of 42/42
Agus Tri Cahyono Selasa, 04 November 2014 PROPOSAL SKRIPSI DESAIN FAKTORIAL 2x2 BAB I PENDAHULUAN A. Latar Belakang Aedy (2009) mengatakan bahwa pendidikan adalah sebuah proses yang melibatkan banyak sumber daya, baik sumber daya manusia, sumber dana maupun sumber daya sarana dan prasarana. Setiap sumber daya tersebut melibatkan banyak variabel dan setiap variabel masih melibatkan banyak unsur pula. Tujuan pembelajaran yang dilakukan di sekolah secara umum adalah untuk mentransfer ilmu dalam bentuk pengetahuan, sikap, maupun keterampilan kepada siswa melalui berbagai proses. Proses pembelajaran yang dilakukan dengan berbagai model untuk mencapai tujuan tersebut tidak selalu cocok pada semua siswa. Penyebabnya bisa saja karena latar belakang pendidikan siswa, kebiasaan belajar, motivasi, minat, sarana, lingkungan belajar, model pembelajaran, dan sebagainya. Dalam menelaah peningkatan mutu pendidikan ada salah satu pendekatan yang harus dilalui dengan sukses, yaitu pendekatan substansial pendidikan (content approach). Pendekatan ini berkaitan langsung dengan mutu pendidikan dan tingkah laku yang harus dimiliki oleh siswa, karena proses belajar mengajar ditentukan dengan orientasi pendidikan yang tidak didominasi oleh guru (teacher centered), melainkan didominasi oleh siswa (student centered). Dengan demikian diharapkan prestasi siswa akan menjadi asli atau tidak artifisial belaka. Prestasi yang diperoleh siswa hendaknya dari proses pembelajaran maupun belajar dan tidak hanya melalui transfer infomasi begitu saja. Pembelajaran merupakan proses interaksi baik antara guru dengan siswa, siswa dengan siswa, maupun siswa dengan lingkungannya yang dapat merangsang siswa untuk belajar. Melalui proses interaksi, kemampuan siswa akan berkembang baik mental maupun intelektualnya (Sanjaya, 2008: 133). Dalam keseluruhan proses pendidikan di sekolah berbasis kelas, kegiatan pembelajaran merupakan kegiatan yang paling pokok. Keberhasilan pencapaian tujuan pendidikan terutama ditentukan oleh proses pembelajaran yang dialami siswa. Siswa yang belajar akan mengalami perubahan baik dalam pengetahuan, pemahaman, ketrampilan, nilai, dan sikap. Menurut Slameto (2010: 54), pembelajaran dipengaruhi oleh dua faktor, yaitu faktor internal dan faktor eksternal. Faktor internal merupakan faktorfaktor yang berasal dari dalam diri individu contohnya niat, motivasi berprestasi, sikap, motivasi belajar. Sedangkan faktor eksternal merupakan faktor yang berasal dari luar blog agus Lihat profil lengkapku Mengenai Saya 2014 (3) November (3) RPP SMK Rangkaian Paralel R‐L‐ C dalam Arus Bolak‐ b... BUKU SISWA DASAR DAN PENGUKUR AN LISTRIK X TITL/ TI... PROPOSAL SKRIPSI DESAIN FAKTORIAL 2x2 2013 (1) 2012 (1) 2010 (3) 2009 (11) 2008 (6) Arsip Blog Join this site with Google Friend Connect There are no members yet. Be the first! Already a member? Sign in Pengikut 0 Lainnya Blog Berikut» Buat Blog Masuk

Agus Tri Cahyono_ Proposal Skripsi Desain Faktorial 2x2

  • View
    102

  • Download
    16

Embed Size (px)

DESCRIPTION

Agus Tri Cahyono_ Proposal Skripsi Desain Faktorial 2x2

Text of Agus Tri Cahyono_ Proposal Skripsi Desain Faktorial 2x2

  • 5/30/2015 AgusTriCahyono:PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    http://agustricahyono.blogspot.com/2014/11/proposalskripsidesainfaktorial2x2.html 1/42

    Agus Tri Cahyono

    S e l a s a , 0 4 N o v e m b e r 2 0 1 4

    PROPOSAL SKRIPSI DESAIN FAKTORIAL 2x2

    BABI

    PENDAHULUAN

    A.LatarBelakang

    Aedy (2009) mengatakan bahwa pendidikan adalah sebuah proses yang

    melibatkanbanyaksumberdaya,baiksumberdayamanusia,sumberdanamaupun

    sumberdayasaranadanprasarana.Setiapsumberdayatersebutmelibatkanbanyak

    variabeldansetiapvariabelmasihmelibatkanbanyakunsurpula.

    Tujuanpembelajaranyangdilakukandi sekolahsecaraumumadalahuntuk

    mentransfer ilmu dalam bentuk pengetahuan, sikap, maupun keterampilan kepada

    siswamelaluiberbagaiproses.Prosespembelajaranyangdilakukandenganberbagai

    model untuk mencapai tujuan tersebut tidak selalu cocok pada semua siswa.

    Penyebabnya bisa saja karena latar belakang pendidikan siswa, kebiasaan belajar,

    motivasi,minat,sarana,lingkunganbelajar,modelpembelajaran,dansebagainya.

    Dalam menelaah peningkatan mutu pendidikan ada salah satu pendekatan

    yangharusdilaluidengansukses,yaitupendekatansubstansialpendidikan(content

    approach).Pendekataniniberkaitanlangsungdenganmutupendidikandantingkah

    laku yang harus dimiliki oleh siswa, karena proses belajar mengajar ditentukan

    dengan orientasi pendidikan yang tidak didominasi oleh guru (teacher centered),

    melainkandidominasi oleh siswa (student centered).Dengandemikiandiharapkan

    prestasisiswaakanmenjadiasliatautidakartifisialbelaka.Prestasiyangdiperoleh

    siswahendaknyadariprosespembelajaranmaupunbelajardantidakhanyamelalui

    transferinfomasibegitusaja.

    Pembelajaran merupakan proses interaksi baik antara guru dengan siswa,

    siswadengan siswa,maupun siswadengan lingkungannyayangdapatmerangsang

    siswauntukbelajar.Melaluiproses interaksi, kemampuan siswaakanberkembang

    baikmentalmaupunintelektualnya(Sanjaya,2008:133).Dalamkeseluruhanproses

    pendidikan di sekolah berbasis kelas, kegiatan pembelajaran merupakan kegiatan

    yangpalingpokok.Keberhasilanpencapaiantujuanpendidikanterutamaditentukan

    olehprosespembelajaranyangdialami siswa.Siswayangbelajarakanmengalami

    perubahanbaikdalampengetahuan,pemahaman,ketrampilan,nilai,dansikap.

    Menurut Slameto (2010: 54), pembelajaran dipengaruhi oleh dua faktor,

    yaitu faktor internal dan faktor eksternal. Faktor internal merupakan faktorfaktor

    yang berasal dari dalam diri individu contohnya niat, motivasi berprestasi, sikap,

    motivasibelajar.Sedangkanfaktoreksternalmerupakanfaktoryangberasaldariluar

    blog agus

    Lihat profil lengkapku

    Mengenai Saya

    2014 (3)November (3)

    RPP SMKRangkaianParalel RLC dalamArus Bolakb...

    BUKU SISWADASAR DANPENGUKURAN LISTRIKX TITL/TI...

    PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    2013 (1)

    2012 (1)

    2010 (3)

    2009 (11)

    2008 (6)

    Arsip Blog

    JointhissitewithGoogleFriendConnect

    Therearenomembersyet.Bethefirst!

    Alreadyamember?Signin

    Pengikut

    0 Lainnya BlogBerikut BuatBlog Masuk

  • 5/30/2015 AgusTriCahyono:PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    http://agustricahyono.blogspot.com/2014/11/proposalskripsidesainfaktorial2x2.html 2/42

    diriindividusalahsatucontohnya,yaitumodelpembelajaran.

    Berdasarkanhasilwawancara terhadapgurumatapelajarandasar dan

    pengukuran listrik pada tanggal 18 Februari 2014 di Sekolah Menengah

    Keujuruan Negeri 7 Surabaya atau selanjutnya disingkat SMK Negeri 7

    Surabaya. Model pembelajaran yang sering digunakan oleh guru mata

    pelajarandasardanpengukuranlistrikketikamengajardikelasadalahmodel

    pembelajaran konvensional. Adapun model pembelajaran konvensional

    tersebutmenggunakanmetodeceramahdanmencatatsehinggasiswakurang

    aktif dalam kegiatan belajarmengajar. Pembelajaran konvensional terpusat

    pada guru sehingga menyebabkan siswa cenderung selalu menunggu

    pengetahuandatangdariguru.Siswayangdiajarpunakancepatmengalami

    kebosanan, mengingat dasar dan pengukuran listrik merupakan mata

    pelajaran produktif yang memiliki jumlah 10 jam pelajaran dalam satu

    minggu.

    Berdasarkan hasil wawancara pula, hasil belajar siswa belum

    menunjukkan peningkatan dari nilai ulangan siswa sebelum remedial pada

    matapelajarandasar danpengukuran listrik.Nilai hasil belajar siswa yang

    telah tuntasmasihmencapai 65%dari seluruh siswa kelas X TIPTL yang

    berjumlah 98 siswa dan terbagi menjadi tiga kelas dengan nilai Kriteria

    KelulusanMinimum(KKM)>76.Didasarkanhaltersebut,adabeberapahal

    yangmenjadi faktoryangbelumbisamenunjanghasil belajar siswa secara

    maksimal. Mengingat kondisi tersebut dan semakin majunya ilmu

    pengetahuan,makadalamprosespembelajaranharuslahmenngunakanmodel

    pembelajaran yang dapatmenarik respon siswa danmembantu guru dalam

    menjelaskanmateripembelajaran.

    Melihat kondisi tersebut, tentunya akanmenimbulkanmasalahpada

    saatprosespembelajaranpadamatapelajarandasar danpengukuran listrik.

    Masalahmunculdiantaranya:(1)kurangefektifnyaprosespembelajaran,(2)

    kurangnyaperhatianpadasaatprosespembelajaran,(3)kurangnyakeaktifan

    siswapada saatmengikutipembelajaran sehinggaketikadiberikesempatan

    untuk bertanya hanya sedikit siswa yang melakukannya, (4) proses

    pembelajaran yang sering di lakukan oleh guru menggunakan model satu

    arah, yaitu dengan menggunakan model pembelajaran langsung dengan

    metodeceramahdanmencatat,(5)karenawaktuyangterbatassehinggasulit

    untuk menyesuaikan penggunaan model pembelajaran dengan tingkat

    motivasi beprestasi siswa yang beragam, dan (6) pencapaian tujuan

    pembelajaranpadamatapelajaranmengaplikasikan rangkaian listrik belum

    sepenuhnyamaksimal,halinidapatdilihatdarinilairataratasiswakelasX

    TeknikInstalasiPemanfaatanTenagaListrik(TIPTL).

    Mata pelajaran dasar dan pengukuran listrik merupakan materi

    hitungan dan praktik padaKurikulum2013. Dengan melaksanakan belajar

    secara praktik, siswa dibimbing untuk dapat terampil dan mempersiapkan

    bekaluntukmenghadapiduniakerja.Dalamprosesnyasiswadituntutuntuk

  • 5/30/2015 AgusTriCahyono:PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    http://agustricahyono.blogspot.com/2014/11/proposalskripsidesainfaktorial2x2.html 3/42

    mampumemahamimatapelajarandasardanpengukuranlistrik.

    Dari uraian di atas,makauntukmengetahui pengaruhmodel pembelajaran

    dan motivasi berprestasi terhadap hasil belajar siswa maka penulis melakukan

    penelitian tentang Pengaruh Model Pembelajaran terhadap Hasil Belajar Siswa

    Ditinjau dari Motivasi Berprestasi pada Mata Pelajaran Dasar dan Pengukuran

    Listrik.

    B.RumusanMasalah

    Berdasarkan latar belakang masalah yang telah diuraikan di atas, maka

    rumusanmasalahdalampenelitianinisebagaiberikut:

    1.Apakahadaperbedaanhasilbelajarsiswapadamatapelajarandasardan

    pengukuran listrik yang dibelajarkan dengan model pembelajaran

    langsungdanmodelpembelajarankooperatiftipeTAI?

    2.Apakahadaperbedaanhasilbelajarsiswapadamatapelajarandasardan

    pengukuranlistrikditinjaudarimotivasiberprestasitinggidanrendah?

    3.Apakahadainteraksiantaramodelpembelajarandanmotivasiberprestasi

    terhadap hasil belajar siswa padamata pelajaran dasar dan pengukuran

    listrik?

    C.BatasanMasalah

    Berdasarkan rumusan masalah yang telah diuraikan, maka batasan

    masalahpenelitianiniadalahsebagaiberikut:

    1. Model pembelajaran yang digunakan adalah Model Pembelajaran

    Langsung (MPL) danMdel PembelajaranKooperatif (MPK) tipeTeam

    AssistedIndividualization(TAI).

    2. Pengukuran hasil belajar siswa pada mata pelajaran dasar dan

    pengukuranlistrikpadakompetensidasarmenganalisis rangkaian listrik

    arusbolakbalik.

    3.KurikulumyangdigunakanadalahKurikulum2013.

    4. Pengukuran hasil belajar siswa pada mata pelajaran dasar dan

    pengukuran listrik kompetensi dasarmenganalisis rangkaian listrik arus

    bolakbalik.

