makalah kortikosteroid

  • View
    516

  • Download
    65

Embed Size (px)

Text of makalah kortikosteroid

BAB 1 PENDAHULUAN 1.1 Latar BeIakang Obatobatankortikosteroidmerupakansuatuagenyangsangatbergunadalamilmu kesehatan.Seringkalikitamelihatparadokterterutamadaribagianilmukesehatankulit, rheumatologis,pulmonologisdandaribagianlainjugameresepkankortikosteroidpada pasienpasienmereka.Namunpenggunaanobatdalamkelompokkortikosteroid sebenarnyamengandungbebarapaefeksampingmembahayakanpasien.Biasanyaefek samping yang terjadi adalah bergantung kepada dosis dan lama pemakaian obat ini1. Efeksampingyangdapatkitajangkakanadalahterjadinyakehilanganmassatulang yang cepat. ni telah dibuktikan dalam satu penelitian, pada penderita yang mengkomsumsi kortikosteroidantara510tahundidapatkanpeningkataninsidenterjadinyafraktur osteoporotik1.niterjadiapabilatulangtulangpadapenderitatersebuttelahkehilangan masasehinggamenjadikannyalemahdantidakmampuuntukmenyokongberattubuh penderita dan akhirnya mengalami fraktur yang terjadi sebagai komplikasi dari osteoporosis. Etiologiterjadinyaosteoporosispadapengunaanobatobatankortikosteroidadalah disebabkankehilanganselpembentuktulangyangdikenalsebagaiosteoblast.Osteoblast yangmenurunmenyebabkantergangunyakeseimbanganpembentukandanpenyerapan tulang2. Dilaporkanpenurunanjaringantulangterjadidengancepatsehinggamencapai12% pada tahun pertama penggunaan kortikosteroid, dan diikuti 2-5% setiap tahunnya. 30 50% pasien yang menggunakan kortikosteroid menderita fraktur yang disebabkan osteoporosis2. Corticosteroidinducedosteoporosismerupakanpenyebabterbanyakkeduaterjadinya osteoporosis setelah osteoporosis postmenopausal1.alaupunefeksampingterhadapcorticosteroidinidapatdidiagnosadenganmudah, tidakbanyakdokteryangmemberikanterapipreventifuntukmencegahosteoporosis kepadapasienmereka.Penelitianyangdilakukanmenunjukkankurangdari50%pasien yang diberikan obat golongan corticosteroid di evaluasi untuk risiko terjadi osteoporosis dan kurang 25% telah dirawat apabila terjadi osteoporosis3. 1.2 Rumusan MasaIah Masalah yang didapatkan yang disimpulkan dalam makalah ini adalah : 1.Bagaimana patofisiologi corticosteroid induced osteoporosis? 2.Bagaimana penatalaksanaan corticosteroid induced osteoporosis? 3.Bagaimana mengurangi terjadi komplikasi daripada corticosteroid induced osteoporosis? 1.3 Tujuan Tujuan pembuatan makalah ini adalah untuk: 1.Mengetahui patofisiologi terjadinaya corticosteroid induced osteoporosis. 2. Mengetahui cara cara penatalaksanaan untuk corticosteroid induced osteoporosis. 3.Mengetahui cara mencegah dan menguranngi komplikasi daripada corticosteroid induced osteoporosis BAB II TINJAUAN PUSTAKA 2.1 Kortikosteroid 2.1.1 Definisi ortikosteroidadalahhormonyangtergolongdalamkelompokhormonsteroidyang dihasilkanolehkelenjarkorteksadrenal.Padakondisi'fight&fight',hipotalamusberaksi dengan menghasilkan 'corticotropin releasing factor' (CRF), CRF kemudian akan menstimulasi kelenjarpituitarianterioruntukmenghasilkan'adrenocorticotrophinstimulatinghormone' (ACTH).ACTHakanmemasukisistemsirkulasidanmenujukekelenjarkorteksadrenaldan menstimulasiproduksihormonkorticosteroid.Hormoniniberperanpentingmengaturrespon tubuhterhadapstress,systemkekebalantubuh,pengaturaninflamasi,gluconeogenesis, metabolism lemak, protein dan juga emosi8. Gambar 2.2.1 