L2 Alignments - PaVE: Papilloma virus genome database .II-L2-1 OCT 95 L2 Alignments L2 Alignments

  • View
    224

  • Download
    0

Embed Size (px)

Text of L2 Alignments - PaVE: Papilloma virus genome database .II-L2-1 OCT 95 L2 Alignments L2 Alignments

II-L2-1OCT 95

L2 AlignmentsL2 AlignmentsL2 AlignmentsL2 AlignmentsL2 AlignmentsL2 AlignmentsL2 AlignmentsL2 AlignmentsL2 AlignmentsL2 AlignmentsL2 AlignmentsL2 AlignmentsL2 AlignmentsL2 AlignmentsL2 AlignmentsL2 AlignmentsL2 AlignmentsL2 AlignmentsL2 AlignmentsL2 AlingmentsL2 AlignmentsL2 AlignmentsL2 AlignmentsL2 AlignmentsL2 AlignmentsL2 AlignmentsL2 AlignmentsL2 AlignmentsL2 AlignmentsL2 AlignmentsL2 AlignmentsL2 AlignmentsL2 AlignmentsL2 AlignmentsL2 AlignmentsL2 Alignments

L2 Protein Alignment

II-L2-2OCT 95

SuperA.con MSVGDSYPNRLFIVDVLCPFVKPHLTPPLFYIVLIHFHFDTFVFFLYLLRFNKRATM???ra?rr??????? 61HPV54 -AKA--P--....... 9

GroupA1.con MPP?RSRRR....... 8HPV32 ---H-----....... 9HPV42 ---Q-----....... 9

GroupA2.con MVAhRARRR....... 9HPV3 ---------....... 9HPV28 ---------....... 9HPV10 ---Q-----....... 9HPV29 ---------....... 9

GroupA3.con MA...LKRR....... 6HPV61 --...----....... 6

GroupA4.con MSVGDSYPNRLFIVDVLCPFVKPHLTPPLFYIVLIHFHFDTFVFFLYLLRFNKRATM.spRAKRR....... 64HPV2a ---------------------------------------------------------.-I-----....... 64HPV27 -..------....... 7HPV57 -.-------....... 8

GroupA5.con MVA?RA?RR....... 7HPV26 ---V--P--....... 9HPV51 ---T--R--....... 9

GroupA6.con MVAHRA?RR....... 8HPV30 ------R--....... 9HPV53 ------R--....... 9HPV56 ------T--....... 9HPV66 ------T--....... 9

GroupA7.con MVShRAaRR....... 9HPV18 ---------....... 9HPV45 ---------....... 9HPV39 ---------....... 9HPV68ME180 ---------....... 9HPV70 ---S--S--....... 9HPV59 ---------....... 9

GroupA8.con MVSSRPRRR....... 9HPV7 ---------....... 9HPV40 ---------....... 9

GroupA9.con Mrhkrst?R??????? 8HPV16 ------AK-T...... 10HPV35h -------K-V...... 10HPV31 --S----K-T...... 10HPV52 --YR---.-H...... 9HPV33 -------R-....... 9HPV58 -------R-....... 9RhPV1 -K-AHLSR-KRAAPRP 16

GroupA10.con MahsRaRRR....... 9HPV6b ---------....... 9HPV11 -K.P-----....... 8HPV44 ---------....... 9HPV55 ---------....... 9HPV13 ---------....... 9PCPV1 -----P---....... 9

GroupA11.con MRRKRDTHIRR..... 11HPV34 -----------..... 11

L2 Protein Alignment

II-L2-3OCT 95

SuperB.con Ma..rarr??...... 6

GroupB1.con Ma..Rarrv....... 7HPV19 --..----T....... 7HPV25 --..-----....... 7HPV20 --..--K--....... 7HPV21 --..--K--....... 7HPV14d --..-----....... 7HPV5 --..--KT-....... 7HPV36 --..--K--....... 7HPV47 --..-----....... 7HPV12 --..--K--....... 7HPV8 --..-----....... 7HPV24 -V..--K-T....... 7HPV15 --..-----....... 7HPV17 --..-S--I....... 7HPV37 --..----T....... 7HPV9 -V..--K-T....... 7HPV22 --..----T....... 7HPV23 -V..--Q-T....... 7HPV38 -V..----T....... 7HPV49 -V..----T....... 7

GroupB2.con M?..?rrr??...... 4HPV4 -Q..SLS-R....... 7HPV65 -Q..AS--T....... 7HPV48 -S..L---........ 6HPV50 -L..R--......... 5HPV60 -Y..A-VKRV...... 8