    5. Sampel yang digunakan adalah siswa SMK program studi keahlian

    TeknikInstalasiPemanfaatanTenagaListrik kelasXdiSMKNegeri 7

    Surabaya.

    6.Hasilbelajarsiswaakandiukuradalahhasilbelajarkognitif,afektifdan

    psikomotor.

    D.TujuanPenelitian

    Tujuanpenelitianiniadalahsebagaiberikut:

    1. Mengetahui adanyaperbedaanhasil belajar siswapadamatapelajaran

    dasar dan pengukuran listrik yang dibelajarkan dengan model

    pembelajaranlangsungdanmodelpembelajarankooperatiftipeTAI.

    2. Mengetahui adanyaperbedaanhasil belajar siswapadamatapelajaran

    dasardanpengukuranlistrikditinjaudarimotivasiberprestasi.

    3. Mengetahui adanya interaksi antaramodel pembelajarandanmotivasi

  • 5/30/2015 AgusTriCahyono:PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    http://agustricahyono.blogspot.com/2014/11/proposalskripsidesainfaktorial2x2.html 4/42

    berprestasi terhadap hasil belajar siswa pada mata pelajaran dasar dan

    pengukuranlistrik.

    E.ManfaatPenelitian

    Penelitiberharaphasilpenelitianinidapatmemberikanmanfaatbaik

    bagi siswa maupun guru. Adapun manfaat penelitian ini adaalah sebagai

    berikut:

    1. Bagi penulis, dalam penelitian ini diharapkan dapat memperoleh

    informasi tentang perbandingan hasil belajar siswa antara yang

    menggunakan model pembelajaran langsung dan model pembelajaran

    kooperatiftipeTAIpadasiswayangmemilikimotivasiberprestasitinggi

    danrendah.

    2.Bagiguru,penelitianinidiharapkanmenjadibahanpertimbangandalam

    memilih model pembelajaran yang tepat dengan mempertimbangkan

    motivasi berprestasi siswa sebagai upaya meningkatkan hasil belajar

    siswa.

    3. Siswa diharapkan mampu meningkatkan hasil belajar pada mata

    pelajarandasardanpengukuranlistrik.

    4.DapatmenjadipilihanyangefektifbagisekolahsekolahSMKdidalam

    membelajarkan model pembelajaran mata pelajaran dasar dan

    pengukuran listrik di kelas serta dapat menjadi jawaban untuk

    meningkatkanhasilbelajarsiswaSMK.

    BABII

    KAJIANPUSTAKA

    A.DeskripsiTeoritik

    1.MotivasiBerprestasi

    a.Pengertianmotivasiberprestasi

    Motivasi dalam bahasa Inggris adalah motive berasal dari kata

    motion yang berarti gerak atau sesuatu yang bergerak. Berawal dari

    kata motif itu motivasi dapat diartikan sebagai daya penggerak aktif.

    Motivasi dapat menjadi aktif pada saatsaat tertentu terutama bila

    kebutuhanuntukmencapaitujuansangatdiperlukan.

    Purwanto (2000: 7071) berpendapat, bahwa setiapmotivasi itu

    bertalianeratdengansuatutujuandancitacita.Makinberhargatujuanitu

    bagiyangbersangkutan,makinkuatpulamotivasinya,sehinggamotivasi

    itusangatbergunabagitindakanatauperbuatanseseorang.

    Menurut Mc. Donald yang dikutip oleh Sardiman (2011: 198),

    motivasi adalah perubahan energi dalam diri seseorang yang ditandai

    denganmunculnya feeling dan didahului dengan tanggapan terhadap

    adanya tujuan. Dari pengertian yang dikemukakan Mc. Donald ini

    mengandung tiga elemen penting, yaitu: (1) motivasi itu mengawali

    terjadinya perubahan energi pada diri setiap individu manusia, (2)

  • 5/30/2015 AgusTriCahyono:PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    http://agustricahyono.blogspot.com/2014/11/proposalskripsidesainfaktorial2x2.html 5/42

    motivasi ditandai denganmunculnya rasadan afeksi seseorang, dan (3)

    motivasiakandirangsangkarenaadanyatujuan.

    Dalam kegiatan belajar, Fathurrohman dan Sutikno

    (2007:19) mengatakan bahwa motivasi dapat dikatakan sebagai

    keseluruhan daya penggerak di dalam diri siswa yang

    menimbulkan, menjamin kelangsungan dan memberikan arah

    kegiatan belajar, sehingga diharapkan dapat mencapai tujuan.

    Dari uraian di atas dapat disimpulkan bahwa motivasi

    berprestasi merupakan dorongan untuk berbuat sebaik mungkin,

    agar memperoleh hasil yang terbaik dengan kondisi yang

    diharapkan. Motivasi berprestasi merupakan pendorong bagi

    siswa untuk berbuat sebaikbaiknya dengan tujuan mencapai

    hasil belajar yang setinggitingginya.

    b.Ciriciridanindikatormotivasiberprestasi

    Motivasiyangadapadadirisiswasangatpentingdalamkegiatan

    belajar. Ada tidaknyamotivasi seseorang individu untuk belajar sangat

    berpengaruh dalam proses aktivitas belajar itu sendiri. Seperti

    dikemukakan oleh Sardiman (2011: 83) motivasi berprestasi memiliki

    ciricirisebagaiberikut:

    1)Tekunmenghadapitugas(dapatbekerjaterusmenerusdalamwaktu

    yanglama,tidakpernahberhentisebelumselesai).

    2)Uletmenghadapikesulitan(tidaklekasputusasa).Tidakmemerlukan

    dorongan dari luar untuk berprestasi sebaik mungkin (tidak cepat

    puasdenganprestasiyangtelahdicapai).

    3)Mewujudkanminatterhadapbermacammacammasalahuntukorang

    dewasa. (misalnyamasalah pembangunan, agama, politik, ekonomi,

    keadilan,pemberantasankorupsi,penentanganterhadapsetiaptindak

    kriminal,amoraldansebagainya).

    4)Lebihsenangbekerjamandiri.

    5) Cepat bosan pada tugastugas yang rutin (halhal yang bersifat

    mekanis,berulangulangbegitusaja,sehinggakurangkreatif).

    6) Dapat mempertahankan pendapatnya (kalau sudah yakin akan

    sesuatu).

    7)Tidakmudahmelepaskanhalyangdiyakiniitu.

    8)Senangmencaridanmemecahkanmasalahsoalsoal.

    Jika ciriciri tersebut terdapat pada seorang siswa berarti siswa

    tersebutmemilikimotivasiberprestasiyangcukupkuatyangdibutuhkan

    dalamaktifitasbelajarnya.

    Dari pendapat tersebut dapat disimpulkan bahwa siswa yang

    memiliki motivasi tinggi dalam berprestasi akan menunjukkan halhal

    seperti1)keinginanmendalamimateri,2)ketekunandalammengerjakan

    tugas,3)keinginanberprestasi,dan4)keinginanuntukmaju.

    c.Jenisjenismotivasiberprestasi

  • 5/30/2015 AgusTriCahyono:PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    http://agustricahyono.blogspot.com/2014/11/proposalskripsidesainfaktorial2x2.html 6/42

    Dalam kegiatan pembelajaran di sekolah merupakan hal yang

    pentingsetidaknyaparasiswamemilikimotivasiuntukberprestasikarena

    kegiatanakanberhasilbaikapabilaanakyangbersangkutanmempunyai

    motivasiyangkuat.Hapsari(2005:74)membagimotivasimembagidua

    jenis, yaitu motivasi instrinsik dan motivasi ekstrinsik dengan

    mendefinisikankeduajenismotivasi tersebut.Motivasi instrinsikadalah

    bentukdoronganbelajaryangdatangdaridalamdiriseseorangdantidak

    perlu rangsangan dari luar. Sedangkan motivasi ekstrinsik adalah

    doronganbelajaryangdatangnyadariluardiriseseorang.

    Daripendapattersebutdapatdisimpulkanbahwamotivasiterdiri

    dari dua macam, yaitu motivasi instrinsik dan motivasi ekstrinsik.

    Berkenaan dengan kegiatan belajarmotivasi instrinsikmempunyai sifat

    yang lebih penting karena daya penggerak yang mendorong seseorang

    dalambelajardaripadamotivasiekstrinsik.Keinginandanusahabelajar

    atas dasar inisiatif dirinya sendiri akanmembuahkan hasil belajar yang

    maksimal, sedang motivasi ekstrinsik, yaitu motivasi yang mendorong

    belajaritutimbuldariluardirinya.Apabilakeinginanuntukbelajarhanya

    dilandasi oleh dorongan dari luar dirinyamaka keinginan untuk belajar

    tersebutakanmudahhilang.

    1)Motivasiintrinsik

    Santrock (2003: 476)mengatakanmotivasi intrinsik adalah

    keinginan dari dalam diri seseorang untuk menjadi kompeten, dan

    melakukan sesuatu demi usaha itu sendiri. Thursan (2008: 28)

    mengemukakan motif intrinsik adalah motif yang mendorong

    seseoranguntukmelakukansesuatukegiatan.

    MenurutHapsari(2005:74)motivasiintrinsikpadaumumnya

    terkaitdenganbakatdanfaktorintelegensidalamdirisiswa.Motivasi

    intrinsik dapat muncul sebagai suatu karakter yang telah ada sejak

    seseorang dilahirkan, sehingga motifasi tersebut merupakan bagian

    darisifatyangdidorongolehfaktorendogen,faktorduniadalam,dan

    sesuatubawaan(Gunarsa,2008:50).

    SedangkanmenurutThursan (2008: 29), seorang siswayang

    memiliki motivasi intrinsik akan aktif belajar sendiri tanpa disuruh

    gurumaupunorangtua.Motivasiintrinsikyangdimilikisiswadalam

    belajarakanlebikkuatlagiapabilamemilikimotivasieksrtrinsik.

    Dari beberapa pendapat tersebut dapat ditarik kesimpulan

    motivasi intrinsik adalahmotivasi yangkuat berasal dari dalamdiri

    individutanpaadanyapengaruhdariluaryangmendorongseseorang

    untukmelakukansesuatukegiatan.

    Menurut Hapsari (2005: 74) faktor yang mempengaruhi

    motivasi intrinsik pada umumnya terkait dengan faktor intelegensi

    danbakat dalamdiri siswa.Gunarsa (2008: 5051),mengemukakan

    bahwa motivasi intrinsik dipengaruhi oleh faktor endogen, faktor

  • 5/30/2015 AgusTriCahyono:PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    http://agustricahyono.blogspot.com/2014/11/proposalskripsidesainfaktorial2x2.html 7/42

    konstitusi, faktor dunia dalam, sesuatu bawaan, sesuatu yang telah

    ada yang diperoleh sejak dilahirkan. Selain itu, motivasi intrinsik

    dapat diperoleh dari proses belajar. Seseoran yang meniru tingkah

    orang lain, yang menghasilkan sesuatu yang menyenangkan secara

    bertahap, maka dari proses tersebut terjadi proses internalisasi dari

    tingkah laku yang ditiru tersebut sehinggamenjadi kepribadian dari

    dirinya.

    Dari berbagai pendapat di atas dapat ditarik kesimpulan

    bahwa faktor yangmempengaruhimotivasi intrinsik antara lain: (1)

    keinginandiri,(2)kepuasan,(3)kebiasaanbaik,dan(4)kesadaran.

    2)Motivasiekstrinsik

    Menurut Supandi (2011: 61), motivasi ekstrinsik adalah

    motivasi yang timbul manakala terdapat rangsangan dari luar

    individu. Adapun Santrock (2003: 476) berpendapat, motivasi

    ekstrinsik adalah keinginan mencapai sesuatu dengan tujuan untuk

    mendapatkan tujuan eksternal atau mendapat hukuman eksternal.

    Lebih lanjut menurut Santrock (2003: 476), motivasi ekstrinsik

    adalah keinginan untuk mencapai sesuatu didorong karena ingin

    mendapatkan penghargaan eksternal atau menghindari hukuman

    eksternal.Motivasiekstrinsikadalahdoronganuntukberprestasiyang

    diberikanolehorang lainsepertisemangat,pujiandannasehatguru,

    orangtua,danoranglainyangdicintai.

    Dari berbagai pendapat tersebut dapat diambil kesimpulan

    bahwa motivasi ektrinsik dipengaruhi atau dirangsang dari luar

    individu. Faktorfaktor yang mempengaruhi motivasi ekstrinsik

    antara lain (1) pujian, (2) nasehat, (3) semangat, (4) hadiah, (5)

    hukuman,dan(6)meniru.

    d.Fungsimotivasiberprestasi

    Motivasi berhubungan erat dengan suatu tujuan. Dengan

    demikian motivasi dapat mempengaruhi adanya kegiatan. Kaitannya

    dengan belajar, motivasi merupakan daya penggerak untuk melakukan

    belajar.MenurutSardiman(2011:85)bahwamotivasimempunyaifungsi

    sebagaiberikut:

    1)Mendorongmanusiauntukberbuat.Jadimotivasisebagaipenggerak

    ataumotoryangmelepaskanenergimotivasidalamhalinimerupakan

    motorpenggerakyangakandigerakkan.

    2) Menentukanarahperbuatanyaknikearahtujuanyangakandicapai.

    Jadi motivasi dapat memberi arah kegiatan yang harus dikerjakan

    agarsesuaidengantujuannya.