elenjarkorteksadrenaldapatdibagikankepadatigabagian,yaituzonaglomerulosa, zonafasikulatadanzonaretikularis.Hormonkortikosteroidjugaterbagikepadatiga,yaitu glukokorticoid,aldosteronedanandrogen.Aldosterondiproduksidizonaglomerulosayang paling luar, glukokorticoid diproduksi pada zona fasikulata yang berada di tengah, dan terkakhir, hormon androgen diproduksi pada zona paling dalam yaitu zona retikularis10. Glukokortikoidberperanmengendalikanmetabolismekarbohidrat,lemak,danprotein, jugabersifatantiinflamasidengancaramenghambatpelepasanfosfolipid,sertadapat menurunkankerjaeosinophil,contohdariglukokortikoidadalahkortisol.elompoklaindari kortikosteroidadalahmineralokortikoid,yangberfungsimengaturkadarelektrolitdanair, dengancarapenahanangaramdiginjal,contohdarimineralokorticoidadalahaldosteron. Beberapakortikosteroidmenunjukkankeduajenisaktivitastersebutdalambeberapaderajat, dan lainnya hanya mengeluarkan satu jenis efek. Dalambidangfarmasi,obat-obatanyangdisintesissehinggamemilikiefekseperti hormonkortikosteroidalamimemilikimanfaatyangcukuppenting.Deksametasondan turunannyatergolongglukokortikoid,sedangkanprednisondanturunannyamemilikikerja mineralokortikoid disamping kerja glukokortikoid 2.1.2 Pengunaan KIinis ortikosteroidmerupakanobatyangsangatbanyakdanluasdipakaidalamdunia kedokteranterutamagolonganglukokortikoid.Glukokortikoidsintetikdigunakanpada pengobatannyerisendi,artheritistemporal,dermatitis,reaksialergi,asma,hepatitis,systemic lupuserythematosus,inflammatoryboweldisease,sertasarcoidosis.Selainsediaanoral, terdapatpulasediaandalambentukobatluaruntukpengobatankulit,mata,danjuga inflammatoryboweldisease.ortikosteroidjugadigunakansebagaiterapipenunjanguntuk mengobati mual, dikombinasikan dengan antagonis 5-HT3 , misalnya ondansetron8. Baikkortikosteroidalamimaupunsintetikdigunakanuntukdiagnosisdanpengobatan kelainanfungsiadrenal.Hormoninijugaseringdigunakandalamdosislebihbesaruntuk pengobatan berbagai kelainan peradangan dan imunologi. Penggunaanglukokortikoidpadapengobatangangguanfungsiadrenalbiasanya diberikanpadakeadaaninsufisiensiatauhiperfungsidariadrenokortikal.eadaaninsufisiensi adrenokortikaldapatberupaakutmaupunkronis(penyakitAddison)yangditandaidengan hiperpigmentasi, lemah, kelelahan, berat badan menurun, hipotensi, dan tidak ada kemampuan untukmemeliharakadarguladarahselamapuasa.Untukkeadaanhiperfungsiadrenokortikal misalnya terjadi pada hiperplasia adrenal kongenital, sindrom chusing, atau aldosteronisme. Glukokortikoiddapatpuladigunakanuntuktujuandiagnostikdarisindromcushing. Dengantessupresideksametason,obatinidiberikansejumlah1mgperoralpadajam11 malam,dansampelplasmadiambilpadapagihari.Padaindividunormal,konsentrasikortisol biasanya kurang dari 5 g/dl, sedangkan pada sindrom chusing kadarnya biasanya lebih besar daripada10g/dl.Namunhasilinitidakdapatdipercayapadakeadaandepresi,ansietas, penyakit, dan kondisi stress yang lain. Selainitu,maturasiparu-parupadajanindiaturolehsekresikortisoljanin.budengan pengobatan glukokortikoid dalamdosis besar akan dapatmenurunkaninsidensindromagagal nafas pada bayi yang dilahirkan secara premature, contoh obat yang sering digunakan adalah indometasin. ortisol dan analog sintetiknya berguna dalam pengobatan berbagai kelompok penyakit yangtidakberhubungandengankelainanfungsiadrenal.egunaankortikosteroidpada kelainan ini merupakan kemampuannya untuk menekan respon peradangan dan respon imun. Padakeadaanyangresponsperadanganatauresponimunnyapentinguntukmengendalikan prosespatologi,terapidengankortikosteroidmungkinberbahayatetapidibenarkanuntuk mencegahtimbulnyakerusakanyangtakdapatdiperbaikiakibatresponperadanganjika digunakan bersama dengan terapi spesifik untuk proses penyakitnya10. 