SuperC.con Ms????kRV....... 5

GroupC1.con MS..ARKRV....... 7BPV1 --..-----....... 7BPV2 --..-----....... 7

GroupC2.con M?P?..?RV....... 4EEPV -A-...R--....... 6DPV -P-L..K--....... 7

SuperD.con MV..RAARR....... 7BPV4 --..-----....... 7

SuperE.con M?..?rrr?....... 4HPV41 -L..A-Q-V....... 7COPV -A..LI-K........ 6CRPV -V..A-S-K....... 7ROPV -V..L-T-K....... 7

GroupE1.con M?..R?R?........ 3HPV1a -Y..-L-R........ 6HPV63 -L..-V-K........ 6

Unclass.con MS..RRRKRHTRV... 11MnPV --..---------... 11

L2 Protein Alignment

II-L2-4OCT 95

SuperA.con ?????KRASaTqlY?TCKa?.GTCPpDvipkvEgtTlAD?iL?w.gslgvffGgLGIGtGsGtGGRtGYvPl 122HPV54 .....---------Q----S.----S----------I--Q--R-.--M---------------------I-- 74

GroupA1.con .....KRASATQLYQTCKAS.GTCPPDVIPK?EG?T?AD?IL?W.GS?GVFFGGLGIGTGAG?GGRTGYVP? 65HPV32 .....---------------.----------I--R-W--Q--K-.--T--------------S--------I 74HPV42 .....---------------.----------V--T-L--K--Q-.--L--------------T--------L 74

GroupA2.con .....KRASATqLYrTCKaa.GTCPPDVIPKVEGTTLADRILQW.GsLGvYLGGLGIGTGSGTGGRTGYvPi 74HPV3 .....---------------.-----------------------.------------------------A-- 74HPV28 .....---------------.-----------------------.-G--I---------------------L 74HPV10 .....--------------S.-----------------------.--------------------------- 74HPV29 .....------E--K---V-.-----------------------.--------------------------V 74

GroupA3.con .....KRASATDLYRTCKQS.GTCPPDVVPKVEGDTLADRILKW.ASLGVFFGGLGIGTGSGTGGRTGYVPI 71HPV61 .....---------------.-----------------------.--------------------------- 71

GroupA4.con .....KRASPTDLYRTCKQA.GTCPPDIIPRvEQnTLADkILKW.GSLGVFFGGLGIGTGSGTGGRTGYIPV 129HPV2a .....---------------.-----------------------.--------------------------- 129HPV27 .....---------------.----------L------------.--------------------------- 72HPV57 .....---------------.-------------D----R----.--------------------------- 73

GroupA5.con .....KRAS?T?LY?TCKAA.GTCPPDV??K?EG?TLADKILQW.SGLGIFLGGLGIGTG?GSGGRTGYIPL 64HPV26 .....----A-D--K-----.-------IP-I--S---------.---------------T----------- 74HPV51 .....----V-Q--S-----.-------VN-V--T---------.---------------S----------- 74

GroupA6.con .....KRASATQLY?TCK?s.GTCPeDViNKiE?kTwADkILQW.GSLFT?FGgLGIGTGsGsGGRaGYvPL 69HPV30 .....---------Q---QA.----S-------HT-L-------.-----F--N------A----------- 74HPV53 .....---------Q---Q-.------------H----------.-----F-----------T---T--I-- 74HPV56 .....---------K---L-.-------V----Q----------.-----Y---------T----------- 74HPV66 .....---------K---L-.----------V-Q-----R----.-----Y--------------------- 74

GroupA7.con .....KRASaTdlYkTCKQs.GTCPpDV?nKVEGTTLADkiLQW.tSLGIFLGGLGIGTGsGtGGRTGYiPL 73HPV18 .....----V----------.-------VP--------------.S-------------------------- 74HPV45 .....---------R-----.-------I---------------.S----------------S------V-- 74HPV39 .....---------R-----.-------VD--------------.---------------T----------- 74HPV68ME180 .....------E--------.-------I-----------L---.--------------------------- 74HPV70 .....-------I-------.-------V----------RF---.A--------------T----------- 74HPV59 .....--------------A.----S--I---------------.--------------------------- 74

GroupA8.con .....KRASATQLYQTCKAA.GTCPPDVV?KVEQTTVADQILKW.GSMGVFFGGLGIGSGSG?GGRAGYVPL 72HPV7 .....---------------.--------N--------------.-----------------S--------- 74HPV40 .....---------------.--------H--------------.-----------------T--------- 74