    3) Menyeleksi perbuatan yakni menentukan perbuatan yang harus

    dikerjakan yang sesuai untukmencapai tujuan denganmenyisihkan

    perbuatanyangtidakbermanfaatbagitujuantersebut.

    Dari pendapat di atas dapat disimpulkan bahwa pada dasarnya

  • 5/30/2015 AgusTriCahyono:PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    http://agustricahyono.blogspot.com/2014/11/proposalskripsidesainfaktorial2x2.html 8/42

    fungsi motivasi dalam belajar adalah sebagai pendorong dan pengarah

    seseorang atau siswa pada aktifitas mereka dalam pencapaian tujuan

    belajar.

    e.Indikatormotivasiberprestasi

    Adapun indikatormotivasi berprestasi yang dapat ditarik adalah

    sebagaiberikut:

    1) Keinginan mencapai hasil yang optimal, yaitu: a) dorongan

    untuk selalu maju dalam menekuni mata pelajarn dasar dan

    pengukuran listrik, b) dorongan untuk selalu mendapat nilai

    baik, c) dorongan untuk menyelesaikan tugastugas, dan d)

    kesungguhan siswa dalam merespon.

    2) Keinginan untuk meningkatkan pengetahuan, yaitu: a)

    dorongan untuk membaca dan mengerjakan soalsoal, b)

    dorongan untuk mengajukan pertanyaan tentang halhal yang

    belum jelas, dan c) dorongan untuk membaca buku baru.

    3) Rasa percaya diri dan kepuasan, yaitu: a) dorongan untuk

    menguasai materi materi pembelajaran secara mandiri, b)

    memiliki kepuasan dalam mengikuti proses pembelajaran, dan

    c) adanya keinginan umpan balik dalam pembelajaran.

    2.ModelPembelajaran

    Menurut Suprijono (2010: 46), model pembelajaran adalah pola yang

    digunakan sebagai pedoman dalam merencanakan pembelajaran dikelas maupun

    tutorial.Modelpembelajaranberfungsipula sebagaipedomanbagiparaperancang

    pembelajarandanparagurudalammerencanakanaktivitasbelajarmengajar.Melalui

    model pembelajaran guru dapat membantu siswa mendapatkan informasi, ide,

    keterampilan, cara berpikir, dan mengekspresikan ide. Model pembelajaran

    berfungsi pula sebagai pedoman bagi para perancang pembelajaran dan para guru

    dalammerencanakanaktivitasbelajarmengajar.Dalampenelitian inidikemukakan

    duamodel pembelajaran yang digunakan, yaitumodel pembelajaran langsung dan

    modelpembelajarankooperatiftipeTeamAssistedIndividualization(TAI).

    a.ModelPembelajaranLangsung(MPL)

    1)PengertianModelPembelajaranLangsung

    Model pembelajaran langsung adalah salah satu pendekatan

    mengajar yang dirancang khusus untuk menunjang proses belajar

    siswayangberkaitandenganpengetahuandeklaratifdanpegetahuan

    proseduralyangterstrukturdenganbaikyangdapatdiajarkandengan

    polabertahap,selangkahdemiselangkah(KardidanNur(2005:5).

    Adapun ciriciri Model Pembelajaran Langsung (MPL)

    menurutKardi&Nur(2005:3)adalahsebagaiberikut:

    a) Adanya tujuan pembelajaran dan pengaruhmodel pada siswa

    termasukprosedurpenilaianbelajar.

    b)Sintaksataupolakeseluruhandanalurkegiatanpembelajaran

    c) Sistem pengelolaan dan lingkungan belajar model yang

  • 5/30/2015 AgusTriCahyono:PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    http://agustricahyono.blogspot.com/2014/11/proposalskripsidesainfaktorial2x2.html 9/42

    diperlukanagarpembelajaran tertentudapatberlangsungdengan

    berhasil.

    2)Tujuanmodelpembelajaranlangsung

    Para pakar teori belajar pada umumnya membedakan dua

    macampengetahuan, yakni pengetahuan deklaratif dan pengetahuan

    prosedural.Pengetahuandeklaratif (dapatdiungkapkandengankata

    kata) adalah pengetahuan tentang sesuatu, sedangkan pengetahuan

    proseduraladalahpengetahuantentangbagaimanamelakukansesuatu

    (Kardi&Nur, 2005: 4).Suatu contohpengetahuandeklaratif, yaitu

    besarnyahambatanmerupakanhasilbagiantarategangandenganarus

    listrik (R=V/I). Pengetahuan prosedural yang berkaitan dengan

    pengetahuandeklaratifdiatasadalahbagaimanamemperolehrumus

    ataupersamaanhambatan.

    Sering kali pengetahuan prosedural memerlukan penguasaan

    prasyarat yang berupa pengetahuan deklaratif. Para guru selalu

    menghendaki agar siswasiswa memperoleh kedua macam

    pengetahuantersebut,supayamerekadapatmelakukansuatukegiatan

    danmelakukansegalasesuatdenganberhasil.

    Dari penjelasan beberapa teori tersebut bahwa tujuan

    dibelajarkannya model pembelajaran langsung adalah siswa

    memperoleh dua macam pengetahuan, yaitu pengetahuan deklaratif

    danpengetahuanprosedural.Penguasaanpengetahuantersebutsaling

    berhubungandemitercapainyahasilbelajaryangmaksimal.

    3)Sintaksataupolamodelpengajaranlangsung

    Pada model pengajaran langsung terdapat lima fase yang

    sangatpenting.Gurumengawalipelajarandenganpenjelasantentang

    tujuan dan latar belakang pembelajaran, sertamempersiapkan siswa

    untukmenerimapenjelasanguru.

    Pengajaran langsung, menurut Kardi (2005: 3) dapat

    berbentuk ceramah, demonstrasi, pelatihan atau praktek, dan kerja

    kelompok. Pengajaran langsung digunakan untuk menyampaikan

    pelajaran yang ditransformasikan langsung oleh guru kepada siswa.

    Penyusunan waktu yang digunakan untuk mencapai tujuan

    pembelajaran harus seefisien mungkin, sehingga guru dapat

    merancangdengantepatwaktuyangdigunakan.

    Sintaksmodelpengajaranlangsungtersebutdisajikandalam5

    tahapsepertiditunjukkanTabel2.1.

    Tabel2.1.SintaksModelPengajaranLangsungFase PeranGuru

    Fase1Menyampaikantujuandan

    GurumenjelaskanTPK, informasi latarbelakang pelajaran, pentingnya

  • 5/30/2015 AgusTriCahyono:PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    http://agustricahyono.blogspot.com/2014/11/proposalskripsidesainfaktorial2x2.html 10/42

    mempersiapkansiswa pelajaran, mempersiapkan siswa untukbelajar.

    Fase2Mendemonstrasikanpengetahuandanketerampilan

    Gurumendemonstrasikan keterampilandengan benar, atau menyampaikaninformasitahapdemitahap

    Fase3Membimbingpelatihan

    Guru merencanakan dan memberibimbinganpelatihanawal

    Fase4Mengecekpemahamandanmemberikanumpanbalik

    Mengecek apakah siswa telah berhasilmelakukantugasdenganbaik,memberiumpanbalik

    Fase5Memberikankesempatanpelatihanlanjutandanpenerapan

    Guru mempersiapkan kesempatanmelakukan pelatihan lanjutan, denganperhatian khusus pada penerapankepada situasi lebih kompleks dankehidupanseharihari.

    Sumber:Kardi&Nur(2005:8)

    Dari teori tersebutdiatasdapatdisimpulkanbahwapada fase

    persiapan, guru memotivasi siswa agar siap menerima presentasi

    materi pelajaran yang dilakukan melalui demonstrasi tentang

    keterampilan tertentu. Pembelajaran diakhiri dengan pemberian

    kesempatan pada siswa untuk melakukan pelatihan dan pemberian

    umpan balik terhadap keberhasilan siswa. Pada fase pelatihan dan

    pemberian umpan balik tersebut, guru perlu selalu mencoba

    memberikankesempatanpadasiswauntukmenerapkanpengetahuan

    atauketerampilanyangdipelajarikedalamsituasikehidupannyata.

    4)Kelebihandankekuranganmodelpembelajaranlangsung

    Model pembelajaran langsung memilki kekurangan dan

    kebelebihan dalam penerapannya. Adapun keunggulan Menurut

    Sanjaya (2008: 189) yaitu: (a). guru bisa mengontrol urutan dan

    mengontrol urutan dan keluasan materi pembelajaran, (b) efektif

    utuuk materi pelajaran yang harus dikuasai siswa cukup luas,

    sementara ituwaktu yang dimiliki untuk belajar terbatas, (c) selain

    siswadapatmendengarmelalui tentang suatumateri pelajaran, juga

    sekaligussiswadapatmelihat(melaluipelaksanaandemonstrasi),dan

    (d)bisadigunakanuntukjumlahsiswadanukurankelasbesar.

    Namun lebih lanjut Sanjaya (2008: 189) menjelaskan

    beberapakekuranganmodelpembelajaranlangsung,yaitu:(a)

    hanya untuk kemampuanmendengar dan menyimak yang baik, (b)

    tidak dapatmelayani perbedaan kemampuan siswa, dan (c)

    hanya menekankan pada komunikasi satu arah (oneway

    communication).

    b.ModelPembelajaranKoopeatifTipeTeamAssistedIndividualization

    (TAI)

    1) Dasar model pembelajaran koopeatif tipe Team Assisted

    Individualization(TAI)

    Team Assisted Individualization (TAI) merupakan bagian

    dalammodelpembelajarankoopeatif.Modelpembelajarankooperatif

    belum banyak diterapkan dalam pendidikan. Kebanyakan pengajar

    enggan menerapkan sistem kerja sama di dalam kelas karena

  • 5/30/2015 AgusTriCahyono:PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    http://agustricahyono.blogspot.com/2014/11/proposalskripsidesainfaktorial2x2.html 11/42

    beberapaalasan.

    MenurutLie (2002: 27) alasan pengajar engganmenerapkan

    sistem kerjasama di dalam kelas adalah khawatir akan terjadi

    kekacauan di dalam kelas dan siswa tidak belajar jika mereka

    diterapkandidalamgrup.Selainitu,banyakorangmempunyaikesan

    negatif mengenai kegiatan kerja sama atau belajar di dalam

    kelompok.

    Model pembelajaran koopeatif tidak sama dengan proses

    pembelajaran yang hanya sekedar belajar menggunakan kelompok.

    Namun terdapat beberapa unsurunsur dasar yang mendasari

    perbedaan model pembelajaran kooperatif dengan model

    pembelajaransecaraberkelompokyangdilakukansecaraasalasalan.

    Pelaksanaanprosedurmodelkoopeatifyangdi lakukansecarabenar

    akanmemungkinkangurumengelolakelasdenganlebihefektif.

    Menurut Roger dan Johnson dalam Lie (2002: 30), bahwa

    tidak semua kerja kelompok bisa dianggap pembelajaran koopeatif.

    Untuk mencapai hasil yang maksimal, lima unsur pembelajaran

    gotongroyongharusditerapkan.Kelimaunsur tersebutmeliputi a)

    saling ketergantungan positif, b) tanggung jawab perseorangan, c)

    tatap muka, d) komunikasi antar anggota, dan e) evaluasi proses

    kelompok.

    Selain unsurunsur dan penjabaran secara singkat mengenai

    model pembelajaran kooperatif, terdapat teknikteknik atau metode

    yang ada pada model pembelajaran kooperatif ini. Menurut Lie

    (2002:54)Metodemetode tersebut,yaitu: a )mencari pasangan, b)

    bertukarpasangan,c)berpikirberpasanganberempat, d)

    berkirim salam dan soal, e) kepala bernomor, f) kepala bernomor

    terstruktur, g) dua tinggal dua tamu, h) keliling berkelompok, i)

    kancing gemrincing, j) keliling kelas, k) lingkaran kecil lingkaran

    besar,l)taribambu,m)jigsaw,dann)berceritaberpasangan.

    Metode yang terdapat dalammodel pembelajaran kooperatif

    tersebut bervariasi dan banyak pilihanya, mulai dari mencari

    pasangan sampaikeberceritaberpasangan.Apabilametode tersebut

    di terapkan pada proses pembelajaran tidak menutup kemungkinan

    siswa akan menjadi aktif dan merasa senang dengan pembelajaran

    yangdisajikanolehguru.

    Guru yang baik tidak hanya terpaku pada satu metode atau

    satustrategisaja,namunguruyanginginmajudanberkembang,perlu

    mempunyai cadangan atau persediaan strategi dan metode

    pembelajaranyangpastiakanselalubermanfaatbagisiswadandalam

    keseluruhanprosesbelajarmengajar.

    Model pembelajaran kooperatif mempunyai kelebihan dan

    kekurangan(Sanjaya,2008:248251).Kelebihanmodelpembelajaran

  • 5/30/2015 AgusTriCahyono:PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    http://agustricahyono.blogspot.com/2014/11/proposalskripsidesainfaktorial2x2.html 12/42

    kooperatif antara lain: a)menumbuhkan sikap kooperatif atau kerja

    sama antar siswa, b)menumbuhkan jiwa kompetitif pada siswa, c)

    menumbuhkan motivasi berprestasi pada siswa, d) memupuk sikap

    gotong royong, toleransi, kepekaan sosial, sikap demokratis, saling

    menghargai, memupuk ketrampilan berinteraksi sosial, dan e)

    menumbuhkan rasa tanggung jawab dan keberanian dalam proses

    pembelajaran.

