Makalah Pro RUU

Embed Size (px)

DESCRIPTION

RUU Keperawatan Legal Ethic Nursing

Citation preview

BAB ILATAR BELAKANG

Kesehatan sebagai hak asasi manusia harus diwujudkan dalam bentuk pemberian berbagai upaya kesehatan kepada seluruh masyarakat melalui penyelenggaraan pembangunan kesehatan yang berkualitas dan terjangkau oleh masyarakat.Tenaga keperawatan sebagai salah satu komponen utama pemberi layanan kesehatan kepada masyarakat memiliki peran penting karena terkait langsung dengan mutu pelayanan kesehatan sesuai dengan kompetensi dan pendidikan yang dimilikinya.Tenaga keperawatan juga memiliki karakteristik yang khas dengan adanya pembenaran hukum yaitu diperkenannya melakukan intervensi keperawatan terhadap tubuh manusia dan lingkungannya dimana apabila hal itu dilakukan oleh tenaga lain dapat digolongkan sebagai tindakan pidana.Keperawatan sebagai profesi mempersyaratkan pelayanan keperawatan diberikan secara professional oleh perawat/ners dengan kompetensi yang memenuhi standar dan memperhatikan kaidah etik dan moral, sehingga masyarakat terlindungi karena menerima pelayanan dan asuhan keperawatan yang bermutu. Keperawatan sebagai profesi juga memiliki body of knowledge yang jelas berbeda dengan profesi lain, altruistik, memiliki wadah profesi, memiliki standard dan etika profesi, akontabilitas, otonomi, dan kesejawatan (Leddy & Pepper, 1993). Perawat juga diharuskan akuntabel terhadap praktik keperawatan yang berarti dapat memberikan pembenaran terhadap keputusan dan tindakan yang dilakukan dengan konsekuensi dapat digugat secara hokum apabila tidak melakukan praktik keperawatan sesuai dengan standar profesi, kaidah etik dan moral.Proses Keperawatan adalah suatu entitas ilmiah dan humanistic melandasi suatu standard asuhan dan dilaksanakan berdasarkan keyakinan terhadap paradigma keperawatan. Sistematika proses keperawatan menjadi pola pikir dan tindakan perawat yang terdiri dari pengkajian (assesment), perencanaan (termasuk kriteria keberhasilan), implementasi dan evaluasi. Proses keperawatan ini telah hampir diterapkan diseluruh pelayanan kesehatan di Indonesia dengan penyesuaian dengan kondisi setempat.Melemahnya kepercayaan masyarakat dan maraknya tuntutan hukum terhadap praktik tenaga kesehatan termasuk keperawatan, seringkali di identikkan dengan kegagalan upaya kesehatan padahal perawat hanya melakukan daya upaya sesuai displin ilmu keperawatan. Untuk menjamin perlindungan terhadap masyarakat penerima pelayanan dan asuhan keperawatan serta perawat sebagai pemberi pelayanan dan asuhan keperawatan, maka diperlukan ketetapan hukum yang mengatur praktik keperawatan. Hanya perawat yang memenuhi persyaratan saja yang akan mendapatkan lisensi/ijin melakukan Pratik keperawatan. Untuk itu diperlukan Undang Undang Praktik Keperawatan yang mengatur keberfungsian Badan Regulatori atau Konsil Keperawatan untuk melindungi masyarakat.Dengan adanya undang-undang praktik keperawatan merupakan jaminan terhadap mutu dan standard praktik disamping sebagai perlindungan hukum bagi pemberi dan penerima jasa pelayanan keperawatan.

Secara garis besar hal-hal substansial yang dimuat dan ditampung dalam Rancangan Undang-Undang Praktik Keperawatan ini antara lain menyangkut:1.Pengaturan kompetensi seorang tenaga keperawatan dalam memberikan pelayanan kesehatan.2.Pengaturan ijin praktik kaitannya dengan sertifikasi, registrasi dan lisensi.3.Akreditasi tempat praktik dan orang-orang yang bertangung jawab terhadap praktik.4.Pengaturan tentang keterkaitan antara praktik dengan penelitian.5.Pengaturan penetapan kebijakan yang sekarang ini ada pada departemen kesehatan.6.Ketatalaksanaan hubungan antara pasien dengan perawat.7.Penerapan ilmu kaitannya dengan penapisan ilmu pengetahuan dan tehnologi.8.Pemberian sanksi disiplin.