2.1.3 Farmakodinamik Kortikosteroid ortikosteroidmerupakanhormonyangsangatlipofiliksehinggadapatmenembus membranlipidsecaradiffus.Padawaktumemasukijaringan,glukokortikoidterikatpada reseptorkortikostroidmenjadikortikosteroidkomplekshormonreseptor,kemudiankompleks hormonreseptorditransporkedalaminti,dimanaakanhormonreseptorkompeksiniakan berikatanpadabagianDNAyangdikenalsebagaielemenhormonreseptorsehinggaterjadi transkirpsimRNAyangkemudiaannyaakanditranslasikanolehribosommenjadiprotein protein tertentu yang mengawal efek dari kortikosteroid6.Selain itu, glukokortikoid mempunyai beberapa efek penghambatan umpan balik negatif. Glukokorticoid yang banyak didalam darah menyebabkan hipotalamus mengurangkan produksi CRF, sehingga terjadi umpan balik yang efektif.10. 2.1.4 Efek Samping Kortikosteroid Manfaatyangdiperolehdaripenggunaanglukokortikoidsangatbervariasi.Harus dipertimbangkandengan hati-hati padasetiappenderita terhadapbanyaknya efek padasetiap bagian organism ini. Efek utama yang tidak diinginkan dari glukokortikoidnya dan menimbulkan gambaran klinik sindrom cushing iatrogenik. Sindromcushingiatrogenikdisebabkanolehpemberianglukokortikoidjangkapanjang dalamdosisfarmakologikuntukalasanyangbervariasi.SindromCushingiatrogenicdijumpai pada penderita arthritis rheumatoid, asma, limfoma, dan gangguan kulit umum yang menerima glukokortikoid sintetik sebagai agen anti inflamasi. atrogenicCushing'ssyndrome,diinduksikandenganpemberianglukokortikoidatau steroidlainsepertimegesterolyangmengikatreseptorglukokortikoid,dibedakanoleh penemuanfisikdarihiperfungsiadrenokortikalendogen.Perbedaandapatdibuat, bagaimanapun,denganmengukurkadarkortisolurinedalamkeadaanbasal;padasindrom iatrogenikpadakadarinimerupakanrendahsecarasekunderakibatpenekanandariaksis adrenalpituari.eparahandariiatrogenicCushing'ssyndrometerkaitdengandosissteroid total, steroid paruh hidup biologis, dan lama terapi. ortikosteroiddapatmempengaruhisel-selmelaluireseptor-reseptorglukokortikoidnya denganmekanismekerjasebagaiberikut:kortikosteroidberdifusikedalamselmelewati membranseldanselanjutnyaberikatandenganreseptor.omplekskortikosteroid-reseptor masukkedalamnukleusdalambentukaktif,danakanmengikatDNAsertameningkatkan sintesis messenger RNA (mRNA). Messenger RNA ini akan menimbulkan sintesis protein yang baru.Proteinbaruiniakanmenghambatfungsisel-sellimfoiddenganpenghambatanuptake glukosa10. Sehubungandenganpengaruhkortikosteroidinikitakenalduagolonganspesiesyaitu golonganyangresistendansensitifterhadapkortikosteroid.Spesiesyangresistenterhadap kortikosteroid adalah manusia dan kera sedangkan yang sensitif adalah tikus dan kelinci. Apabilakortikosteroiddiberikankepadagolonganresistenakanmenyebabkan limfositopeniakibatredistribusilimfositkeluarsirkulasidarahmenujuorgan-organlimfoid lainnyaterutamasumsumtulang.Redistribusiinilebihbanyakmempengaruhilimfosit-T daripadalimfosit-B.Mekanismeyangmendasari terjadinyaredistribusilimfositbelum diketahui secarapasti.Secarateoritislimfositopenidapatterjadimelaluiduamekanismeyaitu:migrasi hebatkeluardaripembuluhdarahda

Search related