    Sedangkan kekurangan atau kelemahan model pembelajaran

    kooperatif, yaitu: a) kesulitan dalam memahami kemampuan

    individual siswa yang sebenarnya, b) siswa yang kemampuannya

    rendah merasa minder dan mengalami kesulitan dalam proses

    pembelajaran, c)munculnya sikap bergantung pada orang lain pada

    siswayangkemampuannyarendah,dand)siswayangpandaimerasa

    harusbekerjamelebihisiswayanglain.

    Pelaksanaan pembelajaran kooperatif terdiri dari beberapa

    fase,yaitu:a)menyampaikantujuandanestablishingset,b)

    mempresentasikan informasi, c)mengorganisasikan siswa ke dalam

    timtim belajar, d) membantu kerja tim dan belajar, e) mengujikan

    berbagaimateri, dan f)memberikanpenghargaan.Tabel 2.2 berikut

    inimerupakanfasefasepadamodelpembelajarankooperatifmenurut

    (Arends,2008:21).

    Tabel2.2.FasefasepadaPembelajaranKooperatifFaseFase Kegiatan Guru

    Fase 1. Menyampaikantujuan dane stablishing set

    Guru menyampaikan tujuantujuanpelajaran dan establishing set

    Fase 2. Mempresentasikaninformasi

    Guru mempresentasikan informasi kepadasiswa secara verbal atau dengan teks.

    Fase 3. Mengorganisasikansiswa ke dalam timtimbelajar

    Guru menjelaskan kepada siswa tata caramembentuk timtim belajar danmembantu kelompok untuk melakukantransisi yang efisien.

    Fase 4. Membantu kerja timdanbelajar

    Guru membantu timtim belajar selamamereka mengerjakan tugasnya

    Fase 5. Mengujikanberbagai materi

    Guru menguji pengetahuan siswa tentangberbagai materi belajar atau kelompokkelompok mempresentasikan hasilnya

    Fase 6. Memberikanpenghargaan

    Guru mencari cara untuk mengakui usahadan prestasi individual maupun kelompok

    Sumber:Arends(2008)

    2)PengertianModelPembelajaranKooperatiftipeTeamAssisted

    Individualization(TAI)

    Model Pembelajaran kooperatif tipe Team Assisted

    Individualization (TAI) ini dikembangkan oleh Slavin. Menurut

    Slavin (2005) tipe inimengkombinasikan keunggulan pembelajaran

    kooperatif dan pembelajaran individual. Tipe ini dirancang untuk

    mengatasi kesulitanbelajar siswa secara individual.Olehkarena itu

    kegiatanpembelajarannyalebihbanyakdigunakanuntukpemecahan

    masalah, ciri khas pada model pembelajaran TAI ini adalah setiap

    siswa secara individual belajar materi pembelajaran yang sudah

    dipersiapkan oleh guru. Hasil belajar individual selanjutnya

  • 5/30/2015 AgusTriCahyono:PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    http://agustricahyono.blogspot.com/2014/11/proposalskripsidesainfaktorial2x2.html 13/42

    didiskusikan ke kelompokkelompok untuk didiskusikan dan saling

    dibahas oleh anggota kelompok, dan semua anggota kelompok

    bertanggungjawabataskeseluruhanjawabansebagaitanggungjawab

    bersama.

    Model Pembelajaran tipe Team Assisted Individualization

    termasukdalampembelajarankooperatif.Dalammodelpembelajaran

    kooperatif tipe TAI, siswa ditempatkan dalam kelompokkelompok

    kecil (3 sampai 4 siswa) yang heterogen dan selanjutnya diikuti

    dengan pemberian bantuan secara individu bagi siswa yang

    memerlukannya. Sebelum dibentuk kelompok, siswa diajarkan

    bagaimana bekerja sama dalam suatu kelompok. Siswa diajari

    menjadipendengaryangbaik,dapatmemberikanpenjelasankepada

    temansekelompok,berdiskusi,mendorong teman lainuntukbekerja

    sama, menghargai pendapat teman lain, dan sebagainya. Masing

    masinganggotadalamkelompokmemilikitugasyangsetara.Karena

    pada pembelajaran kooperatif keberhasilan kelompok sangat

    diperhatikan, maka siswa yang pandai ikut bertanggung jawab

    membantu temannya yang lemah dalam kelompoknya. Dengan

    demikian,siswayangpandaidapatmengembangkankemampuandan

    ketrampilannya, sedangkan siswa yang lemah akan terbantu dalam

    memahamipermasalahanyangdiselesaikandalamkelompok.

    3)KomponenkomponenmodelpembelajarankooperatifTipeTAI

    Model pembelajaran kooperatif TAI memiliki delapan

    komponen (Slavin, 1995:101104) Kedelapan komponen tersebut

    adalahsebagaiberikut:

    1)teams,yaitupembentukankelompokheterogenyangterdiriatas

    3sampai4siswa,

    2) placement test, yakni pemberian pretest kepada siswa atau

    melihat ratarata nilai harian siswa agar guru mengetahui

    kelemahansiswapadabidangtertentu,

    3)studentcreative,yaitumelaksanakantugasdalamsuatukelompok

    dengan menciptakan situasi di mana keberhasilan individu

    ditentukanataudipengaruhiolehkeberhasilankelompoknya,

    4) team study, yaitu tahapan tindakan belajar yang harus

    dilaksanakan oleh kelompok dan guru memberikan bantuan

    secaraindividualkepadasiswayangmembutuhkannya,

    5)teamscoresandteamrecognition,yaitupemberianskorterhadap

    hasil kerja kelompok dan memberikan kriteria penghargaan

    terhadap kelompok yang dipandang kurang berhasil dalam

    menyelesaikantugas,

    6)teachinggroup,yaknipemberianmaterisecarasingkatdariguru

    menjelangpemberiantugaskelompok,

    7)factstest,yaitupelaksanaantesteskecilbardasarkanfaktayang

  • 5/30/2015 AgusTriCahyono:PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    http://agustricahyono.blogspot.com/2014/11/proposalskripsidesainfaktorial2x2.html 14/42

    diperolehsiswa,

    8) wholeclassunits,yaitupemberianmateriolehgurukembalidi

    akhirwaktupembelajarandenganstrategipemecahanmasalah.

    3.HasilBelajar

    a.Pengertianhasilbelajar

    Hasil belajar merupakan variabel dari teori belajar di sekolah.

    Selainvariabel lainnya,yaitukarakteristik individu (siswa)dankualitas

    pengajaran. Hal ini dinyatakan oleh Bloom dalam Theory of School

    Learning, bahwaada tigavariabelutamadalam teoribelajardi sekolah

    yakni:karakteristikindividu,kualitaspengajaran,danhasilbelajarsiswa

    (Sudjana, 2005: 40). Hasil belajar yang dimaksud disini adalah

    kemampuankemampuan yang dimiliki seorang siswa setelah ia

    menerimaperlakukandaripengajar(guru)dimanahasilbelajarmemiliki

    hubungan erat dengan proses belajar. Menurut Whittaker (dalam

    Aunurrahman, 2009: 35) mengemukakan bahwa belajar adalah proses

    dimana tingkah laku ditimbulkan atau diubah melalui latihan atau

    pengalaman. Djamarah dan Zain (2010: 38) mengemukakan bahwa

    belajar pada hakikatnya adalah perubahan yang terjadi dalam diri

    seseorang setelah berakhirnya melakukan aktivitas belajar. Sedangkan

    pendapat lain dari Abdillah (dalam Aunurrahman, 2009: 35)

    mengemukakanbahwabelajar adalah suatuusaha sadaryangdilakukan

    oleh individu dalam perubahan tingkah laku baik memalui latihan

    ataupunpengalamanyangmenyangkutaspekaspekkognitif,afektif,dan

    psikomotor untuk memperoleh tujuan tertentu.Maka proses belajar itu

    adalah proses kegiatan siswa untukmemperoleh sejumlah pengetahuan

    danpengalamanbelajardalammencapaitujuanpembelajaran.Sedangkan

    hasil belajar merupakan gambaran kemampuan yang ditunjukan oleh

    adanyaperubahantingkahlakusetelahsiswamengikutiprosesbelajar.

    Daribeberapapenjelasanteori tersebut, jelasbahwahasilbelajar

    sangattergantungpadaprosesbelajar.Hasilbelajarakanterlihatsetelah

    diberi perlakuan pada proses balajar yang dianggap sebagai proses

    pemberian pengalaman belajar. Hasil belajar mengharapkan terjadinya

    perubahan tingkah laku yang terjadi pada diri siswa. Maka yang

    dimaksud dengan hasil belajar adalah kemampuan siswa setelah

    memperoleh pengalaman belajar dalam proses belajar agar terjadi

    perubahan tingkah laku pada diri siswa dalam bentuk penguasaan dan

    pemahamanpelajaranyangdipelajarinya.

    Arikunto (2001: 26), mengukur hasil belajar dalam dua teknik,

    yaitutekniktesdannontes.Padapenelitianinimenggunakantekniktes,

    danpengamatan.MenurutHasan (2006: 95)mengemukakan bahwa tes

    adalah kegiatan yang dilakukan oleh guru disekolah dalam rangka

    kegiatanevaluasi(mengukur,menilai,assessment).SedangkanArikunto

    (2001:53)mengemukakanbahwatesmerupakanalatatauproseduryang

  • 5/30/2015 AgusTriCahyono:PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    http://agustricahyono.blogspot.com/2014/11/proposalskripsidesainfaktorial2x2.html 15/42

    digunakan untuk mengetahui atau mengukur sesuatu dalam suasana,

    dengan cara dan aturanaturan yang sudah ditentukan. Tes menurut

    Sudjana (2005: 113) adalah alat ukur yang diberikan kepada individu

    untuk mendapatkan jawabanjawaban yang diharapkan baik secara

    tertulisatausecaralisanatausecaraperbuatan.Adaduamacamteshasil

    belajaryakni:tesyangtelahdistandarisasikan(standardizedtest)dantes

    buatan guru sendiri (teachermade test). Tes hasil belajar yang dibuat

    olehguruitudapatdibagiduamacam,yakniteslisan(oraltest)dantes

    tulisan (written test). Tes tertulis dapat dibagi atas tes essay (essay

    examination)dantesobjektif.Tesobjektifyangdisusundapatberbentuk

    pilihan ganda, benarsalah, menjodohkan isian pendek, saat ini banyak

    digunakan dalam penelitian pendidikan. Sedangkan tes essay jarang

    digunakan sebab kurang praktis dan terlalu subjektif. Persyaratan dari

    sebuah tes yang baik menurut Arikunto (2001: 57) diantaranya yaitu

    sebagaiberikut:

    a)validitas(secaratepatmengukuryangseharusnyadiukur),

    b) reliabilitas (menunjukkan hasil yang dapat dipercaya dan tidak

    berubahjikadiadakanteskembali),

    c)objektifitas(tidakdipengaruhiunsurunsurpribadi),

    d)praktikabilitas(praktisdanmudahdalamadministrasinya),dan

    e) ekonomis (tidakmemerlukanbiayayangmahal, tenagadanwaktu

    yangbanyak).

    Dalam penelitian ini, hasil belajar yang dimaksud adalah hasil

    belajarkognitif,afektifdanpsikomotor.Instrumenyangdigunakanuntuk

    mengukur hasil belajar kognitif adalah tes yang digunakan, yaitu tes

    buatan peneliti yang berbentuk tes tertulis objektif pilihan. Sedangkan

    instrumen yang digunakan untk mengkur hasil belajar afektif dan

    psikomotoradalahlembarpengamatan.Agarmemenuhisyaratvaliditas,

    reliabilitas, daya pembeda, dan tingkat kesukaran maka tes buatan

    peneliti ini akan di uji coba terlebih dahulu kepada siswasiswa yang

    telahmempelajarimatapelajaranyangakanditeliti.

    b.Klasifikasihasilbelajar

    Kingsley (dalamSudjana,2005:22),membagi tigamacamhasil

    belajaradalahketerampilandankebiasaan,pengetahuandanpengertian,

    dan sikap dan citacita. Dalam Sistem Pendidikan Nasional rumusan

    tujuan pendidikan, baik tujuan kurikuler maupun instruksional,

    menggunakan klasifikasi hasil belajar Benyamin S. Bloom yang secara

    garisbesarmembaginyamenjadi tiga ranah,yaitu ranahkognitif, ranah

    afektifdanranahpsikomotor.

    Bloom (dalam Rochmad, 2012) membagi ranah masingmasing

    ranahkedalamtingkatantingkatankategoriyangdikenaldenganistilah

    taksonomisepertiberikut:

  • 5/30/2015 AgusTriCahyono:PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    http://agustricahyono.blogspot.com/2014/11/proposalskripsidesainfaktorial2x2.html 16/42

    1)Ranahkognitif

    Ranah kognitif meliputi kemampuan menyatakan kembali

    konsepatauprinsipyangtelahdipelajaridankemampuanintelektual.

    Bloom membagi ranah kognitif ke dalam 6 jenjang kemampuan,

    yaitu:

    a)Mengingat(C1)

    Mengingat kembali pengetahuanyangdiperolehdari ingatan

    jangkapanjang.Adapunprosesdalamranahkognitifiniadalah:

    (1)Mengenali(recognizing)ataumengidentifikasi:menemukan

    pengetahuandariingatanjangkapanjangyangsesuaidengan

    materi yang disajikan (misalnya:mengenali tanggaltanggal

    pentingdalamsejarahAmerika).