BAB IITUJUAN PUSTAKA.Perawat telah berperan penting dalam menopang sistem pelayanan kesehatan. Sebab, sebagaimana diketahui bahwa baik di rumah sakit pemerintah maupun swasta, baik di perkotaan maupun di pelosok desa terpencil sekalipun, peranan perawat senantiasa memberi andil yang signifikan dalam menunjang pelayanan kesehatan masyarakat. Oleh karenanya harus diakui bahwa memang sangat diperlukan suatu landasan hukum dalam bentuk undang-undang yang mengatur profesi atau praktik keperawatan. Dengan adanya undang-undang ini, diharapkan dapat mengatur paling tidak dua hal pokok, yaitu :a. perlindungan hukum atas bekerja/berpraktiknya profesi keperawatan; danb. mendorong profesionalitas perawat.Sehubungan dengan itu, dalam penyusunan Program Legislasi Nasional Prioritas Tahun 2009, DPR dan Pemerintah telah sepakat bahwa RUU yang mengatur mengenai praktik keperawatan merupakan salah satu RUU yang menjadi prioritas tahun 2009. Hal ini telah dituangkan dalam Keputusan DPR RI Nomor 02A/DPR RI/II/2009 tentang Program Legislasi Nasional Rancangan Undang-Undang Prioritas Tahun 2009, dimana dari 35 RUU yang ditetapkan sebagai perioritas terdapat RUU tentang PraktikKeperawatan (sebagaimana terdapat dalam nomor urut 26).Kemudian dalam rapat paripurna berikutnya, Pimpinan DPR memberitahukan kepada Anggota tentang masuknya usul inisiatif RUU tersebut dan dibagikan kepada seluruh Anggota (Pasal 130 ayat (4) Peraturan Tata Tertib DPR). Dalam rapat paripurna ini masing-masing fraksi menyampaikan pendapatnya kemudian diambil keputusan apakah usulinisiatif tersebut dapat diterima menjadi RUU usul DPR atau tidak dapat diterima (Pasal 130 ayat (5) dan ayat (6) Peraturan Tata Tertib DPR).Mengenai pengajuan sebuah Rancangan Undang-Undang (RUU) dari DPR, diatur dalam Pasal 130 Peraturan Tata Tertib DPR RI. Adapun mekanismenya adalah sebagai berikut:a. Rancangan Undang-Undang dari DPR dapat diajukan oleh Komisi,Gabungan Komisi, atau Badan Legislasi (Pasal 130 ayat (2) PeraturanTata Tertib DPR).b. Usul inisiatif RUU tersebut beserta penjelasan dan naskah akademik-nyadisampaikan secara tertulis kepada Pimpinan DPR (Pasal 130 ayat (3)Peraturan Tata Tertib DPR).Kebijakan tentang UU keperawatan masih dalam tahap formulasi. Belum disahkannya RUU keperawatan oleh DPR menjadi UU menjadi satu fenomena yang menarik untuk dianalisis. Penulis menilai bahwa pihak-pihak terkait belum mempunyai pemahaman yang sama tentang pentingnya UU keperawatan di Indonesia.UUNo. 36 tahun 2009 tentang kesehatan pasal 63 ayat (4) secara eksplisit menyebutkan bahwa; pelaksanaan pengobatan dan atauperawatanberdasarkan ilmu kedokteran dan atauilmu keperawatan, hanya dapat dilaksanakan oleh tenaga kesehatan yang mempunyai keahlian dankewenanganuntuk itu. Pada pasal 27 ayat (1) juga menyebutkan bahwa; tenaga kesehatan berhak mendapatkan imbalan danperlindungan hukumdalam melaksanakan tugas sesuai dengan profesinya. Sementara itu, PP No.32 tahun 1996 tentang tenaga kesehatan menempatkan tenaga keperawatan dalam kategori tersendiri, maka mempunyai UU keperawatan sendiri berarti menjalankan amanah UU.Perawat bukan tenaga medis, sementara peraturan yang ada bernuansa medis sehingga peraturan untuk keperawatan tidak dapat dititipkan. Misalnya, dalam UU Praktik Kedokteran tidak ada aturan untuk tugas pelimpahan, padahal kenyataannya banyak tugas dokter yang dilimpahkan kepada perawat seperti melakukan tindakan invasif pemasangan infus.Selain itu, kecenderungan tuntutan klien semakin meningkat terhadap pelayanan kesehatan termasuk pelayanan keperawatan. Dalam beberapa kasus, tidak sedikit akhirnya perawat yang harus berurusan dengan hukum. Sejak tahun 2005 tercatat 33 kasus penangkapan perawat di 7 provinsi. Misalnya kontroversi kewajiban perawat menolong tindakan gawat darurat yang dapat dipidana karena tidak boleh menyimpan obat, seperti yang terjadi pada kasus Misran. Beberapa penyebab kejadian tersebut adalah belum adanya undang-undang keperawatan.Hasil analisis menunjukkan kebijakan yang ada dirasa belum cukup untuk menjadi payung hukum bagi perawat dalam memberikan pelayanan. Kebijakan yang mengatur keperawatan baru setingkat Peraturan Menteri dengan dikeluarkannya Permenkes No.148 tahun 2010 tentang izin dan penyelenggaraan praktik keperawatan dan Permenkes No.1796 tahun 2011 tentang registrasi tenaga kesehatan. Konten dari peraturan tersebut masih bersifat parsial dalam mengatur perawat.