GroupA9.con ?????KRASATQLYqTCKaa.GTCPpDvIPKvEgtTiADQiLkY.GSmgVfFGGLGIGtGsGtGGRtGYvPl 73HPV16 .....---------K---Q-.------I------K-------Q-.------------------------I-- 75HPV35h .....---------R-----.-------------N-V-------.---A---------S-------S----- 75HPV31 .....---------------.----S-----I-H--------R-.-------------S------------- 75HPV52 .....--------------S.-------------------L---.--L------------A-S---A----- 74HPV33 .....--------------T.-------------S---------.--L--------------S--------I 74HPV58 .....--------------S.---------------------R-.--L------------------------ 74RhPV1 PGGRQ---------------.---------------V-------.-----Y-------S-A-----S----- 86

GroupA10.con .....KRASATQLYQTCKa?.GTCPpD?IpKVEhnTiADqILKW.GSLGVFFGGLGIGTGsGtGGRtGY?Pl 71HPV6b .....-------------LT.------V----------------.------------------------V-- 74HPV11 .....--------------T.------V------T---------.---------------A-S---A--I-- 73HPV44 .....--------------A.----S-I----------------.------------------------I-- 74HPV55 .....--------------A.----S-I----------------.------------------------I-- 74HPV13 .....--------------S.------V-----Q--L--K----.------------------------V-V 74PCPV1 .....--------------S.------I-A---Q--L--K----.------------------------V-V 74

GroupA11.con .....KRASATQLYKTCKQS.GTCPPDIIPKVEGNTLADQILKY.GSIGVFFGGLGIGSGSGTGGRTGYVPL 76HPV34 .....---------------.-----------------------.--------------------------- 76

L2 Protein Alignment

II-L2-5OCT 95

SuperB.con .....KRdSvt?iYrtCkqa.gtCppDViNKvEqtTiADkiLky?GsagvffGgLGI?tGrGtGG?tGYvPl 68

GroupB1.con .....KRdSvT?IYrtCKqa.gtCPpDViNKVEqtTiADkILky.GsagVFFGGLGIstGrGtGGaTGYvPl 71HPV19 .....----A-N--------.---------------------Q-.---------------K----------- 72HPV25 .....----A-N--------.-------L----N--------Q-.---------------K----T------ 72HPV20 .....----A-N--------.------------S--------Q-.---------------K----T------ 72HPV21 .....----A-N--------.------------S--------Q-.---------------K----T------ 72HPV14d .....----A-N--------.------------S--------Q-.---------------K----T------ 72HPV5 .....------H--Q-----.---------------V--N----.--------------------------- 72HPV36 .....------H--Q-----.-------V-------V--N----.------------GS------------- 72HPV47 .....------H--Q-----.----S--V-------V--N----.------------G-------------- 72HPV12 .....------H--Q-----.-------L-------V--N----.--G---------G-------V---R-- 72HPV8 .....------H--Q-----.---------------V--N----.------------G-------V---T-- 72HPV24 .....----A-N--------.-------------S----N----.--------------------T------ 72HPV15 .....--A---D---G----.-------L---------------.---A--------G----S--------- 72HPV17 .....--A---D---G----.-----------------------.--S---------------------F-- 72HPV37 .....--A---D---G----.-----------------------.-G------------------------- 72HPV9 .....--A---D---G--A-.------------H--------Q-.--------------------------- 72HPV22 .....--A---D--KG--AS.-------------N-L-------.--V------------K----P---I-- 72HPV23 .....--A---D--KG--AS.-------L-----N-L-------.--V---------G--K----------- 72HPV38 .....--A---D---G--AS.N------------S---------.---A----------------------- 72HPV49 .....------N--------.-N-----V----------Q---F.--T---------G-------S-----I 72

GroupB2.con .....KRdS??nLY??Cqlg.gdC?PDVkNKvE??TlADrLL?ifGs?.?YlGnLGIGtGrGsGGs?GY?Pl 57HPV4 .....----VP---AK---S.-N-L--------AD-------RWL--V.I---G------------T--N-I 72HPV65 .....----IP---AK---S.-N-L--------AD-------RWL--V.I---G------------S--N-- 72HPV48 .....--A-PTD--KT-LQ-.---I------F-NS-I--W--K----L.V-F------S-K-----F--R-- 71HPV50 .....--A-PTD--RS-LQ-.---I---Q--F-GN-I--W--K---GL.V-F----------T--TF--R-F 70HPV60 .....-