    (2) Mengingat (recalling) atau menemukan kembali:

    menemukan hubungan atau kaitan antara pengetahuan dari

    ingatan jangka panjang (misalnya:mengingat kembali hari

    haripentingdalamsejarahAmerika).

    b)Memahami(C2)

    Membangun pengertian atau makna dari pesan berupa

    perintah atau instruksi, termasuk secara lisan, tertulis dan

    hubungan dengan kejadian yang sebenarnya atau dalam bentuk

    gambar.Adapunprosesdalamranahkognitiftingkatinimeliputi:

    (1) Menafsirkan (interpreting) atau mengartikan/

    menggambarkanulang:mengubahdarisatubentukgambaran

    (misal:angka)kebentuklain(misal:kalimat).

    (2) Memberi contoh (exampliying) atau mengilustrasikan:

    menemukan contoh yang sesuai dan cocok atau

    mengilustrasikansuatukonsep.

    (3) Mengklasifikasi (classifying) atau mengelompokkan:

    menentukankonsepyangadapadasuatumateriataukategori.

    (4) Meringkas (summarizing): meringkas suatu bagian yang

    umumataupoinpoinutamadarisuatutema.

    (5) Menduga (inferring) atau mengambil kesimpulan atau

    memprediksi: menggambarkan kesimpulan secara nyata dari

    informasiyangdisajikan.

    (6) Membandingkan (compairing) atau memetakan dan

    mencocokkan:mendeteksiataumencarikesesuaianantaradua

    ide,objekdanhalhalyangserupa.

    (7) Menjelaskan (explaining) atau membangun suatu model:

    membangunhubungansebabakibatdarisuatusystem.

    c)Mengaplikasikan(C3)

    Menerapkanataumenggunakansuatutatacarayangtelah

    diberikanpadasuatukeadaan.Proseskognitifyangdilaluiadalah:

  • 5/30/2015 AgusTriCahyono:PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    http://agustricahyono.blogspot.com/2014/11/proposalskripsidesainfaktorial2x2.html 17/42

    (1) Menjalankan(executing):menerapkansuatucarayang telah

    dikenaluntuktugasyangtelahbiasadijumpai.

    (2) Mengimplementasikan (implementing): menggunakan cara

    yangtelahadauntukmenyelesaikantugasyangbelumdikenal

    sebelumnya

    d)Menganalisis(C4)

    Memutuskan suatumaterial ke dalamunsurunsur pokok

    dan menentukan bagaimana hubungan/kaitan dari satu unsur

    tersebutdenganunsuryanglaindankedalamtujuanataustruktur

    umumdarisuatumateri.Proseskognitifyangdilaluiadalah:

    (1) Membedakan (diffrentiating) atau memilih: membedakan

    bagian yang memiliki hubungan dengan bagian yang tidak

    memiliki hubungan atau memisahkan bagian yang penting

    dengan bagian yang tidak penting dari materi yang telah

    disajikan

    (2) Mengorganisir (organizing) atau menemukan hubungan,

    mengintegrasi, garis besar, uraian dan menyusun secara

    struktur: menentukan bagaimana suatu unsur atau fungsi

    sesuaidengan

    (3) Menemukanmakna tersirat (attributing): menetukan pokok

    permasalahan,bias,nilaiataumaksudtersembunyidarimateri

    yangada

    e)Evaluasi(C5)

    Membuat penilaian atau keputusan berdasarkan kriteria atau

    standar.Prosesinimeliputi:

    (1) Memeriksa (checking) atau mengkoordinasi, menemukan,

    mengawasi dan menguji: menemukan ketidaksesuaian atau

    kesalahanantaraprosesdanhasilmenentukanbahwaproses

    dan hasil memiliki kesesuaian mengawasi ketidakefektifan

    suatucaradalampenerapan.

    (2) Mengritik (critiquing) atau memutuskan: menemukan

    ketidaksesuaianantarahasildankriteriadariluar,menentukan

    bahwa hasil sesuai atau tidak, menemukan kesalahan dari

    suatucarayangmenyebabkansuatumasalah.

    f)Mencipta(C6)

    Mengambil semua unsur pokok untuk membuat sesuatu

    yang memiliki fungsi atau mengorganisasikan kembali element

    yang ada ke dalam stuktur atau pola yang baru. proses ini

    meliputi:

    (1) Merumuskan (generating): membuat hipotesis atau dugaan

    sebagai alternatif berdasarkan kriteria yang ada (misal:

    menyusun hipotesis untuk laporan dari fenomena yang telah

    diamati).

  • 5/30/2015 AgusTriCahyono:PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    http://agustricahyono.blogspot.com/2014/11/proposalskripsidesainfaktorial2x2.html 18/42

    (2)Merencanakan(planning)ataumendesain:merencanakancara

    untuk menyelesaikan tugas (misal: rencana penelitian

    dengantelaah pustaka ditulis berdasarkan topik sejarah yang

    ada).

    (3) Memproduksi (producing):menemukan ataumenghasilkan

    suatu produk ( menciptakan suatu lingkungan atau keadaan

    untuktujuantertentu).

    Untuk dapat membuat suatu penilaian, seseorang harus

    memahami,dapatmenerapkan,menganalisisdanmensintesisterlebih

    dahulu. Contoh kata kerja yang digunakan, yaitu menilai,

    menafsirkan, menaksir, memutuskan. Peneliti hanya menggunakan

    penilaian dalam ranah kognitif dengan jenjang pengetahuan (C1),

    pemahaman (C2), penerapan (C3), analisis (C4), evaluasi (C5), dan

    mencipta(C6).

    2)Ranahafektif

    Ranah afektif terdiri dari lima perilaku, yaitu

    penerimaan, partisipasi, penilaian dan penentuan sikap,

    organisasi, dan pembentukan pola hidup. Lima perilaku ranah

    afektif selanjutnya dapat dijelaskan sebagai berikut:

    a) Penerimaan, yang mencakup kepekaan tentang hal

    tertentu dan kesediaan memperhatikan hal tersebut,

    misalnya kemampuan mengakui perbedaan pendapat.

    b) Partisipasi, yang mencakup kerelaan, kesediaan

    memperhatikan, dan berpartisipasi dalam suatu kegiatan,

    misalnya mematuhi aturan, dan berpartisipasi dalam

    suatu kegiatan.

    c)Penilaian dan penentuan sikap, yang mencakup menerima

    suatu nilai, menghargai, mengakui, dan menetukan sikap.

    Misalnya menerima suatu pendapat orang lain.

    d)Organisasi, yang mencakup kemampuan membentuk suatu

    sistem nilai sebagai pedoman dan pegangan hidup.

    Misalnya menempatkan nilai dalam suatu skala nilai dan

    dijadikan pedoman bertindak secara bertanggung jawab.

    e) Pembentukan pola hidup, yang mencakup kemampuan

    menghayati nilai dan membentuknya menjadi pola nilai

    kehidupan pribadi. Misalnya kemampuan

    mempertimbangkan dan menunjukkan tindakan yang

    berdisiplin.

    Kelima jenis perilaku tersebut tampak mengandung

    tumpang tindih dan juga berisi kemampuan kognitif. Kelima

    jenis perilaku tersebut bersifat hierarkis. Perilaku penerimaan

    merupakan jenis perilaku perilaku terendah dan perilaku

    pembentukan pola hidup merupakan jenis perilaku tertinggi.

  • 5/30/2015 AgusTriCahyono:PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    http://agustricahyono.blogspot.com/2014/11/proposalskripsidesainfaktorial2x2.html 19/42

    3)Ranahpsikomotor

    Menurut Simpson dalam Dimyati dan Mudjiono

    (2006: 2930) membagi ranah psikomotor menjadi tujuh jenis

    perilaku, yaitu: persepsi, kesiapan, gerakan terbimbing,

    gerakan yang terbiasa, gerakan kompleks, penyesuaian pola

    gerakan, dan kreativitas. Tujuh perilaku dalam ranah

    psikomotor selanjutnya dijelaskan sebagai berikut:

    a) Persepsi, yang mencakup kemampuan memilahmilahkan

    (mendeskriminasikan) halhal secara khas, dan menyadari

    adanya perbedaan yang khas tersebut, misalnya pemilahan

    warna, angka 6 (enam) dan 9 (sembilan).

    b) Kesiapan, yang mencakup kemampuan penempatan diri

    dalam keadaan di mana akan terjadi suatu gerakan atau

    rangkaian gerakan. Kemampuan ini mencakup jasmani dan

    rohani, misalnya posisi start lomba lari.

    c) Gerakan terbimbing, mencakup kemampuan melakukan

    gerakan sesuai contoh, atau gerakan peniruan, misalnya

    meniru gerak tari, membuat lingkaran di atas pola.

    d)Gerakan yang terbiasa, mencakup kemampuan melakukan

    gerakan gerakan tanpa contoh, misalnya melakukan

    lompat tinggi dengan tepat.

    e) Gerakan kompleks, yang mencakup kemampuan

    melakukan gerakan atau ketrampilan yang terdiri dari

    banyak tahap, secara lancar, efisien, dan tepat, misalnya

    bongkar pasang peralatan secara tepat.

    f) Penyesuaian pola gerakan, yang mencakup kemampuan

    mengadakan perubahan dan penyesuaian pola gerakgerik

    dengan persyaratan khusus yang berlaku, misalnya

    bertanding.

    g)Kreativitas, mencakup kemampuan melahirkan pola gerak

    gerak yang baru atas dasar prakarsa sendiri, misalnya

    kemampuan membuat tari kreasi baru.

    Ketujuh jenis perilaku tersebut mengandung urutan

    taraf ketrampilan yang berangkaian. Kemampuankemampuan

    tersebut merupakan urutan fasefase dalam proses belajar

    motorik yang bersifat hierarkikal. Belajar berbagai

    kemampuan gerak dapat dimulai dengan kepekaan memilah

    milah sampai dengan kreativitas pola gerak baru. Hal ini

    menunjukkan bahwa kemampuan psikomotor mencakup

    kemampuan fisik dan mental.

    Dalampenelitian ini hasil belajar yang dimaksud adalah hasil belajar

    kognitif, afektif, dan psikomotor. Adapun penilaian dalam hasil belajar

  • 5/30/2015 AgusTriCahyono:PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    http://agustricahyono.blogspot.com/2014/11/proposalskripsidesainfaktorial2x2.html 20/42

    kognitif dengan jenjang pengetahuan (C1), pemahaman (C2), penerapan

    (C3), analisis (C4), evaluasi (C5), mencipta (C6). Hasil belajar afektif

    diperoleh dari hasil pengamatan sikap siswa selama proses pembelajaran.

    Sikap yang diamati meliputi: bekerjasama, saling menghargai, jujur, dan

    bertanggungjawab. Sedangkan hasil belajar psikomotor diperoleh dari hasil

    pengamatanselamaprosespraktikumdanmerupakanpenilaiankinerjasiswa.

    Kinerja yang diamati meliputi: mengaktifkan program PheT, membuat

    rangkaian sesuai dengan gambar, memasang sebuah Amperemeter untuk

    mengukur besar arus yang mengalir, menjalankan simulasi rangkaian,

    menambah jumlah variabel manipulasi kemudianmengamati danmencatat

    penunjukkan Amperemeter, dan mengulangi langkah sebelumnya dengan

    menggantinilaivariabelmanipulasisebanyak5kali.

    4. Pengaruh Model Pembelajaran dan Motivasi Berprestasi Terhadap Hasil

    Belajar

    Trianto (2007: 1) menyatakan bahwa model pembelajaran

    adalah suatu perencanaan atau suatu pola yang digunakan sebagai

    pedoman dalam merencanakan pembelajaran di kelas atau

    pembelajaran dalam tutorial. Model pembelajaran mengacu pada

    pendekatan yang akan digunakan, termasuk di dalamnya tujuan

    tujuan pembelajaran, tahaptahap dalam kegiatan pembelajaran,

    lingkungan pembelajaran, dan pengelolaan kelas.

    Afifuddin (2009: 34) mengatakan bahwa dalam mengajarkan suatu

    konsep atau materi tertentu, tidak ada satu model pembelajaran yang lebih

    baikdaripadamodelpembelajaranlainnya).Dengandemikianberartibahwa

    untuksetiapmodelpembelajaranharusdisesuaikandengankonsepyanglebih

    cocok dan dapat dipadukan dengan model pembelajaran yang lain untuk

    meningkatkan hasil belajar siswa. Oleh karena itu, dalam memilih suatu

    model pembelajaran harus memiliki pertimbangan pertimbangan seperti

    materi pelajaran, jam pelajaran, tingkat perkembangan kognitif siswa,

    lingkungan belajar, dan fasilitas penunjang yang tersedia sehingga tujuan

    pembelajaranyangtelahditetapkandapattercapai.