BAB IIIPEMBAHASAN TOPIK DEBAT

3.1 Pokok-Pokok Materi Muatan Dalam Pengaturan Praktik Keperawatan1.Pengertian UmumPengertian yang terdapat didalam RUU ini antara lain:a.Keperawatan adalah suatu bentuk pelayanan profesional yang merupakan bagian integral dari pelayanan kesehatan, didasarkan pada ilmu dan kiatkeperawatan ditujukan kepada individu, keluarga, kelompok, dan masyarakat baik sehat maupun sakit yang mencakup seluruh proses kehidupan manusia.b.Praktik keperawatan adalah tindakan perawat melalui kolaborasi dengan klien dan atau tenaga kesehatan lain dalam memberikan asuhan keperawatan pada berbagai tatanan pelayanan kesehatan yang dilandasi dengan substansi keilmuan khusus, pengambilan keputusan dan keterampilan perawat berdasarkan aplikasi prinsip-prinsip ilmu biologis, psikolologi, sosial, kultural dan spiritual.c.Asuhan keperawatan adalah proses atau rangkaian kegiatan pada praktik keperawatan yang diberikan kepada klien di sarana pelayanan kesehatan dan tatanan pelayanan lainnya, dengan menggunakan pendekatan ilmiah keperawatan berdasarkan kode etik dan standar praktik keperawatan.d.Perawat adalah seseorang yang telah menyelesaikan program pendidikan keperawatan baik di dalam maupun di luar negeri yang diakui oleh Pemerintah Republik Indonesia sesuai dengan peraturan perundang undangan.e.Perawat professional adalah tenaga professional yang mandiri, bekerja secara otonom dan berkolaborasi dengan yang lain dan telah menyelesaikan program pendidikan profesi keperawatan, telah lulus uji kompetensi perawat profesional yang dilakukan oleh konsil dengan sebutan Registered Nurse (RN).f.Perawat Profesional Spesialis adalah seseorang perawat yang disiapkan diatas level perawat profesional dan mempunyai kewenangan sebagai spesialis atau kewenangan yang diperluas dan telah lulus uji kompetensi perawat profesional spesialis.g.Sertifikat kompetensi adalah surat tanda pengakuan terhadap kemampuan seorang perawat untuk menjalankan praktik keperawatan di seluruh Indonesia setelah lulus uji.h.Registrasi adalah pencatatan resmi oleh konsil terhadap perawat yang telah memiliki sertifikat kompetensi dan telah mempuyai kualifikasi tertentu lainnya serta diakui secara hukum untuk melaksanakan profesinya.i.Surat Izin Perawat adalah bukti tertulis yang diberikan oleh Dinas Kesehatan Kabupaten/Kota kepada perawat yang akan menjalankan praktik keperawatan setelah memenuhi persyaratan.

2.Azas dan TujuanAzas undang-undang praktik keperawatan hdala bahwa praktik keperawatan dilaksanakan berasaskan Pancasila dan berlandaskan pada nilai ilmiah, etika dan etiket, manfaat, keadilan, kemanusiaan, keseimbangan dan perlindungan serta keselamatan bagi penerima dan pemberi pelayanan keperawatan.

3.Lingkup Praktik KeperawatanLingkup praktik keperawatan adalah :a.Memberikan asuhan keperawatan pada individu, keluarga, kelompok dan masyarakat dalam menyelesaikan masalah kesehatan sederhana dan kompleks.b.Memberikan tindakan keperawatan langsung, pendidikan, nasehat, konseling, dalam rangka penyelesaian masalah kesehatan melalui pemenuhan kebutuhan dasar manusia dalam upaya memandirikan system klien.c.Memberikan pelayanan keperawatan di sarana kesehatan dan tatanan lainnya.d.Memberikan pengobatan dan tindakan medik terbatas, pelayanan KB, imunisasi, pertolongan persalinan normal.e.Melaksanakan program pengobatan secara tertulis dari dokter.

4.Konsil Keperawatan IndonesiaKonsil keperawatan Indonesia dibentuk dalam rangka mencapai tujuan terselenggaranya praktik keperawatan yang bertanggung jawab kepada Presiden, bersifat nasional dan dapat membentuk kantor perwakilan bila diperlukan serta berkedudukan di Ibu Kota Negara Republik Indonesia. Konsil Keperawatan Indonesia mempunyai fungsi pengaturan, pengesahan, serta penetapan kompetensi perawat yang menjalankan praktik keperawatan dalam rangka meningkatkan mutu pelayanan keperawatan. Sedangkan tugasnya adalah;a. Melakukan uji kompetensi dan registrasi perawat.b. Mengesahkan standar pendidikan perawat.c. Membuat peraturan-peraturan terkait dengan praktik perawat untuk melindungi masyarakat.

Dalam menjalankan tugasnya, konsil Keperawatan Indonesia mempunyai wewenang:a. Mengesahkan standar kompetensi perawat dan standar praktik Perawat yang dibuat oleh organisasi profesi.b. Menyetujui dan menolak permohonan registrasi perawat.c. Menetapkan seorang perawat kompeten atau tidak melalui mekanisme uji kompetensi.d. Menetapkan ada tidaknya kesalahan disiplin yang dilakukan perawat.e. Menetapkan sanksi disiplin terhadap kesalahan disiplin dalam praktik yang dilakukan perawat.f. Menetapkan penyelenggaraan program pendidikan profesi keperawatan berdasarkan rekomendasi Organisasi Profesi.

5.Standar Pendidikan Profesi KeperawatanStandar pendidikan profesi keperawatan disusun oleh organisasi profesi keperawatan dan disahkan oleh Konsil Keperawatan Indonesia. Dalam rangka memperlancar penyusunan standar pendidikan profesi keperawatan, organisasi profesi dapat membentuk Kolegium Keperawatan.Standar pendidikan profesi keperawatan adalah:a.untuk pendidikan profesi Ners disusun oleh Kolegium Ners generalis dengan melibatkan asosiasi institusi pendidikan keperawatan.b.untuk pendidikan profesi Ners Spesialis I dan II disusun oleh Kolegium Ners Spesialis dengan melibatkan asosiasi institusi pendidikan keperawatan.

