Click here to load reader

Cellink...Sett till P/B däremot, kommer Cellink till börsen med en prislapp på 4,71 x balansomslutningen. Snittet för likartade svenska bolag är 12,03, vilket ger en uppsida på

  • View
    1

  • Download
    0

Embed Size (px)

Text of Cellink...Sett till P/B däremot, kommer Cellink till börsen med en prislapp på 4,71 x...

  • 1211 1

    Rubrik Rubrik Rubrik Rubrik

    1211

    RubrikRubrikRubrikRubrik

    Futura storlekz 9.Nikan flytta varje figur var för sig.Omrubriken inte passar underfiguren kan manflytta denhur manvill.

    Skapa egen bull&bearmall:Radera bilderna från mallen och klipp och klistra indinegna tabell

    1 2

    Skriv text

    Skriv text

    Skriv text

    Skriv text

    Skriv text

    Skriv text

    Skriv text

    Skriv text

    Skriv text

    Skriv text

    Bull or Bear AnalysisAnalytiker: Eric Stussare, Erik Ivarsson

    16 Oktober 2016

    CellinkBull or Bear Analysis

  • Stor underliggande marknad med hög tillväxt ochfå aktörer. Enligt the Wise Guy Report förväntasmarknaden för 3D-Bioskrivare nästan fördubblasfram till 2020, och CAGR uppgår till 17,4 %.Branschen domineras idag av ett fåtal större aktörersamt ett flertal mindre entreprenörsledda aktörer.

    Aktivt i 7 månader och har redan försäljning i25 länder. På mycket kort tid har Cellink nått ut tillen global marknad, vilket får betraktas som etttydligt proof of concept. Affärsmodellen uppvisarhöga bruttomarginaler och stor skalbarhet vilketgör att Cellink kan gå med vinst redan 2017.

    Högt insiderägande med starka ägare. Vidfulltecknad emission uppgår insiderägandet till 86%. Styrelseordförande, som äger 10,5 %, har varitmed och utvecklat bolag som Hexatronic och Opus.Välrenommerade finansmannen Carl Bennet ägeräven 4,5 % av bolaget.

    Lagändring på kosmetikamarknaden öppnar upp förpotentiella partnerskap. Kosmetikabolag har storanvändning av 3D-Bioskrivare. EuropeiskaKommissionen har successivt förbjudit testande avkosmetika på djur. Enbart L’Oreal spenderar 6,2MEUR årligen på odlad hud. Avtal medkosmetikabolag kan på så vis agera katalysator förCellink.

    Hög värdering i relation till försäljning samt ingaregistrerade patent. De största riskerna i bolagetutgörs av att Cellink har två patentansökningar sominte registrerats samt att värderingen i relation tillförsäljningen är hög.

    Value Drivers

    Bull or Bear Analysis

    Fortsatt ökad försäljning skapar ytterligare legitimitet för Cellinks 3D-Bioskrivare

    Partnerskapsavtal med större aktörer

    Fler skrivare utvecklas och kunderbjudandet utökas

    Segmentet kosmetika kan exploateras med förfinat kunderbjudande

    Möjlighet att skriva ut mer avancerade vävnader befäster marknadspositionen ytterligare

    CELLINKAntal aktier * 6 895 847Börsvärde (MSEK) * 179,3Nettokassa (MSEK) 28,69EV (MSEK) * 150,6Handelsplats First NorthDatum för nästa rapport 18:e januari 2017HUVUDÄGAREErik Gatenholm 40,98 %*Hector Martinez 27,20 %*Fore C Investment (Göran Nordlund) 10,66 %*Carl Bennet AB 3,96 %*Gusten Danielsson 3,4 %*Jockum Svanberg 3,06 %*LEDNINGCEO Erik GatenholmStyrelseordförande Göran Nordlund

    ANALYTIKEREric Stussare [email protected] Ivarsson [email protected] AG Equity Research AB

    Riddargatan 35114 57 Stockholm

    Hemsida www.analystgroup.se

    Var vänlig tadelav våra ansvarsbegränsningar i slutet av rapporten

    11 1 1

    Introduction

    2 24 3 2

    Value Drivers Quality of Earnings Risk Profile Quality of Management

    3 4

    * Vid fullteckning

    0,00

    1,00

    2,00

    3,00

    4,00

    5,00

    6,00

    7,00

    2016 2017 2018 2019 2020 2021 2022

    Estimerad global marknadstillväxt för 3D-BioskrivareAlla siffror anges I MDRUSD

    2

  • Var vänlig tadelav våra ansvarsbegränsningar i slutet av rapporten

    CELLINK är en av världens första företag specialiserat pa ̊ ett standardiserat biobläck. Bolaget erbjuder produkter och tjänster såsom 3D-Bioskrivare, biobläck, och forskningssamarbeten inom bioutskrift. Kunderna är idag såväl forskningsinstitutioner som industriföretag med intresse av att skapa mänsklig vävnad för i första hand forskningsändamål. CELLINKs biobläck baseras pa ̊ över 10 års forskning och skapades av Professor Paul Gatenholm för cirka tre år sedan.

