumin) (inject with

adjuvant)

Affinity Cromatography

With Immobilized

antigen

immunoassay

with antigen

Produzione di anticorpi monoclonali

MEDIUM

Elettro blot

Utilizzo di anticorpi come strumenti per la ricerca - WESTERN BLOT

elettrodo

elettrodo

blot a capillarit

anticorpo specifico

di coniglio

anticorpo anti Fc

di coniglio legato a

un enzima

substrato prodotto colorato

Search related