6.Pendidikan dan Pelatihan Keperawatan BerkelanjutanPendidikan dan pelatihan keperawatan berkelanjutan, dimana untuk memberikan suatu kompetensi kepada perawat, dilaksanakan sesuai dengan standar pendidikan keperawatan berkelanjutan. Maka dari itu, Setiap perawat yang berpraktik wajib meningkatkan kompetensinya melalui pendidikan dan pelatihan keperawatan berkelanjutan yang diselenggarakan oleh organisasi profesi dan lembaga lain yang diakreditasi oleh suatu organisasi profesi. Pendidikan dan pelatihan keperawatan berkelanjutan sebagaimana dimaksud dilaksanakan sesuai dengan standar pendidikan berkelanjutan perawat yang ditetapkan oleh organisasi profesi.

7.Registrasi KeperawatanSetiap perawat yang akan melakukan praktik keperawatan di Indonesia harus memiliki Surat Tanda Registrasi Perawat (STRP). Registrasi perawat dilakukan dalam 2 (dua) kategori:a.LVN untuk perawat vokasionalb.RN untuk perawat profesionalUntuk melakukan registrasi awal, perawat harus memenuhi persyaratan :a.memiliki ijazah perawat Diploma III dan SPK untuk LVNb.memiliki ijazah Ners, atau Ners Spesialis untuk RNc.mempunyai surat pernyataan telah mengucapkan sumpah/janji perawatd.memiliki surat keterangan sehat fisik dan mentale.lulus uji kompetensif.membuat pernyataan akan mematuhi dan melaksanakan kode etik profesi keperawatang.rekomendasi dari organisasi profesi

8.Penyelenggaraan Praktik PeperawatanPraktik keperawatan dilakukakan berdasarkan pada kesepakatan antara perawat dengan klien dan atau pasien dalam upaya untuk peningkatan kesehatan, pencegahan penyakit, pemeliharaan kesehatan, kuratif, dan pemulihan kesehatan.Dalam melaksanakan praktik keperawatan, perawat yang telah memililki SIPP berwenang untuk:a.Melaksanakan asuhan keperawatan yang meliputi diantaranya: pengkajian keperawat, penetapan diagnosis keperawatan, perencanaan, melaksanakan tindakan keperawatan dan evaluasi keperawatan.b.Melaksanakan tindakan keperawatan sebagaimana meliput antara lain: intervensi/tritmen keperawatan, observasi keperawatan, pendidikan dan konseling kesehatan.c. Melaksanakan intervensi keperawatand.Memberikan pengobatan (tidak termasuk obat-obat dengan label merah) dan tindakan medik terbatas, pelayanan KB, imunisasi, pertolongan persalinan normal dan menulis permintaan obat/resep terbatas.e.Melaksanakan program pengobatan secara tertulis dari dokter.

9.ketentuan pidanaApabila dalam pembinaan dan pengawasan praktik keperawatan yang berkaitan dengan aspek hukum ditemukan pelanggaran dan kejahatan maka perlu diberikan sanksi hukum. Perawat yang melanggar ketentuan dikenakan sanksi administrasi berupa pencabutan sementara Surat Ijin Praktik Perawat maupun permanen hingga sanksi pidana. Penetapan sanksi administrasi dan Sanksi Disiplin maupun pidana harus didasarkan pada motif pelanggaran dan berat ringannya risiko yang ditimbulkan sebagai akibat pelanggaran.

10. Ketentuan PeralihanDalam rangka untuk mengatasi jangan sampai terjadi kekosongan hokum apabila undang-undang telah disahkan tetapi peraturan perundang-undangan yang terkait dengan praktik keperawatan tetap berlaku sepanjang tidak bertentangan dan belum dicabut. Maka perlu dibunyikan dalam pasal peralihan undang-undang ini. Pada saat diundangkannya Undang-Undang ini semua peraturan perundang-undangan yang merupakan pelaksanaan Undang-undang Nomor 23 Tahun 1992 tentang Kesehatan yang berkaitan dengan pelaksanaan praktik keperawatan, masih tetap berlaku sepanjang tidak bertentangan dan/atau belum diganti berdasarkan Undang-undang ini. Ijin praktik yang diberikan sesuai KepMenKes Nomor 1239 Tahun 2001 tentang Registrasi dan Praktik Keperawatan, masih tetap berlaku sampai berakhirnya izin praktik tersebut sesuai ketentuan.

3.2 Alasan Perlunya Pengaturan Perundang-Undangan Keperawatan1.Alasan FilosofisKesehatan sebagai hak asasi manusia sebagai tanggung jawab Pemerintah dan seluruh elemen masyarakat harus diwujudkan dalam bentuk pemberian berbagai upaya kesehatan kepada seluruh masyarakat melalui penyelenggaraan pembangunan kesehatan yang berkualitas dan terjangkau.Pelayanan kesehatan baik oleh pemerintah maupun masyarakat harus diselenggarakan secara bermutu, adil dan merata dengan memberikan perhatian khusus kepada penduduk miskin, anak-anak, remaja, para ibu dan para lanjut usia yang terlantar baik di perkotaan maupun di pedesaan. Prioritas diberikan pula kepada daerah terpencil, pemukiman baru, wilayah perbatasan dan daerah kantong-kantong keluarga miskin. Penyelesaian masalah yang memberi dampak pada kesehatan masyarakat memerlukan keterlibatan pemerintah, organisasi profesi dan pihak terkait lainnya.