    Business Summary

    Investment Thesis 4Market Description 6Valuation 7Bull and Bear Scenarios 8Management & Board 9Swot 11CEO-interview & raiting 12Disclamer 13

    Content

    Analyst Groups ”bull and bear”-system syftar till att kort illustrera hur vi ser på utsikterna för ett bolag att lyckasi framtiden. Här vägs både historiska faktorer och händelser som ligger i framtiden in. Skalan går från bear 5,vilket är det lägsta betyget, till bull 5, vilket är det högsta. Bear 5 innebär att det är mycket lite som talar för attett bolag ska lyckas inom det området i framtiden, baserat på historisk data och hur detta förhåller sig tillframtiden. Bull 5 innebär således att det är väldigt mycket som talar för att ett bolag ska lyckas i framtiden,baserat på dess historik.

    Förtydligande av rating

    3

  • Var vänlig tadelav våra ansvarsbegränsningar i slutet av rapporten

    Välposititonerat för att kapitalisera på ökad efterfrågan av 3D-Bioutskrivning. Marknaden för 3D-Bioutskrivning förväntas växa med 17,4 % CAGR enligt Wise Guy Report. Cellink kan tjäna pengar på dels hårdvaran, dels kringtjänster, biobläcket och förbrukningsvaror. Med en unik teknologi för 3D-skrivarna, med lägre pris än konkurrenterna, har Cellink en stark position för att kunna ta marknadsandelar och hävda sig i konkurrensen. Nedan illustreras att den globala marknaden för 3D-Bioutskrivare förväntas växa med 17,4 % CAGR, enligt Wise Guy Report (2016), och att värdet idag är 2,33 mdUSD, en siffra som nästan väntas fördubblas fram till 2022.

    Cellink nyemitterar aktier till ett värde av 30 MSEK, där 23 MSEK sker i samband med börsintroduktionen. Dessförinnan har en riktad emission till Carl Bennet genomförts, där Bennet tecknat aktier för motsvarande 7 MSEK. Kapitalet från nyemissionen kommer användas till följande ändamål:

    Kosmetikamarknaden värd mer än 100 MEUR per år. Kosmetikabolag har stor användning av 3D-Bioskrivare, eftersom tekniken kan ersätta testande av kosmetika pa ̊ djur. Europeiska Kommissionen har stegvis förbjudit testande av kosmetika på̊ djur, vilket öppnar upp en stor potentiell marknad. Enbart L’Oreal lägger i dagsläget 6,2 MEUR på odlad hud, enligt Bloomberg.

    En annan gynnsam trend för bolaget är att 3D-Bioskrivning inte bara blir mer vedertaget i befintliga applikationsområden utan att antalet användningsområden växer. På så sätt väntas efterfrågan accelerera än mer vilket kommer driva tillväxten ytterligare.

    .

    Big Pharma kan nå signifikanta kostnads-besparingar med hjälp av 3D-Bioskrivare. De tolv största läkemedelsbolagen spenderar idag över 65 miljarder USD per år enbart pa ̊ tester enligt Statista.com. Genom att inte använda sig av människor i lika hög utsträckning utan istället kunna skriva ut specifika vävnader för tester finns stora pengar att spara för dessa bolag. Inom detta område är det troligt att Cellink kan nå en stark position genom partnerskap med en större aktör, på liknande sätt som konkurrenten Organovo slutit avtal med L’Oreal.

    Aktivt i 7 månader och har redan kunder i 25 länder. Cellink har sedan uppstart nått ut till en global marknad med försäljning i 25 länder. Kunderna består till 70 % av universitet, och bland kunderna kan högt ansedda universitet såsom Princeton University, Tufts University och Wake Forest University nämnas. Nedan illustreras försäljningens fördelning mellan bolagets olika marknader.

    Diversifierad affärsmodell med återkommande intäkter, höga bruttomarginaler och flera intäktsstrategier. Cellinks strategi bygger på att bista ̊ med allting som behövs för att skriva ut de vävnader forskare och företag behöver, snarare än att skriva ut mänsklig vävnad för transplantation. Affärsmodellen uppvisar stor skalbarhet och intäkter genereras primärt genom tre ben:

    • Engångsintäkter: försäljning av 3D-Bio-skrivarna Inkredible och Inkredible + (Estimerad bruttomarginal om 65 %)

    • Eftermarknad: tjänster, service och utbildning (Estimerad bruttomarginal > 65%)

    • Återkommande intäkter: biobläck och förbrukningsvaror (Estimerad bruttomarginal 75 %)

    Affärsmodellen är på så vis diversifierad över såväl affärsområden, typ av kunder (företag och universitet) och geografier, samtidigt som skalbarheten är stor. På nästa sida beskrivs affärsmodellen mer ingående.

    Investment Thesis

    Kommersialisering & marknadsföring 7 MSEK

    Fortsatt utveckling av biobläck 7 MSEK

    Nya generationer 3D-skrivare 7 MSEK

    Löpande verksamhet 6 MSEK

    0,00

    1,00

    2,00

    3,00

    4,00

    5,00

    6,00

    7,00

    2016 2017 2018 2019 2020 2021 2022Sverige, 9 %

    EU, 13 %

    USA, 52,7 %

    Övriga världen 25 %

    4

  • Var vänlig tadelav våra ansvarsbegränsningar i slutet av rapporten

    Engångsintäkter Genom att ha en lägre initial prisnivå för att locka kunder blir besluten inte lika stora för forskningsinstitutioner och företag för inköp av en skrivare, som de blir om inköp görs från konkurrenter. Prisbilden hos de mest framstående konkurrenterna är mellan 150 – 250 tUSD per skrivare. En uttalad strategi från Cellink är att initialt nå ut till många kunder för att därefter kunna vara med och vidareutveckla skrivare och andra kringtjänster i takt med att nya användningsområden upptäcks. På så vis kan en stark marknadsposition byggas upp, där skalbarheten är stor samtidigt som utbytbarheten minskar allteftersom kundrelationerna fördjupas.