    Hasil belajar merupakan tujuan yang hendak dicapai dalam

    proses pembelajaran. Dalam mencapai suatu tujuan seseorang akan

    berusaha semaksimal mungkin. Adanya tujuan yang jelas akan

    mempengaruhi timbulnya kebutuhan kebutuhan, dan ini akan

    mendorong timbulnya motivasi dalam diri siswa. Terkait dengan

    pencapaian prestasi, adanya motivasi berprestasi dalam diri siswa

    dalam diri siswa akan merangsang dirinya meraih prestasi secara

    optimal. Terkait motivasi, menurut McClelland dalam Afifuddin

    (2008) mengemukakan bahwa seseorang mempunyai motivasi untuk

    bekerja karena adanya kebutuhan untuk berprestasi. Motivasi di sini

    merupakan fungsi dari tiga variabel, yaitu: a) harapan untuk

    melakukan tugas dengan berhasil, b) persepsi tentang nilai tugas

  • 5/30/2015 AgusTriCahyono:PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    http://agustricahyono.blogspot.com/2014/11/proposalskripsidesainfaktorial2x2.html 21/42

    tersebut, dan c) kebutuhan untuk keberhasilan atau sukses.

    Kebutuhan untuk berprestasi bersifat intrinsik dan relatif

    stabil. Orang yang mempunyai motivasi berprestasi tinggi ingin

    menyelesaikan tugas dan meningkatkan keterampilan mereka.

    Mereka ini berorientasi kepada tugas dan masalahmasalah yang

    memberikan tantangan, dimana penampilan mereka dapat dinilai dan

    dibandingkan dengan suatu patokan atau dengan penampilan orang

    lain. Orang seperti ini menginginkan adanya umpan balik mengenai

    penampilannya.

    Siswa dengan motivasi berprestasi tinggi selalu memilih

    bekerja untuk tugastugas yang mempunyai derajat tantangan yang

    sedangsedang karena mereka menginginkan adanya keberhasilan.

    Mereka tidak menyenangi tugas yang mudah dan tidak memberikan

    tantangan. Sebaliknya untuk melakukan tugastugas yang sangat sulit

    mereka tidak mau apabila mereka yakin bahwa tugas tersebut sulit

    untuk dilaksanakan. Dengan demikian terlihat bahwa di dalam

    bekerja mereka tidak bersifat untunguntungan, dan semua tujuan

    mereka adalah realistis. Apabila berhasil, mereka akan meningkatkan

    aspirasinya sehingga dapat meningkat ke tugas yang lebih sulit. Siswa

    dengan motivasi berprestasi rendah sebaliknya mau memilih tugas

    tugas yang sangat mudah atau sangat sulit. Apabila tugas sangat

    mudah dengan sendirinya mereka akan dapat melakukannya dengan

    baik, sebaliknya kegagalan di dalam melaksanakan tugas yang sangat

    sulitpun tidak mempunyai arti apaapa bagi mereka karena sejak

    semua mereka telah tahu akan gagal. Di sini terlihat bahwa di dalam

    menentukan tujuan mereka tidak realistis.

    Dari uraian di atas dapat disimpulkan bahwa motivasi

    berprestasi merupakan dorongan untuk berbuat sebaik mungkin, agar

    memperoleh hasil yang terbaik dengan kondisi yang diharapkan.

    Motivasi berprestasi merupakan pendorong bagi siswa untuk berbuat

    sebaikbaiknya dengan tujuan mencapai hasil belajar yang setinggi

    tingginya.

    5.TinjauanUmumMatapelajaranDasardanPengukuranListrik

    Mata pelajaran dasar dan pengukuran listrikmerupakan salah satu

    programkompetensikejuruanyangwajibdiikutiolehsiswakelasXdiSMK

    Negeri 7 Surabaya, Program Keahlian Teknik Ketenagalistrikan. sub

    kompetensi yang akan dibahas yaitu menganalisis rangkaian listrik arus

    bolakbalikdiantaranyarangkaianRL,RC,RLC.

    Gambaranmateriatausilabusmatapelajarandasardanpengukuran

    listrik yaitu: (a) dasar dan pengukuran listrik arus bolakbalik. (b)

    Menganalisis rangkaian kemagnetan. Pokok bahasan yang diambil: (a)

    RangkaianseriRL,RC,danRLC.(b)RangkaianparalelRL,RC,danRLC.

    Materiyangakandisampaikanadalahsebagaiberikut:

  • 5/30/2015 AgusTriCahyono:PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    http://agustricahyono.blogspot.com/2014/11/proposalskripsidesainfaktorial2x2.html 22/42

    a.RangkaianSeriRL

    1)PengertianrangkaianRL

    2)Rumusmencaritegangan

    3)Rumusmencariarus

    4)Rumusmencariimpedansi

    5)Rumusreaktansiinduktor

    6)Segitigadaya

    b.RangkaianSeriRC

    1)PengertianrangkaianRC

    2)Rumusmencaritegangan

    3)Rumusmencariarus

    4)Rumusmencariimpedansi

    5)Rumusreaktansikapasitor

    6)Segitigadaya

    c.RangkaianSeriRLC

    1)PengertianrangkaianseriRLC

    2)SifatsifatpadarangkangaianseriRLC

    3)Rumustegangan,arusdanimpedansi,dan

    4)Segitigatahanan

    B.PenelitianyangRelevan

    Di bawah ini akan disajikan beberapa hasil penelitian yang

    relevan dengan penelitian ini. Hasil penelitian pendukung yang

    dimaksud yaitu hasil penelitian penerapan model pembelajaran

    kooperatif tipe TAI.

    1. Hasil penelitian yang dilakukan Hafid (2012) yang membandingkan

    perbedaan hasil belajar menggunakan model pembelajaran

    kooperatif tipe TAI dan model pembelajaran langsung dengan hasil

    pelaksanaan pembelajaran dengan model kooperatif hasilnya lebih

    baik dibandingkan model pembelajaran langsung.

    2. Hasil penelitian yang dilakukan Farikah (2011) yang membandingkan

    pengaruh hasil belajar matematika pada materi faktorisasi suku

    aljabar menggunakan model pembelajaran kooperatif tipe TAI dan

    pembelajaran konvensional dengan hasil pelaksanaan pembelajaran

    dengan model kooperatif tipe TAI hasilnya lebih baik dibandingkan

    pembelajaran konvensional.

    3. Hasil penelitian yang dilakukan Ratri (2012) yang membandingkan

    perbedaan hasil belajar menggunakan model pembelajaran

    kooperatif tipe TAI dan model pembelajaran langsung pada standar

    kompetensi merawat peralatan rumah tangga listrik dengan hasil

    pelaksanaan pembelajaran dengan model kooperatif hasilnya lebih

    baik dibandingkan model pembelajaran langsung.

  • 5/30/2015 AgusTriCahyono:PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    http://agustricahyono.blogspot.com/2014/11/proposalskripsidesainfaktorial2x2.html 23/42

    C.KerangkaBerpikir

    Berdasarkan rumusan masalah, landasan teori dan kerangka berpikir

    penelitiandiatasmakaterdapattigakerangkaberpikiryangdiajukan,yaitu:

    1.Pengaruh penggunaan model pembelajaran langsung dan model

    pembelajaran kooperatif tipe TAI terhadap hasil belajar dasar

    dan pengukuran listrik

    Dalam penerapan model pembelajaran kooperatif tipe Team

    Assisted Individualization (TAI), setiap anggota kelompok

    bertanggung jawab untuk mempelajari bagian yang telah diberikan

    kepadanya. Setiap anggota kelompok diberi tugas untuk menjadi

    seorang pakar dalam beberapa aspek yang bersumber dari bahan

    bacaan tersebut. Dari masingmasing pakar berusaha mendiskusikan

    bahan bacaan tersebut kemudian mengajarkan kepada anggota

    kelompoknya. Satusatunya cara siswa dapat belajar subbab lain

    selain dari subbab yang mereka pelajari adalah dengan

    mendengarkan secara sungguhsungguh terhadap penjelasan teman

    satu kelompok mereka. Keberhasilan kelompok diyakini bergantung

    pada adanya saling ketergantungan anggota kelompok dan

    pembagian tugas. Setelah selesai pertemuan dan diskusi kelompok

    asal, siswa dikenai kuis secara individu tentang materi pelajaran.

    Adapun kelebihan model pembelajaran kooperatif tipe TAI,

    yaitu: (a) Setiap anggota dapat saling melengkapi dan membantu

    menyelesaikan setiap materi yang diterima, (b) anggota kelompok

    memiliki pemikiran yang berbedabeda sehingga pemikirannya

    menjadi luas dan mampu melihat dari sudut pandang lain untuk

    melengkapi jawaban yang lain, (c) Peseta didik dapat lebih mudah

    memahami materi yang disampaikan karena bekerja sama dengan

    temantemannya, (d) memupuk rasa pertemanan dan solidaritas

    sehinnga diantara anggotanya akan terjadi hubunganyang positif,

    (e) setiap kelompok merasa memiliki tanggung jawab bersama

    untuk membuat anggota lain memahami materi.

    Sedangkan kekurangan dari model pembelajaran kooperatif

    tipe TAI, yaitu: (a) Terdapat anggota yang lebih mendominasi

    kelompok dan aday yang hanya diam, sehingga pembagian tugas

    tidak merata, (b) apabila kelompoknya tidak dapat bekerja sama

    dengan baik maka akan terjadi perselisihan karena adanya berbagai

    perbedaan yang dapat menyebabkan perselisihan, (c) sebagian

    pengetahuan didapat dari teman dan yang menerangkan, maka

    terkadang sulit untuk dimengerti, (d) pembelajaran

    memerlukanwaktu yang cukup lama sebab harus saling berdiskusi

    bersama temanteman lain untuk menyatukan pendapat dan

    pandangan yang dianggap benar.

  • 5/30/2015 AgusTriCahyono:PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    http://agustricahyono.blogspot.com/2014/11/proposalskripsidesainfaktorial2x2.html 24/42

    Pada model pembelajaran lain yang digunakan peneliti

    dalam penelitian ini adalah model pembelajaran langsung. Model

    pembelajaran langsung merupakan suatu pendekatan mengajar

    yang dapat membatu siswa mempelajari keterampilan dasar dan

    memperoleh informasi yang dapat diajarkan selangkah demi

    selangkah. Adapun beberapa kelebihan dalam model pembelajaran

    langsung, yaitu: (a) guru menguasai kelas, (b) dapat diikuti oleh

    jumlah siswa yang besar, (c) mudah mempersiapkan dan

    melaksanakannya, (d) mudah mengorganisasikan tempat

    duduk/kelas.

    Namun kekurangan model pembelajaran langsung, yaitu: (a)

    membosankan bagi peserta didik, (b) menyebabkan siswa menjadi

    pasif, (c) mudah/cepat lupa, (d) kurang merangsang kreativitas

    siswa, (e) sulit mengetahui apakah siswa mengerti/tidak, (f)

    bersifat verbalisme.

    Berdasarkan kelebihan dan kekurangan masingmasing model

    pembelajaran, apabila dihubungkan dengan mata pelajaran Dasar

    dan Pengukuran Listrik, maka diduga model pembelajaran

    kooperatif tipe Team Assisted Individualization (TAI) lebih tepat

    digunakan pada mata pelajaran tersebut karena mata pelajaran

    Dasar dan Pengukuran Listrik merupakan pelajaran Produktif.

    Hal tersebut dikarenakan adanya tanggung awab bersama

    yang diemban oleh setiap kelompok agar seluruh anggota kelompok

    tersebut dapat memahami matei ajar. Sehingga komunikasi antar

    siswa lebih intensif dan materi lebih mudah dampai pada siswa

    yang dianggap memiliki kemampuan rendah. Untuk mengatasi

    kelemahan model pembelajaran kooperatif tipe TAI ini guru harus

    mengarahkan setiap kelompok agar dapat berkordinasi dengan baik.

    2. Pengaruh antara motivasi berprestasi siswa terhadap hasil

    belajar dasar dan pengukuran listrik

    Salah satu faktor yang mempengaruhi hasil belajar siswa

    adalah motivasi. Dengan adanya motivasi, siswa akan belajar lebih

    keras, ulet, tekun dan memiliki dan memiliki konsentrasi penuh

    dalam proses belajar pembelajaran. Sedangkan motivasi berprestasi

    merupakan dorongan yang berhubungan dengan prestasi, yaitu: 1)

    menguasai, 2) memanipulasi atau mengorganisir lingkungan sosial

    maupun fisik, 3) mengatasi rintanganrintangan dan memelihara

    kualitas kerja yang tinggi, dan 4) bersaing dengan ukuran

    keunggulan. Motivasi berprestasi yang dimiliki siswa dalam setiap

    kegiatan pembelajaran sangat berperan untuk meningkatkan hasil

    belajar siswa. Siswa yang bermotivasi tinggi dalam belajar

    memungkinkan akan memperoleh hasil belajar yang tinggi pula,

    artinya semakin tinggi motivasinya, semakin intensitas usaha dan

  • 5/30/2015 AgusTriCahyono:PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    http://agustricahyono.blogspot.com/2014/11/proposalskripsidesainfaktorial2x2.html 25/42

    upaya yang dilakukan, maka semakin tinggi prestasi belajar yang

    diperolehnya, sebaliknya apabila motivasi belajar rendah atau

    tiadanya motivasi belajar akan melemahkan kegiatan, sehingga

    memungkinkan hasil belajar akan rendah pula.

    Berdasarkan uraian tersebut, diduga hasil belajar siswa yang

    bermotivasi tinggi lebih tinggi daripada hasil belajar siswa

    yangbermotivasi rendah.

    3.Interaksi antara penggunaan model pembelajaran dan motivasi

    berprestasi siswa terhadap hasil belajar.