2.Alasan Yuridisa. Undang-Undang Dasar 1945 pasal 28 H ayat 1 menyebutkan bahwa Setiap orang berhak hidup sejahtera lahir dan batin, bertempat tinggal, dan mendapatkan lingkungan hidup yang baik dan sehat serta berhak memperoleh pelayanan kesehatan.b. Undang-Undang Nomor 23 tahun 1992, tentang kesehatan, Bab VI mengenai Sumber Daya Kesehatan yang terdiri dari: tenaga kesehatan, sarana kesehatan, perbekalan kesehatan, pembiayaan kesehatan, pengelolaan kesehatan dan penelitaian dan pengembangan kesehatan. Dalam Pasal 32 ayat (4) secara eksplisit menyebutkan bahwa:Pelaksanaan pengobatan dan atau perawatan berdasarkan ilmu kedokteran dan atau ilmu keperawatan, hanya dapat dilaksanakan oleh tenaga kesehatan yang mempunyai keahlian dan kewenangan untuk itu.Pada Pasal 53 ayat 1 juga menyebutkan bahwa: Tenaga kesehatan berhak memperoleh perlindungan hukum dalam melaksanakan tugas sesuai dengan profesinya.

3.Alasan SosiologisUndang-Undang menganut beberapa alasan sosiologis sebagai berikut:a. Mengantisipasi kebutuhan masyarakat akan pelayanan kesehatan khususnya pelayanan keperawatan dengan adanya pergeseran paradigma dalam pemberian pelayanan kesehatan dari model medical yang menitikberatkan pelayanan pada diagnosis penyakit dan pengobatan ke paradigma sehat yang lebih holistik yang melihat penyakit dan gejala sebagai informasi dan bukan sebagai fokus pelayanan (Cohen, 1996).b. Sudah disepakati secara nasional pada tahun 1983 bahwa keperawatan sebagai profesi dan struktur pendidikan tinggi keperawatan sebagai pendidikan profesi sesuai dengan proyeksi kebutuhan jenis dan jenjang tenaga perawat.c. Mendekatkan keterjangkauan masyarakat terhadap pelayanan keperawatan.d. Meningkatkan kontribusi pelayanan keperawatan yang bermutu sebagai bagian integral dari pelayanan kesehatan.e. Memberikan kepastian hukum kepada pemberian dan penyelenggaraan pelayanan keperawatan Masyarakat terutama masyarakat Indonesia berhak mendapakan pelayanan keperawatan yang berkualitas oleh perawat yang kompeten tanpa diskriminatif menurut status social, budaya, agama, ras dll.

4.Alasan Tehnik Keperawatana. Citra keperawatan rendah terkait dengan Persepsi masyarakat terhadap perawat.b. Keperawatan masih dianggap bukan merupakan komponen penting dalam pengambilan keputusan (kebijakan).c. Variasi proporsi kualifikasi tenaga perawat Penyebaran tenaga yang tidak merata.d. Kepemimpinan dan manajemen yang tidak efektif.e. Ketidaksesuaian kompetensi dengan tanggung jawab.f. Peluang untuk Pelatihan kurang, jika ada kesempatan menggunakan peluang sempit.g. Kurang dilibatkan dalam pengambilan keputusan penting.h. Kondisi kerja.

3.3Manfaat RUU KeperawatanTingginya tuntutan pengesahan UU keperawatan oleh anggota profesi perawat tak lain untuk melindungi kepentingan pasien dan masyarakat. UU ini menjamin kompetensi perawat yang baik sehingga kepentingan pasien untuk mendapatkan asuhan keperawatan yang bermutu akan terjamin. Pasien akan terhindar dari praktek keperawatan yang dilakukan oleh perawat yang tidak kompeten.UU keperawatan juga akan mencegah dampak negatif dari perdagangan bebas bidang jasa. UU keperawatan akan melindungi masyarakat dan profesi keperawatan terutama yang menyangkut penapisan kompetensi. Mulai 1Januari 2010 berlaku Mutual Recognition Arrange (MRA) dimana perawat-perawat asing sudah bebas masuk ke Indonesia. Sementara Indonesia sebagai tuan rumah belum memiliki pengaturan hukum yang melindungi masyarakat dan perawat Indonesia. Dibandingkan 10 negara di Asia Tenggara hanya Indonesia dan Laos saja yang belum memiliki UU keperawatan.Saat ini, perawat masih dipandang sebagai vokasional bukan profesional. Perawat dinilai belum mampu menjadi mitra dokter, perawat hanya dipandang sebagai pelaksana instruksi dokter. Disamping itu, ketika perawat berada di tempat dan situasi dimana tidak terdapat tenaga dokter seperti daerah terpencil yang mengharuskan perawat melakukan tindakan penyelamatan hidup (life saving)dan pengobatan tidak ada UU yang melindungi perawat.Tentu kita tidak menginginkan kasus Misran terjadi pada rekan perawat yang lain. Perawat perlu perlindungan hukum untuk melakukan tindakan medis bagi keadaan yang mengancam nyawa. Muara dari urgensi UU keperawatan ini adalah untuk melindungi pasien dan masyarakat itu sendiri.Perjuangan dalam mengesahkan UU keperawatan ini tidak akan tercapai tanpa usaha dan dukungan dari seluruh anggota profesi dan masyarakat. Pemerintah perlu membuka mata bahwa UU keperawatan merupakan perjuangan melindungi kepentingan masyarakat dan profesi. PR kita sebagai perawat adalah bersama-sama membangun organisasi profesi agar lebih kuat, mulai sekarang perawat dituntut untuk meningkatkan pengetahuan dan keterampilannya agar makna kolaborasi dan mitra benar-benar bisa dibuktikan. Mulailah dari diri sendiri, dari hal yang kecil, dan mulai sekarang.Berdasarkan uraian diatas, dapat disimpulkan bahwa ada empat hal yang menjadi urgensi atau pentingnya UU keperawatan yaitu perawat sebagai profesi mandiri perlu memiliki kewenangan untuk mengatur kehidupan profesi sendiri, kesyahan peraturan profesi yang terkait dengan kehidupan masyarakat, mencegah dampak negatif dari perdagangan bebas di bidang jasa, dan mengejar ketertinggalan dari luar negeri. Rekomendasi penting yang harus dilakukan adalah advokasi kepada pengambil keputusan dan sosialisasi kepada masyarakat untuk mendukung pengesahan UU keperawatan ini.