    Eftermarknad: Cellink erbjuder även tjänster så som serviceavtal, workshops inom 3D-Bioskrivning och studier pa ̊ beställning, där projekten faktureras på såväl tim- som projektbasis. Bolaget engagerar sig även i externt organiserade projekt vars syfte är att utveckla teknik inom området.

    Återkommande intäkter: Cellink utvecklar löpande nya produkter och affärsmodellen fokuserar pa ̊ utveckling av specialiserade biobläck, anpassade för smala användningsområden. Biobläck säljs kontinuerligt och de fasta kostnaderna för biobläcket är låga. I denna kategori finns även förbrukningsmaterial till själva utskriftsprocessen. En aktiv kund behöver fylla pa ̊ med tillbehör pa ̊ regelbunden basis. Exempel pa ̊ tillbehör är nålar, cellmixer och petriskålar.

    Inträdesbarriärer byggs snabbt upp till följd av höga utbyteskostnader. Publikationer och verifiering av andra forskare och forskningsinstitut är kritiskt för att skapa legitimitet för 3D-Bioskrivarna och biobläcket. Cellink fokuserar därför på kunder inom universitet, som i dagsläget utgör 70 % av omsättningen på 3,6 MSEK. Cellerna som används tillsammans med biobläcket är kostsamma och anpassningsarbetet är initialt tidsskrävande. Detta leder till att utbytesgraden är låg när en kund väl påbörjat ett samarbete. Affärsmodellen inriktar sig mot att bygga upp långsiktiga samarbeten mellan Cellink och forskningsinstitutioner, till en relativt låg startkostnad från kunden, vilket skapar en stark position för Cellink.

    Med Cellinks försäljning under 2016 har bolaget redan visat prov på framgången i affärsmodellen samt att deras produkter håller hög standard. I takt med att allt fler kunder ansluter sig förväntas en större andel av omsättningen utgöras av biobläck, vilket ökar skalbarheten och bruttomarginalerna estimeras överstiga 70%.

    Flera utmärkelser ingjuter förtroende för framtiden.Cellink har vunnit flera utmärkelser för bolagetsinnovationsförmåga och höga tillväxttakt. Blandutmärkelserna kan bland annat Årets Start-Up iSerendipity Challenge samt årets exponentiella start-upfrån Nordic start-up Awards lyftas fram. Cellink har ävenvarit med på Nytekniks och Affärsvärldens 33-lista.

    Högt insiderägande, kompetent ledning och starkaägare. Insiderägandet uppgår till 86 %, förutsatt attemissionen blir fulltecknad. Ingen av de nuvarandeledande befattningshavarna eller styrelseledamöternasäljer aktier vid noteringen, utan istället har blandannat VD, CFO, styrelseordförande, Claes Dinkelspieloch GU Venture AB valt att teckna ytterligare aktier isamband med nyemissionen. I styrelsen finns blandannat Göran Nordlund, som varit med och utvecklatbolag som Transtema, Hexatronic och Opus, samt BengtSjöholm som har en bakgrund inom Getingekoncernen.Ledningens, styrelsens och de största ägarnas starkaindustriella nätverk och höga insiderägande ingjuterförtroende för att Cellink har rätt förutsättningar för denkommersialiseringsfas bolaget nu går in i.

    Hög värdering och inga registrerade patent. En av destörsta riskerna i Cellink är att bolaget i dagsläget harlåg försäljning i relation till börsvärdet. Om bolagetväxer i paritet med marknadstillväxten om 17,4 % förhelåret 2016 uppgår EV/S till 29,14. Detta kan jämförasmed branschsnittet för svenska likartade bolag, vilketuppgår till 8,2, motsvarande en premie om 255 %.Härröande från bolagets mål om att bli en betydandeaktör inom 3D-Bioskrivare och marknadsledande inombiobläck estimeras dock en betydligt högre tillväxttaktän marknaden. Detta i kombination med att VD ochflertalet insynspersoner väljer att teckna ännu fleraktier i samband med nyemissionen motiverar dockvärderingen.

    Cellink har i dagsläget ansökt om två patent, ett påbiobläcket och ett på 3D-bioskrivarna. Skulle dessa integodkännas så skulle konkurrenter kunna använda derasteknologi, vilket skulle försvaga deras ställning.

    Sett till P/B däremot, kommer Cellink till börsen med enprislapp på 4,71 x balansomslutningen. Snittet förlikartade svenska bolag är 12,03, vilket ger en uppsidapå 155 %. Den största posten i balansräkningen är dockkassan, vilken utgör 79 %. Justerat för immateriellatillgångar uppgår kvoten till 4,96, vilket kan jämförasmed branschsnittet om 25,7. Detta beror främst på attCellink inte i lika hög omfattning som branschkollegoraktiverat utvecklingskostnader som tillgångar ibalansräkningen. Sett till kvaliteten på balansräkningfinns det med andra ord potential för uppvärdering.