    Motivasi berprestasi siswa yang tinggi akan lebih siap dan

    sanggup untuk mengikuti pelajaran berikutnya dan diharapkan akan

    mencapai hasil belajar yang lebih tinggi. Namun jika pembelajaran

    dengan menggunakan model pembelajaran kooperatif tipe TAI serta

    motivasi berprestasi siswa disertakan dalam mendesain proses

    pembelajaran, ada dugaan bahwa terdapat interaksi pengaruh

    terhadap pencapaian hasil belajar siswa.

    Penerapan model pembelajaran kooperatif tipe TAI dengan

    mempertimbangkan motivasi berprestasi siswa akan dapat

    mengoptimalkan siswa dalam mencapai prestasi. Dengan

    menggunakan model pembelajaran kooperatif tipe TAI siswa lebih

    prospektif tentang belajar dan perspektif tentang kerja sama.

    Siswa dapat mengembangkan pemahaman dan penghayatan akan

    prinsipprinsip dan nilainilai ilmiah dalam rangka menumbuhkan

    daya nalar, cara berfikir logis, sistematis dan kreatif, kecerdasan

    serta sikap kritis, terbuka dan rasa ingin tahu.

    Pembelajaran menggunakan model pembelajaran kooperatif

    tipe TAI disertai motivasi berprestasi siswa yang tinggi akan lebih

    memudahkan siswa belajar dan berinteraksi lebih positif sehingga

    akan mampu meningkatkan hasil belajarnya. Sedangkan pada siswa

    yang memiliki motivasi berprestasi rendah akan terbantu dengan

    siswa lain yang memiliki motivasi berprestasi tinggi untuk mencapai

    hasil belajar yang lebih tinggi. Hal ini dikarenakan model

    pembelajaran kooperatif tipe TAI mengandalkan kerja sama tim

    sehingga mampu menciptakan kegiatan belajar yang

    menyenangkan.

    Penggunaan model pembelajaran langsung pada siswa

    dengan motivasi berprestasi tinggi diduga akan menghasilkan hasil

    belajar tinggi. Hal ini disebabkan karena siswa yang memiliki

    motivasi berprestasi tinggi akan memiliki semangat dan kemauan

    yang lebih dari pada siswa yang memiliki motivasi berprestasi

    rendah. Sedangkan model pembelajaran langsung yang diterapakan

    pada siswa yang memiliki motivasi berprestasi rendah diduga hasil

    belajarnya lebih rendah. Hal ini disebakan siswa yang memiliki

  • 5/30/2015 AgusTriCahyono:PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    http://agustricahyono.blogspot.com/2014/11/proposalskripsidesainfaktorial2x2.html 26/42

    motivasi berprestasi rendah cenderung untuk mengalami kebosanan

    dan membutuhkan suntikan motivasi lain yang dapat meningkatkan

    semangat dan motivasi belajarnya.

    D.RumusanHipotesis

    1.Hasilbelajarsiswayangdibelajarkandenganmodelpembelajarankooperatif

    tipeTAI lebih tinggidaripadahasilbelajar siswayangdibelajarkandengan

    model pembelajaran langsung pada mata pelajaran dasar dan pengukuran

    listrik

    2. Hasil belajar siswayangmemilikimotivasi berprestasi tinggi lebih tinggi

    daripadahasilbelajarsiswayangmemilikimotivasiberprestasi rendahpada

    matapelajarandasardanpengukuranlistrik

    3. Terdapat interaksi antara model pembelajaran dan motivasi berprestasi

    terhadap hasil belajar siswa pada mata pelajaran dasar dan pengukuran

    listrik?

    BABIII

    METODEPENELITIAN

    A.RancanganPenelitian

    Penelitian ini dilakukan dengan metode quasi eksperimen dengan

    harapan banyak memberikan manfaat terutama untuk menentukan model

    pembelajaran dalam suatu proses pembelajaran. Alasan penggunaan metode

    quasieksperimendalamkelompoktersebutadalahmasihbanyakvariabeldalam

    kelompok yang belum bisa dikontrol oleh peneliti. Kelompok dalam sampel

    penelitian adalah kelompok kelas yang sudah terbentuk sesuai dengan

    pembagian menjadi kelas eksperimen dan kelas kontrol. Kelas eksperimen

    adalah kelas yang dibelajarkan dengan menggunakan model pembelajaran

    langsung, sedangkan kelas kontrol adalah kelas yang dibelajarkan dengan

    menggunakanmodelpembelajarankooperatiftipeTAI.

    Rancangan eksperimen yang digunakan penelitian ini dengan desain

    faktorial2x2,mempunyaiduavariabelbebasdansatuvariabelterikat.Variabel

    bebaspertama(variabelperlakuan)adalahmodelpembelajaran,variabelbebas

    kedua (variabel atribut) adalah motivasi berprestasi, sedang variabel terikat

    adalahhasilbelajar.

    Variabel bebas terdiri dariModelPembelajaranLangsung (MPL) (A1)

    danmodelpembelajarankooperatif tipeTeamAssistedIndividualization(TAI)

    (A2). Variabel moderator terdiri dari motivasi berprestasi rendah (B1) dan

    motivasiberprestasitinggi(B2).Tabel3.1menunjukkanrancanganeksperimen

    dengandesainfaktorial2x2.

    Tabel3.2.DesainFaktorial2x2Modelpembelajaran

    MPL(A1)

    TAI(A2)

    Motivasi Rendah(B1) 16 16

  • 5/30/2015 AgusTriCahyono:PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    http://agustricahyono.blogspot.com/2014/11/proposalskripsidesainfaktorial2x2.html 27/42

    berprestasi Tinggi(B2) 16 16TOTAL 32 32

    Sumber:Dantes(2012:100)

    B.VariabelVariabelPenelitiandanDefinisiOperasional

    1.VariabelPenelitian

    Penelitian ini melibatkan bebarapa variabel yang dapat

    dikelompokkansebagaiberikut.

    a.Variabelbebas

    Variabelbebasmerupakanvariabelyangdalampenelitian ini tidak

    tergantungpadanilaivariabellain.Variabelbebasdalampenelitianini

    adala model pembelajaran yang diterapkan kepada siswa. Model

    pembelajaranyangpertamaadalahmodelpembelajarankooperatiftipe

    TAI yang diterapkan pada kelompok kelas eksperimen. Model

    pembelajan yang kedua adalah model pembelajaran langsung yang

    diterapkanpadakelompokkelaskontrol.

    b.Variabelterikat

    Variabel terikat adalah variabel yang dipengaruhi atau menjadi

    akibat,karenaadanyavariabelbebas.Variabelterikatdalampenelitian

    iniadalahhasilbelajarsiswa.

    c.Variabelmoderator

    Variabelmoderatormerupakanvariabelyangdianggapberpengaruh

    terhadapvariabel terikat, tetapi dianggap tidak mempunyai pengaruh

    utama. Variabel moderator dalam penelitian ini adalah motivasi

    berprestasi.

    2.DefinisiOperasionalVariabel

    a.Definisioperasionalvariabelbebas

    1)Modelpembelajaranlangsungakanditerapkanpadakelaskontrol.

    Model langsung adalah salah satu pendekatan mengajar yang

    dirancang khusus untuk menunjang proses belajar siswa yang

    berkaitan dengan pengetahuan deklaratif dan pegetahuan

    prosedural yang terstruktur dengan baik. Adapun fase dalam

    pembelajaran langsung, yaitu: a) menyampaikan tujuan dan

    mempersiapkan siswa, b) mendemonstrasikan pengetahuan dan

    keterampilan,c)membimbingpelatihan,d)mengecekpemahaman

    dan memberikan umpan balik, dan e) memberikan kesempatan

    pelatihan lanjutan dan penerapan memberikan kesempatan

    pelatihanlanjutandanpenerapan.

    2) Model pembelajaran kooperatif tipe Team Assisted

    Individualization (TAI)diterapkanpadakelaseksperimen.Model

    pembelajaran ini merupakan pengembangan kodel pembelajaran

    kooperatif yang mengombinasikan keunggulan pembelajaran

    kooperatif dan individual. Dalam model ini terdapat komponen

    penting, yaitu: teams, yaitu teams, placement test, creative, team

    study,teamscoresandteamrecognition,teachinggroup,factstest,

  • 5/30/2015 AgusTriCahyono:PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    http://agustricahyono.blogspot.com/2014/11/proposalskripsidesainfaktorial2x2.html 28/42

    whole class units. Adapun sintaks dalam model pembelajajaran

    kooperatif tipe TAI, yaitu: a) menyampaikan tujuan dan

    establishing set, b) mempresentasikan informasi, c)

    mengorganisasikan siswakedalam timtimbelajar, d)membantu

    kerjatimdanbelajar,e)mengujikanberbagaimateri,danf)

    memberikanpenghargaan.

    b.Definisioperasionalvariabelterikat

    Definisi operasional hasil belajar padapenelitian ini adalah hasil

    yangdicapaiolehsiswamelaluiprosespembelajaranyangdapatdiukur

    melalui posttest (kognitif) dan pengamatan (afektif dan psikomotor).

    Adapunpencapaian hasil belajar yang diukur yaitumencakup bidang

    kognitif, yaitu meliputi: aspek pengetahuan (C1), aspek pemahaman

    (C2),aspekpenerapan (C3),aspekanalisis (C4),aspekevaluasi (C5),

    dan aspek penciptaan (C6). Hasil belajar afektif diperoleh dari hasil

    pengamatan sikap siswa selama proses pembelajaran. Sikap yang

    diamati meliputi: bekerjasama, saling menghargai, jujur, dan

    bertanggungjawab.Sedangkanhasil belajar psikomotor diperolehdari

    hasilpengamatanpadasiswaselamaprosespraktikumdanmerupakan

    penilaian kinerja siswa selama mengikuti praktikum. Kinerja yang

    diamatimeliputi: : mengaktifkan program PheT, membuat rangkaian

    sesuai dengan gambar, memasang sebuah Amperemeter untuk

    mengukurbesararusyangmengalir,menjalankan simulasi rangkaian,

    menambah jumlah variabel manipulasi kemudian mengamati dan

    mencatat penunjukkan Amperemeter, dan mengulangi langkah

    sebelumnya dengan mengganti nilai variabel manipulasi sebanyak 5

    kali.

    c.Definisioperasionalvariabelmoderator

    Definisi motivasi berprestasi siswa pada penelitian ini

    adalah diukur dengan menggunakan angket motivasi

    berprestasi. Setelah itu dikelompokkan menjadi dua macam

    yaitu motivasi berprestasi tinggi dan motivasi rendah, tidak

    dimanipulasi secara eksperimental, tetapi dimasukkan dalam

    desain penelitian. Motivasi berprestasi merupakan dorongan

    siswa untuk bersaing dalam upaya mencapai standar

    keunggulan, mencapai hasil yang sebaik baiknya dalam

    mencapai tujuan. Beberapa indikator motivasi berprestasi

    adalah keinginan mencapai hasil yang optimal, yaitu: a)

    dorongan untuk selalu maju dalam menekuni pelajaran dasar

    dan pengukuran listrik, b) dorongan untuk selalu mendapat

    nilai baik, c) dorongan untuk menyelesaikan tugastugas

    pelajaran dasar dan pengukuran listrik, dan d) kesungguhan

    siswa dalam merespon mata pelajaran dasar dan pengukuran

    listrik. Indikator yang kedua adalah keinginan untuk

  • 5/30/2015 AgusTriCahyono:PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    http://agustricahyono.blogspot.com/2014/11/proposalskripsidesainfaktorial2x2.html 29/42

    meningkatkan pengetahuan, yaitu: a) dorongan untuk membaca

    dan mengerjakan soalsoal, b) dorongan untuk mengajukan

    pertanyaan tentang halhal yang belum jelas, dan c) dorongan

    untuk membaca buku baru. Sedangkan indikator yang ketiga

    adalah rasa percaya diri dan kepuasan, yaitu: a) dorongan

    untuk menguasai materi materi pembelajaran secara mandiri,

    b) memiliki kepuasan dalam mengikuti proses pembelajaran, c)

    adanya keinginan umpan balik dalam pembelajaran.

    C.TempatdanWaktuPenelitian

    PenelitianinidilaksanakandiSMKNegeri7Surabayapadasiswakelas

    X Teknik Instalasi Pemanfaatan Tenaga Listrik (TIPTL) tahun ajaran

    2013/2014.Waktu penelitian dilaksanakan pada semester genap tahun ajaran

    2013/2014.

    D.ProsedurPenelitian

    Prosedurpenelitianyangdirencanakanmeliputi:

    1.Tahappersiapanpembelajaranmeliputi:

    a.Surveidanwawancara.

    b.Menyusunproposalpenelitian,menyusuninstrumenpenelitian.

    c.Menyusunperangkatpembelajaran.

    d.Validasiperangkatdaninstrumen

    2.Tahappelaksanaanpembelajaranmeliputi:

    a.Mengukurmotivasiberprestasisiswasebelumprosespembelajaran.

    b. Kegiatan pembelajaran denganmenggunakan model pembelajaran

    kooperatiftipeTAIdanmodelpembelajaranlangsung(MPL).

    c. Eksperimen dilaksanakan selama 4 kali pertemuan atau 8 jam

    pelajaran. Pada model pembelajaran kooperatif tipe TAI meliputi

    langkahlangkah apersepsi dan motivasi, penjelasan materi,

    pembentukan kelompok, pembentukan kelompok ahli, diskusi

    kelompok ahli, diskusi kelompok asal, presentasi kelompok, kuis.