3.4 Hal yang Menghambat Disahkannya RUU Keperawatan Dalam mengesahkan RUU keperawatan sebenarnya yang menjadi kendala adalah keraguan orang lain terhadap profesi keperawatan. Dalam mengubah pola pikir orang lain terhadap profesi keperawatan ,perawat harus bias menangani dan mengatasi permasalahan atau penyakit yang dialami pasien menggunakan pendekatan ilmu keperawatan yang dimiliki dan rasionalnya. Jangan sampai profesi keperawatan dipandang sebelah mata karena ulah dari perawat itu sendiri yang bekerja secara tidak profesional , sehingga banyak menimbulkan pertanyaan dan keraguan dalam diri orang lain terhadap terhadap profesi keperawatan. Mari kita bersama- sama meningkatkan kapasitas keilmuan dan keintelektualan kita dengan meningkatkan kapasitas keilmuan, kita tidak akan merasa tertinggal dengan teman- teman sejawat dan kita bisa profesional dalam menjalankan tugas kita yang mulia.Rancangan undang-undang keperawatan yang sampai saat ini masih terus dalam pembahasan Komisi IX DPR RI belum menemui titik waktu kapan disahkannya. Ada beberapa hal yang mungkin perlu dipikirkan oleh segenap perawat di Indonesia agar RUU Keperawatan segera mendapatkan pengesahannya, sebagai berikut:Pertama: apakah perawat telah melakukan sosialisasi ke masyarakat umum. Fenomena yang terjadi dilapangan menggambarkan bahwa hanya perawat saja yang menuntut untuk disahkannya RUU Keperawatan tersebut (mungkin juga ada sebagian perawat yang juga tidak mengetahui tentang RUU keperawatan), sedangkan sebagian besar masyarakat belum memberikan reaksi aktif untuk mendukung pengesahan RUU keperawatan ini.Padahal bila menilik substansi isi RUU keperawatan yang terdiri 12 bab 97 pasal dapat disimpulkan bahwa RUU keperawatan tersebut tidak hanya melindungi perawat sebagai perangkat anggota profesi, namun juga melindungi masyarakat sebagai klien dalam pelayanan keperawatan. Disini perlu adanya support dari dari masyarakat sehingga semua lapisan akan merasa bahwa RUU keperawatan tersebut bukan ditujukan untuk kepentingan perawat semata namun untuk melindungi masyarakat sebagai pengguna jasa pelayanan keperawatan. Dari substansi RUU Keperawatan itu sendiri tidak hanya membahas tentang praktik keperawatan saja yang sempat menjadi kontra pada sebagian petinggi negara. Namun juga mengatur tentang sistem registrasi dan jaminan mutu lulusan perawat yang nantinya akan mengayomi masyarakat. Kedua: apa urgensinya RUU keperawatan sehingga perlu disahkan. Keperawatan sebagai suatu profesi, dalam melaksanakan tugas dan tanggungjawab pengembangannya harus mampu mandiri. Untuk itu memerlukan suatu wadah yang mempunyai fungsi utama untuk menetapkan, mengatur serta mengendalikan berbagai hal yang berkaitan dengan profesi seperti pengaturan hak dan batas kewenangan, standar praktek, standar pendidikan, legislasi dan kode etik profesi.Serta peraturan lain yang berkaitan dengan profesi keperawatan sehingga perawat yang bekerja dalam lingkup kewenangan profesi seharusnya mengetahui apa yang boleh dan tidak boleh dilakukannya. Bila kita melihat isi UU Kesehatan no. 36 tahun 2009, banyak sekali substansi dari peraturan yang ada diperundang-undangan tersebut yang bernuansa medis, padahal pada semua tempat pelayanan kesehatan yang ada di Indonesia jumlah tenaga keperawatan.Selain itu, UU Kesehatan tersebut belum spesifik diatur menjadi PP, sementara Kepmenkes kurang mengikat peraturan-peraturan yang ada di daerah karena hingga saat ini di Indonesia, baru Provinsi Lampung saja yang mempunyai Peraturan Daerah tentang Praktik Keperawatan.Perawat dalam melaksanakan peran dan fungsinya kerapkali mengalami berbagai kendala, mulai dari adanya kasus mal praktek, tidak adanya legalisasi dalam memberikan pelayanan kesehatan, hingga ada yang meragukan kompetensi yang dimiliki dan sebagainya. Dari berbagai masalah yang muncul memicu kita sebagai anggota profesi dan juga perawat tentunya untuk berusaha mencari sebuah kebijakan yang dapat mengatur profesi keperawatan dalam melaksanakan peran dan fungsinya dimasyarakat.Dalam upaya pengembangan kebijakan, ada beberapa model pengembangan dalam menentukan kebijakan publik bagi profesi keperawatan. Untuk menghadapi situasi saat ini, salah satu metode yang cocok digunakan adalah model kelompok, dimana diperlukan peran aktif dari berbagai anggota kelompok yang berkepentingan untuk mempengaruhi substansi dan bentuk kebijakan. Dalam aplikasinya, organisasi profesi (PPNI) perlu melakukan advokasi dan sosialisasi secara menyeluruh kepada segenap lapisan masyarakat baik kalangan elit maupun masyarakat umum agar memiliki kesadaran akan manfaat bila RUU Keperawatan ini disahkan.Gambaran fenomena diatas dapat menyimpulkan bahwa RUU Keperawatan yang telah diajukan merupakan bentuk dari pertanggungjawaban dari profesi keperawatan terhadap pelayanan kesehatan yang diberikan kepada masyarakat dan ini juga melindungi masyarakat dari kesalahan dalam menerima pelayanan kesehatan. Oleh karena itu hendaknya dapat menjadi kesepakatan bersama agar RUU Keperawatan ini segera disahkan.