    Investment Thesis

    5

  • Var vänlig tadelav våra ansvarsbegränsningar i slutet av rapporten

    I dagsläget är det primärt forskningsinstitut, universitet, kosmetikabolag, läkemedelsbolag och bolag verksamma inom implantat som använder 3D-Bioskrivare och biobläck. Forskningsinstitut och universitet är tidiga användare och agerar som institutioner för att verifiera tekniken och undervisa den bredare marknaden. Det finns idag cirka 11 000 universitet med fakulteter inom kemi, biologi och Life Science världen över. Dessa intuitioner innehar samtliga användningsområden inom 3D-Bioskrivning, och uppskattningsvis har respektive institution behov av allt från ett par upp till ett hundratal 3D-Bioskrivare. Denna marknad är värd cirka 700 MSEK för Cellink, enbart sett till försäljning av en skrivare per institution.

    Gartner Inc. prognosticerade att det under 2015 såldes cirka 220 000 3D-skrivare över hela världen, en tillväxt om cirka 100 procent jämfört med 2014. Wells Fargo menar att 3D-utskrivning är det snabbast växande området inom IT och prognosticerar i linje med Gartner Inc. att 3D-utskrivning kommer att ha uppvisat en tillväxt om i genomsnitt 95 procent årligen mellan 2012 och 2017.

    Enligt en rapport från Wise Guy Reports beräknas marknaden för 3D-Bioskrivning uppgå till 6,120 MUSD år 2022. Detta ger en CAGR på 17.4 % från 2015 fram till 2022. Den höga tillväxten drivs av flertalet faktorer så som kraftigt ökande åldrad befolkning, ökande kroniska sjukdomar, ökad efterfråga av organ- och vävnadstransplantationer i kombination med begränsat utbud av donatorer av organ.

    Kosmetikabolag har, som tidigare nämnts, stor användning av 3D-Bioskrivare eftersom tekniken kan ersätta kosmetikatester pa ̊ djur. I etapper har Europeiska Kommissionen förbjudit denna typ av djurtester.

    En marknadsledande aktör inom kosmetikabranschen producerar odlad hud till ett värde av 6,2 MEUR årligen. Den befintliga tekniken för att framställa hud är väldigt tidskrävande. Cellink har en verifierad teknologi för testande pa ̊ hud och kosmetikabolagen förväntas efterfråga stora mängder biobläck de kommande åren.

    Deloitte estimerar att företag, snarare än konsumenter, kommer att utvecklas till att bli målmarknaden för 3D-skrivare. I en studie producerad av Deloitte framhålls att företag kommer att stå för cirka 95 % av volymen och 99 % av det ekonomiska värdet kopplat till 3D-skrivare.

    Under 2015 har ett stort antal universitet, forskningsinstitut och statliga organ intensifierat sin forskning inom 3D-Bioskrivning. Ökningen av kroniska sjukdomar och att människor genomsnittligen lever längre i kombination med den stora bristen på organ är nyckelfaktorer bakom denna intensifiering.

    Konkurrens

    För att vara en relativt ny marknad är marknaden för 3D-Bioskrivning konkurrensutsatt. De mer etablerade aktörerna inom 3D-Bioskrivare utgörs av regenHU och envisionTEC. En annan etablerad aktör inom 3D-Bioskrivning är det Nasdaq noterade Organovo som erbjuder cellvävnad. Vissa universitet och institutioner utvecklar även 3D-bioskrivare på egen hand. Trots att markanden är konkurrensutsatt är det få aktörer som innehar en liknande produkt med samma prestanda och låga prisbild som Cellink. Det är få konkurrenter som uppvisar samma bredd som Cellink, och som kan erbjuda såväl försäljning av 3D-Bioskrivare som biomaterial. Det amerikanska bolaget BioBots framstår dock verksamhetsmässigt väldigt likt Cellink gällande erbjudande till kund samt prisbild. Men värt att poängtera är att Cellink har kommit längre än BioBots i termer av att leverera biobläck.

    Market Description

    Bolag Börsnoterat År sedan start Affärsmodell Uppskattat pris per skrivare

    Cellink Ja 1*3D-Bioskrivare, biobläck & bio-

    utskrivningstjänster5 - 10 TUSD

    Organovo Ja 9 Cellvävnad NA

    regenHU Nej 9 3D-Bioskrivare & biobläck 150 - 250 TUSD

    envisionTEC Nej 14 3D-Bioskrivare 150 - 250 TUSD

    BioBots Nej 23D-Bioskrivare, biobläck & bio-

    utskrivningstjänster10 TUSD

    Konkurrenssituation

    6*Brutet räkenskapsår

  • Var vänlig tadelav våra ansvarsbegränsningar i slutet av rapporten

    Ovan illustreras värderingen för Cellink i relationtill ett svenskt sektorsnitt samt en jämförelse medden amerikanska börsnoterade konkurrentenOrganovo. Gemensamt för bolagen är bland annathöga EV/S-multiplar, vilket indikerar attförväntningarna från marknaden är höga på 3D-Bioskrivarbolag. Att Price/Book är lägre än sektornförklaras till stor del av att såväl Organovo somCellink har en hög andel kassa.

    Burn-rate

    I dagsläget uppgår Cellinks kostnadsmassa tillcirka 500 tSEK per månad, eller 6 MSEK per år.Kassan, efter att 21 MSEK från nyemissioneninvesterats, räcker fram till mars 2018 mednuvarande burn-rate, förutsatt att ingen försäljningsker. Eftersom Cellink står inför kraftig expansionär det troligt att utökning av personalstyrkan, sombestår av 12 personer idag, kommer ske.Personalkostnaderna väntas öka under 2017, till6,3 MSEK per år (beräknat på en årlig snittlön peranställd om 525 tSEK). Dessutom är det troligt attinvesteringarna i skrivare och biobläck kommeraccelerera för att Cellink ska kunna fortsätta varakonkurrenskraftiga. Således bedöms burn-rate ökatill cirka 850 tSEK per månad under 2017, vilketinnebär att kassan räcker till februari 2018, utan attförsäljning tas i beaktning. Med den högaestimerade omsättningstillväxten om 17,4 % CAGRi kombination bruttomarginal över 65 % är dettroligt att bolaget klarar att finansiera sin operativaverksamhet och därigenom undvika nyemission.