    Sedangkan pada Model Pembelajaran Langsung (MPL) siswa diajar

    dengan metode ceramah yang meliputi penjelasan materi dan tanya

    jawab.

    d.Tahappascaeksperimenmerupakanlangkahterakhirsetelahdiberikan

    perlakuanmakakeduakelompokdiberitesakhir.

    3.Tahappenyajianhasilpenelitian.

    Padatahapiniyangdilakukanpenelitiadalahmenganalisisdatayang

    diperolehdarihasilpenelitiandanmenyusunlaporanpenelitian.

    E.PopulasidanSampel

    4.PopulasipenelitianiniadalasiswaTIPTLSMKNegeri7Surabaya

    5. SampelkelasyangdigunakandalampenelitianiniadalahkelasXTIPTL

    SMK. Dalam penelitian ini menggunakan 2 kelas, yaitu kelas pertama

  • 5/30/2015 AgusTriCahyono:PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    http://agustricahyono.blogspot.com/2014/11/proposalskripsidesainfaktorial2x2.html 30/42

    adalahkelaskontroldankelaskeduaadalahkelas eksperimen.Dalamhal

    ini kelas diambil secara acak dari jumlah 3 kelas yaitu X TIPTL1, X

    TIPTL2 dan X TIPTL3. Teknik pengambilan sampel dilakukan

    menggunakantekniksimplerandomsampling.

    F.InstrumenPenelitian

    Penyusunan instrumendalampenelitian inimengacupadadimensidan

    indikator hasil belajar siswa kelas X TIPTL SMK Negeri 7 Surabaya.

    Instrumen penelitian adalah alat yang digunakan oleh peneliti dalam

    mengumpulkan data agar pekerjaanya lebih mudah dan hasilnya lebih baik,

    dalamarti lebih cermat, lengkapdan sistematis sehingga lebihmudahdiolah

    (Arikunto, 2010: 203). Adapun instrumen penelitian yang digunakan dalam

    penelitianiniada3buahinstrumenyangdigunakanyaitu:(1)lembarvalidasi

    (2) lembarangketmotivasiberprestasidan(3) lembarpenilaianhasil belajar

    afektif, dan psikomotor. Instrumen yang digunakan untuk memperoleh data

    dalampenelitianiniada3macam,yaitu:

    1.Lembarvalidasi

    Lembar validasi digunakan untuk mengukur efektivitas atau

    ketepatan instrumen yang digunakan dalam suatu penelitian (Sugiyono,

    2008: 129).Dalampenelitian ini yang instrumenyang divalidasi sebelum

    diujicobakan adalah perangkat pembelajaran dan soal posttest. Adapun

    perangkatpembelajaranpenelitianiniadalahsilabus,RencanaPelaksanaan

    Pembelajaran (RPP), Lembar Kerja Siswa (LKS), buku siswa. Adapun

    perangkat pembelajaran yang divalidasi ahli adalahRPP dan buku siswa.

    Sedangkanuntuksoalposttestdivalidasiolehahlimateri.Dalampenelitian

    ini uji validitas digunakan untuk menguji sejauh mana perangkat

    pembelajaran yang dikembangkan dapat digunakan sebagai salah satu

    media pembelajaran, sehingga dapat diketahui tingkat kebenaran dan

    ketepatan penggunaan perangkat pembelajaran tersebut Kisikisi yang

    digunakan untuk uji validitas yangmeliputi lembar lembar validasi RPP,

    lembarvalidasibukusiswa,danlembarvalidasisoalposttest.

    a.LembarvalidasiRencanaPelaksanaanPembelajaran(RPP)

    Rencana pelaksanaan pembelajaran, yaitu panduan langkah

    langkahyang akan dilakukan oleh guru dalamkegiatan pembelajaran

    yang disusun dalam skenario kegiatan. Pada penelitian ini peneliti

    membuat RPP pada setiap tatap muka dengan tujuan agar kegiatan

    pembelajaran bersifat sistematis sehingga perlu adanya validasi oleh

    ahli perangkat pembelajaran. Tabel 3.3 merupakan lembar validasi

    rencanapelaksanaanpembelajaran.

    Tabel3.3.Lembarvalidasirencanapelaksanaanpembelajaran

    Faktor/Aspek IndikatorJumlah

    pertanyaanNomor

    Pertanyaan

    1.KompetensiDasar

    Kesesuaianrumusankompetensidasardengansilabusyangsudahada.

    1 1a

    Kesesuaiankompetensidasardenganperkembangansiswa 1 1b

  • 5/30/2015 AgusTriCahyono:PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    http://agustricahyono.blogspot.com/2014/11/proposalskripsidesainfaktorial2x2.html 31/42

    2.Indikator Kesesuaianindikatordengankompetensidasaryangsudahada.

    1 2a

    Kesesuaianrumusanpencapaianhasilbelajar 1 2b

    3.TujuanPembelajaran

    Tujuanpembelajaransesuaidenganindikatoryangada. 1 3

    4.Materipembelajaran

    Relevansimateridengankompetensidasarpembelajaran.

    1 4a

    Urutanpenyajianmateridikelompokkandalambagianbagianyanglogis(keterkaitantopik,subtopik,danpenyajiansistematis).

    1 4b

    Kesesuaiantugas/latihansoalyangmendukungkonsep. 1 4c

    5.AlokasiWaktu

    Kesesuaianalokasiwaktudengancakupanmateri. 1 5

    6.Sumber&saranabelajar

    Kesesuaiandengankompetensiyangingindicapai.

    1 6a

    KesesuaianLP1dengantujuanpembelajaran. 1 6b

    KesesuaianLP2dengantujuanpembelajaran. 1 6c

    KesesuaianLP3dengantujuanpembelajaran. 1 6d

    KesesuaianLP4dengantujuanpembelajaran. 1 6e

    KesesuaianLP5dengantujuanpembelajaran. 1 6f

    Kesesuaianformatpenilaiandengantujuanpembelajaran. 1 6g

    7.KegiatanBelajarMengajar

    Kesesuaianlangkahpembelajarandenganmetodepembelajaran.

    1 7a

    KetepatanmetodepembelajarandenganKD. 1 7b

    8.Bahasa Kebenarantatabahasayangdigunakan,sesuaidengankaidahbahasaIndonesiayangbaku.

    1 8a

    BahasasesuaiEYD. 1 8bKesederhanaanstrukturkalimat. 1 8c

    Sifatkomunikatifbahasayangdigunakan. 1 8d

    9.Format Kejelasanpembagianmateri. 1 9aKesesuaianjenisdanukuranhurufyangdigunakan. 1 9b

    Catatan:InstrumeninidiadaptasikandariArif,2012.

    b.Lembarvalidasibukusiswa

    Buku iniberisiuraianmateriyangmendukung lembarkegiatan

    siswa tentang menganalisis rangkaian listrik arus bolak balik. Buku

    siswa perlu divalidasi oleh ahli materi rangkaian listrik karena

    kesesuaianmateri tersebut akanmempengaruhi asil belajar.Tabel3.4

    berikutmerupakanlembarvalidasibukusiswa.

    Tabel3.4.Lembarvalidasibukusiswa

    Faktor/Aspek Indikator JumlahPertanyaanNomor

    Pertanyaan1.Perwajahan

    dantataletakWajahsampulbukusiswamemilikidayatarik. 1 1a

    Gambarsampulmenggambarkanisimodul. 1 1b

    Hurufdangambarditatadenganbaikdanrapi. 1 1c

    2.Materibukusiswa

    Teksbukusiswadapatterbaca. 1 2a

    Materiyangdisajikansesuaidengantingkatpikirsiswa.

    1 2b

    Tingkatkebenarankonsepmateridalambukusiswa. 1 2c

    Teksdangambarsalingterkait. 1 2d

  • 5/30/2015 AgusTriCahyono:PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    http://agustricahyono.blogspot.com/2014/11/proposalskripsidesainfaktorial2x2.html 32/42

    Obyekgambarsesuaimateri.

    1 2e

    Obyekgambarjelasatautidakkabur. 1 2f

    Informasipadabukusiswacukupmemadai. 1 2g

    3.Bahasa Bahasamudahdipahami. 1 3aBahasasesuaiEYD. 1 3bSifatkomunikatifbahasayangdigunakan 1 3c

    Catatan:InstrumeninidiadaptasikandariArif,2012.

    c.Lembarvalidasisoalposttest

    Soalposttestmerpakanbagianpentingdalampenelitianinikarena

    sebagai instrumen untuk mengukur hasil belajar kognitif siswa

    sehingga, soal tersebut sebelum diujikan perlu di validasi oleh ahli

    evaluasi.AdapunlembarvalidasisoalposttestditunjukkanpadaTabel

    3.5berikutini.Tabel3.5.Lembarvalidasisoalposttest

    Faktor/Aspek Indikator JumlahpertanyaanNomor

    pertanyaan

    1.Materi Soalsesuaidenganindikatoryangada 1 1a

    Materiyangditanyakansesuaidengankompetensi

    1 1b

    Hurufdangambarditatadenganbaikdanrapi. 1 1c

    Tingkatkesulitansoal 1 1d2.Konstruksi Soaldirumuskandengan

    singkat,jelas,dantegas. 1 2a

    Rumusanpokoksoaldanpilihanjawabanmerupakanpernyataanyangdiperlukansaja.

    1 2b

    Soaltidakmemberipetunjukkuncijawaban. 1 2c

    Pilihanjawabanhomogendanlogisditinjaudarisegimateri.

    1 2d

    Gambarjelasdanberfungsi. 1 2e

    Panjangpilihanjawabanrelatifsama. 1 2f

    3.Bahasa MenggunakanbahasayangsesuaidengankaidahbahasaIndonesia

    1 3a

    Menggunakanbahasayangkomutatif. 1 3b

    Catatan:InstrumeninidiadaptasikandariArif,2012.

    2.Instrumenvariabelmotivasiberprestasi

    Instrumen variabelmotivasi berprestasi merupakan instrumen yang

    diguanakan untuk mengetahi tingkat motivasi berprestasi siswa terhadap

    mata pelajaran dasar dan pengukuran listrik. Pengumpulan data yang

    motivasi berprestasi menggunakan teknik angket, yaitu angket motivasi

    berprestasi pada mata pelajaran dasar dan pengukuran listrik. Instrumen

    angket berbentuk skala karena skala merupakan seperangkat nilai angka

    yang telah ditetapkan kepada tingkah laku untuk mengukur motivasi

    berprestasisiswapadamatapelajarandasardanpengukuranlistrik.

  • 5/30/2015 AgusTriCahyono:PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    http://agustricahyono.blogspot.com/2014/11/proposalskripsidesainfaktorial2x2.html 33/42

    Motivasi berprestasi siswa terhadap mata pelajaran dasar dan

    pengukuran listrik merupakan skor yang diperoleh siswa setelah siswa

    mengisiangketmotivasiberprestasiyangberbentukskaladenganrentangan

    angka1sampai5.

    Untukkisikisiangketmotivasiberprestasisiswapadamatapelajaran

    dasar danpengukuran listrik disusunberdasarkan indikatorindikator pada

    kajian teori. Tabel 3.6 merupakan Kisikisi penyusunan angket motivasi

    berprestasi.

    Tabel 3.6. Kisikisi penyusunan angket motivasi berprestasiNo Aspek yangdiukur Indikator Motivasi

    Komponen sikap Total(%)Positif Negatif

    1 Keinginanmencapaihasil yangoptimal

    1.Dorongan untukselalu maju dalammenekuni pelajaran.

    2.Dorongan untukselalu mendapatkannilai baik.

    3.Dorongan untukmenyelesaikan tugastugas dasar danpengukuran listrik.

    4.Kesanggupan siswadalam meresponmata pelajaran dasardan pengukuranlistrik.

    2 Keinginanuntukmeningkatkanpengetahuan

    1.Dorongan untukmembaca danmengerjakan soalsoal dasar danpengukuran listrik.

    2.Dorongan untukmengajukanpertanyaan tentanghalhal yang belumjelas.

    3.Dorongan untukmembaca buku baru.

    3 Rasa percayadiri dankepuasan

    1.Dorongan untukmenguasai materipembelajaran secaramandiri.

    2.Mengikuti kepuasandalam mengikutiproses pembelajaran.

    3.Adanya keinginanumpan balik dalampembelajaran.

    Total(%)

    25(50%)

    25(50%)

    50(100%)

    Catatan:InstrumeninidiadaptasikandariAfifuddin,2012.

    3.Lembarpenilaianhasilbelajar

    Lembar instrumen penilaian hasil belajar digunakan untuk

    mengetahuihasilbelajar siswapadamatapelajarandasar danpengukuran

    listrik.Adapun lembar penilaian hasil belajar yang dibutuhkanmencakup

    tigaranahhasilbelajar,yaitu:

    a.Lembarteshasilbelajarkognitif

    Metode yang digunakan untuk pengumpulan data pada hasil

    belajar kognitif adalah metode tes. Metode tes digunakan untuk

    mengumpulkan data dan mengukur penguasaan materi menganalisis

  • 5/30/2015 AgusTriCahyono:PROPOSALSKRIPSIDESAINFAKTORIAL2x2

    http://agustricahyono.blogspot.com/2014/11/proposalskripsidesainfaktorial2x2.html 34/42

    rangkaian listrik arus bolak balik. Tes disusun sesuai dengan mata

    pelajaran dasar dan pengukuran listrik pada kurikulum 2013 yang

    dibelajarkan pada siswa kelas X program studi kea