3.5 Solusi yang Dilakukan Untuk Pengesahan RUU KeperawatanRapatParipurnaDPRRIhariini,Selasa(12/2)memutuskanRUUUsulInisiatifKomisiIXDPRRItentangKeperawatanmenjadiRUUUsulInisiatifDPRRIuntuksegeradilakukanpembahasanlebihlanjut.PengesahanRUUtentangKeperawatanmenjadiusulinisiatifDPRRIinitanpa dibacakanpandanganfraksi-fraksi.Pandanganfraksi fraksi,hanyadisampaikansecaratertuliskepadaWakilKetuaDPRRIPriyoBudiSantosoyangmemimpinrapatparipurnatersebutitudinyatakansah. Halinimengingatpadaprinsipnyasemuafraksitelahmenyetujuihalini.

AnggotaDPR,SalehHusin(F-Hanura) yangmengajukaninterupsipadaPimpinanSidangagarpandanganfraksitidakperludibacakan,tapicukupdisampaikansecaratertulispadaPimpinanSidangsaja.UsulanSalehHusininipunBakGayungBersambut,danlangsungdisetujuipimpinanumani.

Bagaimanakalaucukupdiserahkansajakemejapimpinan,tidakperludibacakan.Karenapadaprinsipnyafraksi-fraksitelahmenyatakanpersetujuanRUUinisiatifDewansoalkeperawatanini,tukasHusin.

Priyopunmenyetujuinya,denganpertimbangankeefektifandanefisiensiwaktu.MenurutPriyo,untukkeperluantersebut,SekjenDPRRItelahmemberitahukandaftarnamajurubicarafraksi-fraksiyangakanmenyampaikanpendapatfraksinyadenganurutansecarabergiliranyangdiawalijurubicaradariF-PDIPSriRahayu,AnshoriSiregardariF-PKS,RizkiSadikdariF-PAN,OkyAsokawatidariF-PPP,ChusnuniaF-PKB,SupriyatnodariF-Gerindra,MuchtarAmaF-Hanura, NovaRiyantiYusufdariF-PD,danEndangAgustiniSyarwanHamiddariF-PG.

Untukyangsayasebuttadi,sayapersilahkanmenyampaikanpandanganfraksinyadanmenjadibagianyangtidakterpisahkanyangsudahkitasepakatitadi,ujarPriyo.Setelahjurubicaramasing-masingfraksimenyerahkanpendapatfraksinya,Priyomengatakan,apakahRUUUsulInisiatifKomisiIXDPRRIdapatdisahkanmenjadiRUUUsulInisiatifDPRRI.Seluruhanggotayanghadirdalamrapatparipurnatersebutmenyatakansetuju.