    Nedan anges estimat fram till 2018. Impliceradförsäljning baseras på bruttomarginaler om 65 %,och denna post anger hur stor försäljningenbehöver vara för att täcka de operationellakostnaderna. Detta illustreras även i grafen tillhöger. Alla siffror avser MSEK, och siffrorna ärbaserade på slutet av kalenderåret.

    Nedan illustreras hur bolagets kassa förväntasutvecklas under kommande år. Givet denimplicerade försäljningen i tabellen till vänsterbedöms riskerna för nyemission som låga.

    Slutsats

    Tillföljd av investeringar och personalkostnader,estimeras att tillväxten behöver vara 133 % CAGRunder 2017 och 2018. Givet bolagets mål om attvara en betydande aktör inom 3D-Bioskrivning ochmarknadsledande inom biobläck i kombination medatt nuvarande omsättning befinner sig på låganivåer, antas den höga tillväxttakten rimlig.

    Cellink har befintlig försäljning och har sedanårsskiftet lyckats nå ut till kunder i 25 länder, vilketfår betraktas som ett tydligt proof of concept, samtatt risker relaterade till misslyckadkommersialisering är låga. Den operationella riskenär således lägre än för sektorn, vilket motiverar enpremie. Bolaget har inte aktiveratutvecklingskostnader i lika hög omfattning sompeers vilket höjer kvaliteten på tillgångarna ibalansräkningen. Med högt insiderägande ochkapitalstarka ägare finns även en uthållighet ihändelse av att nyemission skulle ske.Sammantaget torde detta skapa en premiegentemot likartade medtech-bolag.

    ValuationBolag Kassa, %* Immateriella tillgångar % Soliditet P/B EV/S

    Cellink 78,9 % 4,89 % 85 % 4,71 29,14 **

    Organovo 92% 0% 92% 5,1 38

    Sektorn 6,86 % 33 % 41 % 12,03 8,02

    År Kassa (utanförsäljning)

    Implicerad försäljning, bruttomarginal 65 %

    Burn-rate

    2016E 11 6,2 5,5

    2017E 0,85 7,3 10,2

    2018E -10,9 16,8 11,8

    * Andel kassa % avser kassans andel av balansräkningen

    ** Baserat på att bolagets månatliga försäljning fortsätter i samma takt under resterande månader för 2016.

    kr-

    kr2 000 000

    kr4 000 000

    kr6 000 000

    kr8 000 000

    kr10 000 000

    kr12 000 000

    kr14 000 000

    kr16 000 000

    kr18 000 000

    2016E 2017E 2018E

    Kassa, vid försäljning Burn-rate Försäljning

    7

  • Var vänlig tadelav våra ansvarsbegränsningar i slutet av rapporten

    Bullscenario Bearscenario

    Bull and Bear Scenarios

    I ett Bullscenario estimeras Cellink fortsättapenetrera marknaden i ett högt tempo och på så vissnabbt lyckas ta marknadsandelar. Efterfrågan på 3D-Bioutskrivare förväntas huvudsakligen riktas motbolag som kombinerar en prismedveten strategi medkomplexitet. Detta är ett område som bolaget harnischat sig mot med en av marknadens mestkostnadseffektiva 3D-Bioskrivare och tillhörandebiobläck. Detta leder till att Cellink växer betydligtsnabbare än marknadens tillväxttakt om 17,4 %.Skulle bolaget lyckas erhålla partneravtal med enstörre aktör inom antigen Big Pharma ellerkosmetikabranschen, likt Organovos avtal medL’Oreal, är potentialen för omsättningsökning mycketstor. Vid ett sådant scenario är det rimligt att anta attCellinks CAGR överstiger 100 % och attbruttomarginalerna successivt stiger mot 75 % i taktmed att kundrelationer fördjupas och eftermarknads-potentialen ökar. Då eftermarknaden är associeradmed högre marginaler kommer skalbarheten iaffärsmodellen tydligt märkas av, vilket ävenavspeglar sig i en allt högre rörelsemarginal.

    I dagsläget finns det cirka 11 000 universitet världenöver som är potentiella kunder. Skulle Cellink lyckaspenetrera 3 % av den marknaden, med detkonservativa åtagandet att varje universitet köper intvå 3D-Bioskrivare, skulle det generera en försäljningom 42,7 MSEK. Värt att notera är att försäljingen om42,7 MSEK endast är baserad på försäljning av 3D-Bioskrivare och tar inte hänsyn till någon merförsäljning av biobläck eller förbrukningsvaror.

    I ett Bearscenario har Cellink svårigheter att tamarknadsandelar och nå ett kommersielltgenombrott. I scenariot hårdnar konkurrensen inom3D-Bioskrivare, där nya innovativa tekniker försvårarmöjligheterna för att just Cellinks 3D-Bioskrivare skanå framgångar. Detta resulterar i att bolagetmisslyckas med att nå tillräcklig försäljning för atttäcka de operationella kostnaderna, vilket leder till ennyemission under 2018. Vidare nekas även bolagetspatentansökningar på både biobläcket och 3D-Bioskrivarna, vilket öppnar upp möjligheter för merresursstarka konkurrenter att kopiera bolagetsaffärsmodell.