Dalamkesempatantersebut,Priyomenyatakan,bahwapembahasanRUUkeperawataninidapatsegeradimulai,dandapatdiselesaikanpada 2013ini.Sementara itu, Juru Bicara Sri Rahayu (F-PDIP) menyatakan RUU Keperawatan harus menjamin tidak adanya diskriminasi terhadap profesi perawat. Karena munculnya RUU ini berawal dari adanya keresahan para perawat yang mengalami perlakuan diskriminatif dalam melaksanakan profesinya.Terkait rumusan uji kompetensi, registrasi dan lisensi bagi peserta didik keperawatan yang telah menyelesaikan pendidikan keperawatan maupun bagi perawat yang telah bekerja, menurut Juru Bicara F-PDIP ini, dalam RUU ini harus dihindari adanya birokrasi profesi yang berlebihan yang kemudian menjadi penyebab adanya profesi dengan biaya tinggi yang akhirnya menjadi beban masyarakat sebagai pengguna pelayanan kesehatan.Nova Riyanti Yusuf (F-PD) menjelaskan, bahwa RUU ini harus mampu mengarahkan para perawat untuk bekerja secara profesional, terlatih, dan mampu menguatkan para perawat untuk bekerja dan berperperilaku baik, serta tidak pernah menanggalkan empati kepada mereka yang diberikan pelayanan.Oleh karena itu, menurutnya, diperlukan kepastian hukum yang melindungi para perawat dalam mengemban tugas secara profesional dan mengedepankan umanism, harus linier dengan kepastian pelayanan yang berkualitas dan berpihak pada keselamatan jiwa dan raga seluruh rakyat Indonesia.Sementara, Endang Agustini Syarwan Hamid (F-PG) menyatakan, secara politis UU Keperawatan bagi FPG merupakan keputusan yang sangat strategis untuk didukung, karena sangat berpengaruh atas akses pelayanan kesehatan bagi masyarakat yang sampai saat ini masih memerlukan banyak perhatian.Bilamana UU Keperawatan disahkan, kata Endang, maka perawat merasa mendapat perhatian yang adil secara hukum dan profesional, disamping bagi masyarakat, juga merasa terlindungi dengan baik secara proporsional, yaitu dapat meminimalkan kesalahan prosedur dalam penanganan dan tindakan kesehatan.Okky Asokawati (F-PPP) menjelaskan bahwa pembahasan RUU Keperawatan memang dapat dilakukan dalam RUU Tenaga Kesehatan. Namun, fraksinya merasa jauh lebih baik urusan tersebut diatur dalam suatu RUU tersendiri, sehingga dapat memberikan kepastian hukum yang lebih besar.Menurut Okky, fraksinya tidak keberatan jika nantinya ada kehendak organisasi-organisasi profesi kesehatan lainnya untuk memperoleh kesempatan yang sama guna mendapatkan perlindungan di mata hukum.Senada dengan F-PDIP, F-PD, F-PG dan F-PPP, masing-masing juru bicara F-PKS, F-PKB, F-PAN, F-HANURA dan F-GERINDRA menyatakan persetujuannya dan mendukung RUU tentang Keperawatan ditetapkan menjadi RUU DPR RI, dan berharap dapat segera dibahas bersama pemerintah.

BAB IVSIMPULAN DAN SARAN4.1 KesimpulanDalam peraturan perundang-undangan yang mengatur mengenai penyelenggaraan praktik keperawatan saat ini didominasi oleh kebutuhan formil dan kepentingan pemerintah, sedangkan peran profesi masih kurang.Kemajuan ilmu pengetahuan dan tehnologi dibidang keperawatan yang sangat pesat harus diimabngi pula dengan perangkat hukum yang ada, sehingga dapat memberikan perlindungan yang menyeluruh kepada tenaga keperawatan sebagai pemberi pelayanan maupun di masyarakat sebagai penerima pelayanan kesehatan. Dalam melakukan perubahan atau dalam membentuk suatu undang-undang yang diharapkan dapat sesuai dengan kebutuhan hukum masyarakat, maka keberadaan Undang-Undang yang mengatur tentang praktik keperawatan.

4.2 Saran

DAFTAR PUSTAKA

Anoname.2012.MAKALAH RUU KEPERAWATAN. http://keperawatan007.blogspot.com/2012/11/makalah-ruu-keperawatan.html diakses pada tanggal 20 Mei 2013

RUU Keperawatan.(2010).from http://vhacomel.student.umm.ac.id/2010/02/05/ruu-keperawatan/

Draf RUU Keperawatan. (2011). From ttp://downloads.ziddu.com/downloadfiles/16422594/DrafRUUKeperawatan_Rev_13Januari2011_.pdf

DPDRI. (2012). RUU Keperawatan untuk Mempertahankan dan Meningkatkan Mutu Keperawatan (Publication. Retrieved 20 Mei 2013, from Dewan Perwakilan Daerah RI: http://dpd.go.id/2012/10/ruu-keperawatan-untuk-mempertahankan-dan-meningkatkan-mutu-keperawatan/

Soekarno. (2009). PENYUSUNAN RUU TENTANG PRAKTIK KEPERAWATAN. Retrieved 23 Agustus 2009, from http://www.dpr.go.id/complorgans/baleg/makalah_PENYUSUNAN_RUU_TENTANG_PRAKTIK_KEPERAWATAN____Oleh_-_F.X._Soekarno,_SH.pdf

http://theglobejournal.com/opini/undang-undang-keperawatan-pentingkah/index.phphttp://www.fik.umsurabaya.ac.id/berita BAGAIMANA%20NASIB%20UU%20KEPERAWATAN.php

http://www.dpr.go.id/id/berita/pimpinan/2013/feb/13/5109/dewan-tetapkan-ruu-keperawatan-jadi-ruu-usul-inisiatif-dpr

1