    Cellink kommer vid ett sådant utfall ha svårigheter attnå lönsamhet och följaktligen kommer bolaget attfortsätta bränna kassa framgent och enligt estimatenför bolagets burn-rate skulle det innebära attytterligare kapitalanskaffning skulle behövagenomföras under 2018.

    Under dessa förutsättningar tvingas Cellink sänkapriserna på såväl 3D-Bioskrivare someftermarknadstjänster, vilket slår motbruttomarginalerna. En lägre penetrationsgrad lederockså till att bolaget får det svårare att fördjupakundrelationer samt att ytterligare investeringarbehöver göras i teknologin.

    0%

    10%

    20%

    30%

    40%

    50%

    60%

    70%

    kr(4 000 000)

    kr(2 000 000)

    kr-

    kr2 000 000

    kr4 000 000

    kr6 000 000

    kr8 000 000

    kr10 000 000

    kr12 000 000

    kr14 000 000

    2016E 2017E 2018E 2019E

    Omsättning RörelsekostnaderRörelseresultat Bruttomarginal

    0%

    10%

    20%

    30%

    40%

    50%

    60%

    70%

    80%

    kr(10 000 000)

    kr-

    kr10 000 000

    kr20 000 000

    kr30 000 000

    kr40 000 000

    kr50 000 000

    kr60 000 000

    kr70 000 000

    kr80 000 000

    kr90 000 000

    2016E 2017E 2018E 2019E

    Omsättning RörelsekostnaderRörelseresultat Bruttomarginal

    8

  • Var vänlig tadelav våra ansvarsbegränsningar i slutet av rapporten

    Göran Nordlund

    Styrelsens ordförande

    Antal aktier: 724 808. Ägarandel i Cellink 10,66 %*

    Nordlund är entreprenör, privatinvesterare och sitter med i flertalet styrelser. Under de senaste 15 åren har Nordlund drivit egen verksamhet i Fore C Investment där han investerat i ett flertal entreprenor̈sledda bolag och arbetat aktivt med dessa bolags affärsutveckling, tillväxt och finansiering.

    Övriga uppdrag och historik: Hexatronic, Group AB, Transtema Group AB, Opus Group AB.

    Erik Gatenholm

    Verkställande Direktör och Styrelseledamot

    Antal aktier: 2 787 340. Ägarandel i Cellink: 40,98 %*

    Gatenholm innehar en BSc i Business Management från Virginia Tech University och snart en Master of Science i Innovation & Industrial Management från Goẗeborgs universitet. Gatenholm har erfarenhet inom kommersialisering av bioteknik och life science-teknik från USA. Han är specialiserad inom marknadsföring, försäljning och kommersialisering av nya produkter.

    Klementina Österberg

    Styrelseledamot

    Antal aktier: 68 700 (via GU Ventures AB). GU Ventures AB ägarandel i Cellink 1 %*

    Österberg är VD for̈ GU Ventures AB. GU Ventures AB utvecklar och investerar i bolag med koppling till Goẗeborgs universitet. Österber har under många år arbetat med att kommersialisera forskningsbaserade idéer i nya for̈etag inom bl.a. den medicintekniska sektorn.

    Övriga uppdrag och historik: Styrelseledamot i Alzinova, Toleranzia AB, PExA AB

    Bengt Sjöholm

    Styrelseledamot

    Antal aktier: 43 213. Ägarandel i Cellink: 0,64 %*

    Sjoḧolm har lång erfarenhet från den medicintekniska industrin, i huvudsak inom läkemedels- och sjukvårdssektorn. Bengt har bl.a. haft ledande positioner inom Getingekoncernen och Tylok̈oncernen.

    Management & Board

    * Vid fullteckning

    9

  • Var vänlig tadelav våra ansvarsbegränsningar i slutet av rapporten

    Hector Martinez

    Styrelseledamot och CTO/CSO

    Antal aktier: 1 844 840. Ägarandel i Cellink 27,2 %*

    Martinez är medgrundare av CELLINK. Disputerade inom Tissue Engineering från Chalmers Tekniska Hog̈skola och har 7 års erfarenhet inom biomaterial, vävnadsteknik och 3D-Bioutskrivning. Hector är en biomedicinsk ingenjor̈, med särskilt intresse for̈ biomimetik och biologiska system.

    Magnus Jonsson

    Styrelseledamot

    Antal aktier: 68 728 (Västkusten Affärsänglar AB) . Ägarandel i Cellink: 1 %*

    Jonsson har främst erfarenhet från fordonsindustrin där han huvudsakligen arbetat med produktutveckling. I sin senaste operativa roll var han ansvarig for̈ Volvo Cars samtliga utvecklingsaktiviteter. Under de senaste 5 åren har Magnus huvudsakligen ägnat sig åt styrelsearbete i sma ̊ och medelstora bolag med inriktning pa ̊ avancerad teknik. Är även styrelseordförande i Powercell Sweden AB.

    Gusten Danielsson

    CFO

    Antal aktier: 231 410. Ägarandel i Cellink 3,4 %*

    Gusten har en MSc i Innovation & Industrial Management från Goẗeborgs universitet. Under sin studietid var han bland annat for̈valtningschef samt VD for̈ Handels Capital Management AB och bedrev därefter ett konsultbolag inom Corporate Finance där han deltog i både M&A affärer och kapitalanskaffningar.

    Management & Board

    * Vid fullteckning

    10

  • Strengths Weaknesses

    Opportunities Threats

    Var vänlig tadelav våra ansvarsbegränsningar i slutet av rapporten

    • Diversifierad affärsmodell med återkommande intäkter och stor skalbarhet.

    • Kompetenta och kapitalstarka ägare med relevant branscherfarenhet.

    • Bolaget har under sin korta historik lyckats väl med marknadsföring, etablering och bearbetning av nya kunder.

    • Attraktivt och komplett erbjudande till kunderna samtidigt som prisbilden är låg jämfört med konkurrenternas.

    • Begränsad historik.• Inga godkända patent ännu.

    • Hög värdering sett till nuvarande försäljning.

    • Hög tillväxt i den underliggande marknaden.

    • Lagändring från Europeiska kommissionen avseende djurförsök öppnar upp för en mångmiljon-marknad.

    • Big Pharma kan uppnå stora kostnadsbesparingar genom att använda Cellinks tjänster jämfört med att endast göra undersökningar på människor.

    • Fragmenterad marknad gör att Cellink kan skapa ett first-mover advantageom de fortsätter att hålla en hög tillväxttakt framöver.

    • Marknaden uppvisar hög tillväxt och troligtvis kommer konkurrensen tillta de kommande åren.

    • Flera universitet utvecklar 3D-bioskrivare i egen regi.

    • Big Pharma kommer troligtvis intensifiera interna satsningar för att spara pengar genom 3D-bioskrivare.

    11

  • Hur skiljer sig ert biobläck från konkurrenter som BioBotsoch regenHU? RegenHu och Biobots använder sig avstandardiserade och välkända biomaterial som biobläckistället för ett nytt biomaterial som blivit optimerat förbioprinting. De materialen de använder är gelatin ochcollagen, båda två baserade på djurvävnader. Derasbiobläck kan dessutom inte heller patenteras eftersom detanvänts så länge redan. Cellink erbjuder ett nytt materialsom kan patenteras och som erbjuder en helt ny innovativlösning för bioprinting av mänskliga vävnader. Dessutomär det baserat på helt renewable material.

    I vilket applikationsområde ser ni störst potential?CELLINKs marknad är strukturerad upp i fyraaffärsområden: akademisk forskning, kosmetika industrin,läkemedels industrin, och organ transplantationsmarknaden. CELLINKs produkt appliceras redan iakademisk forskning och kosmetiska industrin förframtagandet av nya produkter, och kommer applicerasmer i läkemedels marknaden i framtiden. Sedan kommerteknologin också appliceras i organ och transplantationsmarknaden i framtiden genom att erbjuda forskare ochläkare en teknologi plattform som kan användas för attprinta fullt fungerande organ. Just nu ser vi störst potentialinom kosmetika marknaden som redan bevisat sig varalukrativ för globalt ledande kosmetika företag.

    Vilket affärsområde prioriterar ni för tillfället och varför?Just nu satsar vi otroligt starkt på den akademiskamarknaden eftersom den kommer hjälpa oss att få enbättre helhetsbild av hur den globala 3D-Bioprintingmarknaden ser ut och vart den rör sig emot. Att hamajoriteten av kunder inom akademisk forskning betyderatt vi är väl medvetna om nya forskningsområden ochtrender.

    Nästa satsning är kosmetika marknaden och vi arbetar justnu väldigt aktivt på att optimera våra biobläck förprintandet av hudvävnad.

    När förväntar ni er att era patentansökningar ska gåigenom? Vi har förhoppningar på att det första skall gåigenom 2017-2018.

    Hur ser ni på möjligheten att ingå ett partneravtal med enstörre aktör inom Big Pharma eller kosmetiskabranschen?Detta ser vi inte bara som en möjlighet utan också ett måsteför att kunna expandera in i de två stora marknaderna:kosmetika och läkemedelsforskning. Vi ser också attframtidens kommersialisering för tillväxtbolag handlar tillmestadels av samarbeten med väletablerade aktörer och vianser det är oerhört viktigt för oss att så tidigt som möjligtbörja skapa samarbeten.

    Vilka är era största utmaningar det kommande åren?Den största utmaningen som vi ser det handlar mycket omuppskalning och produktion av 3d bioskrivarna. Vi har enstark orderingång och vi vill behålla en stadig utleverans avprodukter med kort leadtime, vilket kommer kräva organisktillväxt på produktionssidan. Sedan är det också otroligtviktigt att vi behåller kvalitén på produkterna när företagetväxer.

    Nämn tre anledningar till varför CELLINK är en intressantinvestering? Cellink har sedan i början på året redan börjatbevisa affärsmodellen, nått ut till kunder i mer än 25 ländervärlden över, och har en helt fantastiskt team med styrelsen,management teamet, och anställda som tillför en grymtbred expertisbas som kommer hjälpa oss ta detta företag tillatt bli en global ledare inom 3D Bioprinting. Tre ord på det:Let's Go Cellink!

    Erik Gatenholm, VD Cellink2016-10-13

    4

    3

    Var vänlig tadelav våra ansvarsbegränsningar i slutet av rapporten

    4

    CEO-Interview

    RatingValue Drivers

    Quality ofEarnings

    Risk Profile

    Quality of Management

    Overall view

    3

    Marknadstillväxt med en CAGR om 17,4 % fram till 2022, stort antal applikationsområden som ständigt ökar samt hög efterfråga indikerar goda möjligheter för hög tillväxt framgent. Vidare kan eventuella partneravtal med aktörer inom Big Pharma och kosmetiskabranschen agera katalysator för kursen.

    Cellink går för tillfället med förlust och uppvisar negativa kassaflöden, men om Cellink aktiverat pågående utvecklingsprojekt hade bolaget redovisat ett positivt kassaflöde redan första året. Detta, samt att bolaget trots dess korta historik, redan lyckats nå ut med produkter på marknaden i över 25 länder höjer betyget.

    Värderingen anses hög med en låg försäljning sett till börsvärde och inga registrerade patent, där konkurrenter kan anamma teknologin höjer riskprofilen. Marknaden för 3D-Bioutskrivning är även konkurrensutsatt vilket kan skapa svårigheter för Cellink att penetrera marknaden. Att ledningen valt att teckna i emissionen ingjuter dock förtroende, vilket sänker risken något.

    Högt insiderägande, kompetent ledning och starka huvudägare. Bolaget har vunnit diverse prestigefulla priser och styrelseordförande har utvecklat bolag som Hexatronic, Transtema och Opus, vilket i kombination med att Bennet är 4:e största ägare motiverar en hög rating.

    Hög marknadstillväxt med ett brett spektrum av applikationsområden, unikt kunderbjudande, en intressant affärsmodell och ett proof of concept talar för Cellink. Hög värdering, hög konkurrens samt avsaknad av patent utgör de största riskerna.

    12

  • Var vänlig tadelav våra ansvarsbegränsningar i slutet av rapporten

    Definition of ratiosMultipel Förklaring

    Kassa % Anger hur stor andel av balansräkningen som utgörs av kassa

    Immateriella tillgångar % Anger hur stor andel av balansräkningen som utgörs av immateriella tillgångar

    P/B Indikerar hur högt balansräkningen värderas. Beräknas som: marknadsvärde/balansomslutning

    EV/S Indikerar hur bolaget är värderat i relation till försäljningen. Beräknas som: Enterprise Value/Omsättning.

    13

  • AnsvarsbegränsningDessa analyser, dokument eller annan information härrörande AG Equity Research AB (vidare AG) är framställt iinformationssyfte, för allmän spridning, och är inte avsett att vara rådgivande. Informationen i analyserna ärbaserade på källor och uppgifter samt utlåtanden från personer som AG bedömer tillförlitliga. AG kan dock aldriggarantera riktigheten i informationen. Alla estimat i analyserna är subjektiva bedömningar, vilka alltid innehåller vissosäkerhet och bör användas varsamt. AG kan därmed aldrig garantera att prognoser och/eller estimat uppfylls. Dettainnebär att investeringsbeslut baserat på information från AG eller personer med koppling till AG, alltid fattassjälvständigt av investeraren. Dessa analyser, dokument och information härrörande AG är avsett att vara ett av fleraredskap vid investeringsbeslut. Investerare uppmanas att komplettera med ytterligare material och information samtkonsultera en finansiell rådgivare inför alla investeringsbeslut. AG frånsäger sig allt ansvar för eventuell förlust ellerskada av vad slag det må vara som grundar sig på användandet av material härrörande AG.

    Intressekonflikter och opartiskhetFörattsäkerställaAnalystGroupsoberoendeharAnalystGroupinrättatinternareglerföranalytiker,utöverdettasåharallaanalytikerundertecknatavtalivilketdeärskyldigaattredovisaallaeventuellaintressekonflikter.DessaharutformatsförattsäkerställaattFinansinspektionensföreskrifterochallmännarådominvesteringsrekommendationerriktadetillallmänhetensamthanteringavintressekonflikter(FFFS2005:9)efterlevs.

    Bull and Bear- RekommendationerRekommendationernaiformavbullalternativtbearsyftartillattförmedlaenövergripandebildavAnalystGroupsåsikt.Rekommendationernaärutarbetadegenomnoggrannaprocesserbeståendeavkvalitativresearchochövervägningsamtdiskussionmedandrakvalificeradeanalytiker.

    DefinitionBullBullärenmetaforförenpositivtinställdvypåframtiden.Termenanvändsförattbeskrivadefaktorersomtalarförenpositivframtidsutvecklingförbolaget.DefinitionBearBearärenmetaforförenpessimistiskinställdvypåframtiden.Termenanvändsförattbeskrivadefaktorersomtalarförennegativframtidsutvecklingförbolaget.

    ÖvrigtDenna analys är en så kallad uppdragsanalys.Detta innebär att AnalystGrouphar mottagit betalning för att göraanalysen.Uppdragsgivaren Cellink (vidare Bolaget) har inte haftnågon möjlighet att påverka dedelar där AnalystGrouphar haftåsikter omBolaget,framtida värdering eller annat som skulle kunna tänkas utgöra en subjektivbedömning.Dedelar som Bolaget har kunnat påverka är dedelar som är rentfaktamässiga och objektiva.Analytiker äger inte aktier i bolaget.

    UpphovsrättDenna analys är upphovsrättsskyddad enligt lag och är AG Equity Research AB egendom (© AG Equity Research AB2014-2015). Delning, spridning eller motsvarande till en tredje part är tillåtet under förutsättning att analysen delas ioförändrad form.

    Var vänlig tadelav våra ansvarsbegränsningar i slutet av rapporten 14